HHsearch alignment for GI: 254780426 and conserved domain: cd04607

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=99.32  E-value=1.1e-11  Score=96.52  Aligned_cols=107  Identities=20%  Similarity=0.252  Sum_probs=95.2

Q ss_pred             EEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEECCCC
Q ss_conf             998630103677897986598179984188664224102999998766223564322333457678851-5657971788
Q gi|254780426|r  100 NAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVPSSM  178 (320)
Q Consensus       100 ~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vpe~~  178 (320)
T Consensus         5 i~v~~~~tl~ea~~~m~~~~~~~~~Vvd~~~-~l~GiiT~~Di~r~l~~~~~--------~~~~v~~im~~~~~~i~~~~   75 (113)
T cd04607           5 LLVSPDASILDALRKIDKNALRIVLVVDENG-RLLGTVTDGDIRRALLKGLS--------LDDPVSEVMNRNPITAKVGS   75 (113)
T ss_pred             EEECCCCCHHHHHHHHHHCCCCEEEEECCCC-EEEEEEECHHHHHHHHCCCC--------CCCCHHHHHCCEEEEEECCC
T ss_conf             8969949899999999875997899997999-59999987277668762898--------45615675212129998799


Q ss_pred             CHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             5123234320135651165407766204667588999
Q gi|254780426|r  179 LVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       179 ~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus        76 ~~~~a~~~m~~~~i~~lPVvd~~~~lvGiit~~Dll~  112 (113)
T cd04607          76 SREEILALMRERSIRHLPILDEEGRVVGLATLDDLLS  112 (113)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCEEEEEEEHHHHHC
T ss_conf             8999999998779749999978994999999799308