HHsearch alignment for GI: 254780426 and conserved domain: COG4109

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription].
Probab=99.51  E-value=9.2e-14  Score=110.05  Aligned_cols=131  Identities=23%  Similarity=0.314  Sum_probs=116.2

Q ss_pred             HHHHHHHHHC-----CCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHH
Q ss_conf             9999998730-----47757641312001299986301036778979865981799841886642241029999987662
Q gi|254780426|r   74 EKEIFNNILR-----FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISH  148 (320)
Q Consensus        74 E~~ii~~vl~-----l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~  148 (320)
T Consensus       170 VAtmIN~Al~n~lIKkdI~~Vedi~~P~~~~~yL~~~d~v~d~~~l~~kt~~sRfPVvn~~~-kvvGvVt~rDv~~----  244 (432)
T COG4109         170 VATMINKALSNQLIKKDIITVEDIMTPLEDTSYLRETDTVEDWLDLVEKTGHSRFPVVNRSM-KVVGVVTMRDVLD----  244 (432)
T ss_pred             HHHHHHHHHHHHHHHHHEEEHHHHCCCCCCCEECCCCCCHHHHHHHHHHCCCCCCCEECCCC-EEEEEEEEHHHHC----
T ss_conf             99999899877666443255877446443432324645099999999971987341331442-6999998346444----


Q ss_pred             CCCCCCCCCCCCCCCHHHHCCC-CEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHH
Q ss_conf             2356432233345767885156-579717885123234320135651165407766204667588999987
Q gi|254780426|r  149 MYAKTNNINLNIQLSESNLIKN-ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM  218 (320)
Q Consensus       149 ~~~~~~~~~~~~~~~l~~~~r~-~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~iv  218 (320)
T Consensus       245 ---------~~~~t~ieKVMtknp~tv~~~tsVAsvaq~MiwE~iem~PVv~~n~~llGiitR~dvlk~lq  306 (432)
T COG4109         245 ---------KKPSTTIEKVMTKNPITVRAKTSVASVAQMMIWEGIEMLPVVDSNNTLLGIITRQDVLKSLQ  306 (432)
T ss_pred             ---------CCCCCCHHHHHCCCCEEECCCCHHHHHHHHHHHCCCEEEEEECCCCEEEEEEEHHHHHHHHH
T ss_conf             ---------79986177774269755425226889988887645526568837861898988999999998