HHsearch alignment for GI: 254780426 and conserved domain: TIGR01137

>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857 This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases. Cysteine synthase (O-acetylserine (thiol)-lyase) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid - the function of many of these enzymes is unproven.; GO: 0004122 cystathionine beta-synthase activity, 0019343 cysteine biosynthetic process via cystathionine, 0005737 cytoplasm.
Probab=98.20  E-value=9.5e-06  Score=57.52  Aligned_cols=130  Identities=23%  Similarity=0.314  Sum_probs=99.8

Q ss_pred             CCCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCCCEEEEEC--------CCCCCCCCCEEHHHHHHHHHHCCCCCC
Q ss_conf             047757641312001299986301036778979865981799841--------886642241029999987662235643
Q gi|254780426|r   83 RFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK--------NSLDNPRGMVHMRDVISYISHMYAKTN  154 (320)
Q Consensus        83 ~l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~--------~~~d~iiGiv~~kDll~~~~~~~~~~~  154 (320)
T Consensus       362 ~~~~~~v~~l~L~--~~v~~~~t~tv~~ai~iLre~GfdQ~PVv~pga~~P~veag-~v~G~v~l~~lL~~l~~~~a~~~  438 (527)
T TIGR01137       362 VFGNARVKDLHLP--ALVTVHPTETVGDAIEILREYGFDQLPVVKPGAAEPDVEAG-KVLGSVTLRELLSALFAKKAKLE  438 (527)
T ss_pred             HHCCCEEECCCCC--CCEEECCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-EEEEEEEHHHHHHHHHHCCCCCC
T ss_conf             4256364156688--73454676408999999997487307620778888972353-47887426778999984246755


Q ss_pred             CCCCCCCCCHHHHC---------------CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCC------------CEEE
Q ss_conf             22333457678851---------------56579717885123234320135651165407766------------2046
Q gi|254780426|r  155 NINLNIQLSESNLI---------------KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGG------------TDGL  207 (320)
Q Consensus       155 ~~~~~~~~~l~~~~---------------r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~------------~~Gi  207 (320)
T Consensus       439 D~v~Gkyldfk~~~~Fndvssynenk~~~~~~~~i~~~~~l~~L~~~le~--~~~a~V~~e~~pyhstGkssqrq~~~gv  516 (527)
T TIGR01137       439 DAVSGKYLDFKVMSRFNDVSSYNENKSKKKKFIQIGEGEKLADLSKFLEK--NSSAIVVEEGKPYHSTGKSSQRQMVIGV  516 (527)
T ss_pred             CCCCCCCHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHHCC--CCCEEEEECCCCCCCCCCCCCCEEEEEE
T ss_conf             44343000344453210100010102467676544677518999998516--9618997078232125654243278986


Q ss_pred             EEHHHHHHHH
Q ss_conf             6758899998
Q gi|254780426|r  208 VSYEDIVSVL  217 (320)
Q Consensus       208 VTleDIle~i  217 (320)
T Consensus       517 VT~~DLL~fL  526 (527)
T TIGR01137       517 VTKIDLLSFL  526 (527)
T ss_pred             EEHHHHHHHC
T ss_conf             4412244312