HHsearch alignment for GI: 254780426 and conserved domain: cd04584

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria. Acetoin is a product of fermentative metabolism in many prokaryotic and eukaryotic microorganisms. They produce acetoin as an external carbon storage compound and then later reuse it as a carbon and energy source during their stationary phase and sporulation. In addition these CBS domains are associated with a downstream ACT domain, which is linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The in
Probab=99.44  E-value=7.6e-13  Score=104.03  Aligned_cols=116  Identities=17%  Similarity=0.298  Sum_probs=95.5

Q ss_pred             EEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCC--CCCCCCCCCCCHHHHC-CCCEEE
Q ss_conf             2999863010367789798659817998418866422410299999876622356--4322333457678851-565797
Q gi|254780426|r   98 SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAK--TNNINLNIQLSESNLI-KNILFV  174 (320)
Q Consensus        98 ~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~--~~~~~~~~~~~l~~~~-r~~~~V  174 (320)
T Consensus         2 ~vvtv~~~~sl~~a~~lm~~~~~~~lpVvd~~~-~lvGiit~~Di~~~~~~~~~~~~~~~~~~~~~~~V~~iM~~~~~tv   80 (121)
T cd04584           2 DVVTITPTTTIAEALELMREHKIRHLPVVDEEG-RLVGIVTDRDLRDASPSPFTTLSEHELYLLLKMPVKEIMTKDVITV   80 (121)
T ss_pred             CCEEECCCCCHHHHHHHHHHCCCCEEEEECCCC-CEEEEEEHHHHHHHHCCCCCHHHHHHCCCCCCCCHHHHCCCCCCEE
T ss_conf             988968929899999999972998899990899-3999965899875220122002444202514689999667998589


Q ss_pred             CCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             17885123234320135651165407766204667588999
Q gi|254780426|r  175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       175 pe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus        81 ~~~~~l~~a~~~m~~~~i~~lpVvd~-~~lvGivt~~Dilr  120 (121)
T cd04584          81 HPLDTVEEAALLMREHRIGCLPVVED-GRLVGIITETDLLR  120 (121)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHHHC
T ss_conf             89995999999988669619999999-99999998226006