HHsearch alignment for GI: 254780426 and conserved domain: PTZ00314

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional.
Probab=96.87  E-value=0.00077  Score=45.02  Aligned_cols=60  Identities=12%  Similarity=0.163  Sum_probs=53.1

Q ss_pred             CCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHH
Q ss_conf             477576413120012999863010367789798659817998418866422410299999876
Q gi|254780426|r   84 FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYI  146 (320)
Q Consensus        84 l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~  146 (320)
T Consensus       155 d~~~~v~~vMt~--~lvt~~~~isl~eA~~ll~~~kieklpvVd~~g-~L~glit~kDi~k~~  214 (499)
T PTZ00314        155 DKSTPVSEIMTT--DLVVGRYPITLEDANDVLNRSRKGVLPIVNDNG-ELVALVSRSDAVKNR  214 (499)
T ss_pred             CCCCCHHHHHCC--CCEEECCCCCHHHHHHHHHHHHHCCCEEECCCC-CEEEEEECCHHHHHH
T ss_conf             677588886156--726725999999999999860331230665789-589986303487753