HHsearch alignment for GI: 254780426 and conserved domain: PRK01862

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional.
Probab=99.26  E-value=4.8e-11  Score=92.26  Aligned_cols=124  Identities=15%  Similarity=0.214  Sum_probs=105.2

Q ss_pred             CCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             47757641312001299986301036778979865981799841886642241029999987662235643223334576
Q gi|254780426|r   84 FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLS  163 (320)
Q Consensus        84 l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~  163 (320)
T Consensus       453 l~~~~v~dvm~~--~~~~v~~~~~l~e~~~~~~~~~~~~~~Vvd~~g-~l~Giv~l~dl~~~~~~~~-------~~~~~~  522 (583)
T PRK01862        453 LRTTQMRELIQP--AQTVVPLTASVADMTRVFLEYPVKYLYVTDDDG-RFRGAVALKDITSDLLDKR-------DTTDKT  522 (583)
T ss_pred             HHHCCHHHHCCC--CCCEECCCCCHHHHHHHHHHCCCEEEEEECCCC-EEEEEEEHHHHHHHHHCCC-------CCCCCC
T ss_conf             850809996387--882349999899999999847970799988999-7999978999887751635-------556460


Q ss_pred             HHHHCC-CCEEECCCCCHHHHHHHHHCCCCCCEEEEECCC--CCEEEEEHHHHHHHH
Q ss_conf             788515-657971788512323432013565116540776--620466758899998
Q gi|254780426|r  164 ESNLIK-NILFVPSSMLVSDLLTNIQESRIRMALVIDEHG--GTDGLVSYEDIVSVL  217 (320)
Q Consensus       164 l~~~~r-~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G--~~~GiVTleDIle~i  217 (320)
T Consensus       523 ~~~~~~~~~~~l~~~~sL~~al~~f~~~~~~~LPVVd~~~~~~lvGiit~~dil~aY  579 (583)
T PRK01862        523 AADYAHTPFPLLTPDMPLRDALEHFMAFQGERLPVVESEASPTLAGVVYKTSLLDAY  579 (583)
T ss_pred             HHHHHCCCCCEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEEHHHHHHHH
T ss_conf             999817999578899989999999996699877899559998799997789999999