HHsearch alignment for GI: 254780426 and conserved domain: cd04595

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=97.94  E-value=1.5e-05  Score=56.31  Aligned_cols=49  Identities=14%  Similarity=0.162  Sum_probs=32.2

Q ss_pred             CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHH
Q ss_conf             56579717885123234320135651165407766204667588999987
Q gi|254780426|r  169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM  218 (320)
Q Consensus       169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~iv  218 (320)
T Consensus         2 spV~ti~p~~tv~ea~~~m~~~~i~~lpVvd~-~~lvGivT~~Di~~~~~   50 (110)
T cd04595           2 SPVKTVRPEATIEEARELLLRYGHTALPVVEG-GRVVGIISRRDVEKALR   50 (110)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHCCCEEEEEEC-CEEEEEEEHHHHHHHHH
T ss_conf             89899799599999999999759988999989-99999997689887765