HHsearch alignment for GI: 254780426 and conserved domain: cd04608

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream. The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well as the 5'-phosphate esters of pyridoxal (PALP) and pyridoxamine, the last two being the biologically active coenzyme derivatives. The members of the PALP family are principally involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and other amine-containing compounds. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a poten
Probab=99.00  E-value=1.1e-09  Score=83.25  Aligned_cols=113  Identities=20%  Similarity=0.185  Sum_probs=85.7

Q ss_pred             CEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEEC
Q ss_conf             129998630103677897986598179984188664224102999998766223564322333457678851-5657971
Q gi|254780426|r   97 VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVP  175 (320)
Q Consensus        97 ~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vp  175 (320)
T Consensus         2 ~~~vtv~p~~tv~~a~~~m~~~~i~~lPVvd~~g-~~~G~vt~~~ll~~~~~~~~~~~-------~~V~~vm~~~~~~v~   73 (124)
T cd04608           2 KAPVTVLPTVTCAEAIEILKEKGFDQLPVVDESG-KILGMVTLGNLLSSLSSGKVQPS-------DPVSKALYKQFKRVN   73 (124)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHCCCEEEEECCCC-CEEEEEEHHHHHHHHHCCCCCCC-------CCHHHHHCCCCCCCC
T ss_conf             9997989989099999999984998568987999-68888879999999973899999-------828997446565147


Q ss_pred             CCCCHHH---------HHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHH
Q ss_conf             7885123---------23432013565116540776620466758899998
Q gi|254780426|r  176 SSMLVSD---------LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVL  217 (320)
Q Consensus       176 e~~~l~~---------lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~i  217 (320)
T Consensus        74 ~~~~l~~ls~~l~~~~~~lvv~~~~~~~~~v~~~~~k~vGIvTr~DLL~yl  124 (124)
T cd04608          74 KNDTLGKLSRILETDAFLLVFFEQISSAAIGKEKQEKPIGIVTKIDLLSYI  124 (124)
T ss_pred             CCCCHHHHHCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEEEEEHHHHHHHC
T ss_conf             998556731036732789999986025676277799899998679977039