HHsearch alignment for GI: 254780426 and conserved domain: COG2905

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].
Probab=97.30  E-value=0.0005  Score=46.23  Aligned_cols=71  Identities=21%  Similarity=0.479  Sum_probs=63.4

Q ss_pred             HHHHHHHHHHC---CCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHH
Q ss_conf             99999998730---4775764131200129998630103677897986598179984188664224102999998766
Q gi|254780426|r   73 TEKEIFNNILR---FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS  147 (320)
Q Consensus        73 ~E~~ii~~vl~---l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~  147 (320)
T Consensus       197 T~~dl~~~v~~~g~~~~~~V~evmT--~p~~svd~~~~~feAml~m~r~~I~hl~V~e~g--q~~Gilt~~dIl~l~s  270 (610)
T COG2905         197 TRKDLRSRVIADGRSKTQKVSEVMT--SPVISVDRGDFLFEAMLMMLRNRIKHLPVTEDG--QPLGILTLTDILRLFS  270 (610)
T ss_pred             EHHHHHHHHHHCCCCCCCCHHHHHC--CCCEEECCCCHHHHHHHHHHHHCCCEEEEECCC--EEEEEEEHHHHHHHHC
T ss_conf             2277789998658974233545414--684454476569999999998077442361189--0467766999997617