HHsearch alignment for GI: 254780426 and conserved domain: cd04586

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain. BON is a putative phospholipid-binding domain found in a family of osmotic shock protection proteins. It is also found in some secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=98.09  E-value=3.7e-06  Score=60.22  Aligned_cols=51  Identities=20%  Similarity=0.257  Sum_probs=36.6

Q ss_pred             CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHH
Q ss_conf             565797178851232343201356511654077662046675889999874
Q gi|254780426|r  169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMR  219 (320)
Q Consensus       169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivG  219 (320)
T Consensus         2 ~~vitv~~~~tl~~a~~~m~~~~i~~lpVvd~~~~lvGiit~~Dil~~~~~   52 (135)
T cd04586           2 TDVVTVSPETSVAEAARLMLDNHISGLPVVDDDGRLVGIVSEGDLLRRAEL   52 (135)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHCCCEEEEEECCCEEEEEEEHHHHHHHHHC
T ss_conf             999899993939999999997399679999089979999981897644541