HHsearch alignment for GI: 254780426 and conserved domain: KOG2550

>KOG2550 consensus.
Probab=97.72  E-value=6.6e-05  Score=52.00  Aligned_cols=125  Identities=17%  Similarity=0.208  Sum_probs=100.3

Q ss_pred             HHHHHHHHHHHCCCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCC--CCCCCCCEEHHHHHHHHHHC
Q ss_conf             8999999987304775764131200129998630103677897986598179984188--66422410299999876622
Q gi|254780426|r   72 ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS--LDNPRGMVHMRDVISYISHM  149 (320)
Q Consensus        72 ~~E~~ii~~vl~l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~--~d~iiGiv~~kDll~~~~~~  149 (320)
T Consensus        98 e~QA~~v~~vK~~~~g~~~-------dp~v~sp~~tvg~v~~~k~~~gF~g~pvTe~g~~~~KLvG~vtsrdi~f~-~--  167 (503)
T KOG2550          98 EDQADMVRRVKNYENGFIN-------NPIVISPTTTVGEVKEAKEKHGFSGIPVTEDGKRGSKLVGIITSRDIQFL-E--  167 (503)
T ss_pred             HHHHHHHHHHHHHHCCCCC-------CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHHHH-H--
T ss_conf             8877888888875225456-------86203775431055652065663354211577546515777742023455-3--


Q ss_pred             CCCCCCCCCCCCCCHHHHCCC-CEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             356432233345767885156-579717885123234320135651165407766204667588999
Q gi|254780426|r  150 YAKTNNINLNIQLSESNLIKN-ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       150 ~~~~~~~~~~~~~~l~~~~r~-~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus       168 ---------~~~~~~~~vmt~~~~~~~~gi~l~~~neiL~~~kkGkl~iv~~~gelva~~~rtDl~k  225 (503)
T KOG2550         168 ---------DNSLLVSDVMTKNPVTGAQGITLKEANEILKKIKKGKLPVVDDKGELVAMLSRTDLMK  225 (503)
T ss_pred             ---------CCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEECCCCCEEEEEEHHHHHH
T ss_conf             ---------4551124330344301444466778899987631486523436776233433345665