HHsearch alignment for GI: 254780426 and conserved domain: cd04597

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=97.92  E-value=1.7e-05  Score=55.79  Aligned_cols=58  Identities=17%  Similarity=0.344  Sum_probs=42.1

Q ss_pred             CCCCCCHHHHC-CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             33457678851-56579717885123234320135651165407766204667588999
Q gi|254780426|r  158 LNIQLSESNLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       158 ~~~~~~l~~~~-r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus        54 ~~v~~qV~DIm~~~~vti~~~~sl~eA~~lM~e~~i~~LPVVD~~g~l~GiIT~~DIAe  112 (113)
T cd04597          54 ADVHPRVRDVINRKPVTARPNDPLREALNLMHEHNIRTLPVVDDDGTPAGIITLLDLAE  112 (113)
T ss_pred             CCCCCHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEHHHHHC
T ss_conf             15650566631378834199982999999999849987869889993999987787435