HHsearch alignment for GI: 254780426 and conserved domain: cd02205

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generali
Probab=97.41  E-value=0.00075  Score=45.09  Aligned_cols=83  Identities=22%  Similarity=0.294  Sum_probs=58.9

Q ss_pred             CCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCCEEEEECCCCHH
Q ss_conf             65797178851232343201356511654077662046675889999874222100000000124677337830453599
Q gi|254780426|r  170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE  249 (320)
Q Consensus       170 ~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g~~~v~G~~~l~  249 (320)
T Consensus         2 ~~~~v~~~~~l~~a~~~m~~~~~~~~~Vvd~~~~~~G~it~~dl~~~~~~~~~~~~~~---~~~~~~~~~~~v~~~~~~~   78 (113)
T cd02205           2 DVVTVSPDDTVAEALRLMLEHGISGLPVVDDDGRLVGIVTERDLLRALAEGGLDPLVT---VGDVMTRDVVTVSPDTSLE   78 (113)
T ss_pred             CCEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEEEHHHHHHHHHHCCCCCCCC---EEEEEECCCEEEEECCHHH
T ss_conf             9779689298999999999839809999939995999998899898876315741033---0456750546897321177


Q ss_pred             HHHHHH
Q ss_conf             999982
Q gi|254780426|r  250 ELAKII  255 (320)
Q Consensus       250 ~l~~~l  255 (320)
T Consensus        79 ~~~~~~   84 (113)
T cd02205          79 EAAELM   84 (113)
T ss_pred             HHHHHH
T ss_conf             999999