HHsearch alignment for GI: 254780426 and conserved domain: cd04612

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase an
Probab=99.55  E-value=2.3e-14  Score=113.95  Aligned_cols=109  Identities=19%  Similarity=0.245  Sum_probs=93.9

Q ss_pred             EEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEECC
Q ss_conf             29998630103677897986598179984188664224102999998766223564322333457678851-56579717
Q gi|254780426|r   98 SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVPS  176 (320)
Q Consensus        98 ~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vpe  176 (320)
T Consensus         2 dvvtv~p~~tl~~a~~~m~~~~~~~lpVvd~--~~l~Givt~~di~~~~~~~~~~~--------~~v~~im~~~~~~v~~   71 (111)
T cd04612           2 DVVTVPVDLTVDEVLALMFGERHRGYPVVDD--GRLVGIVTLADIRRVPAEGREAT--------VLVGDVMTRDPVTASP   71 (111)
T ss_pred             CCEEECCCCCHHHHHHHHHHCCCCEEEEEEC--CEEEEEEEHHHHHHHHHCCCCCC--------CEEEEEECCCCCCCCC
T ss_conf             8499999295999999999719948999999--99999998999998775147777--------5699997079605299


Q ss_pred             CCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHH
Q ss_conf             8851232343201356511654077662046675889999
Q gi|254780426|r  177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV  216 (320)
Q Consensus       177 ~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~  216 (320)
T Consensus        72 ~~~l~~a~~~m~~~~~~~lpVvd~~g~l~GiiT~~DilrA  111 (111)
T cd04612          72 DETLRDALKRMAERDIGRLPVVDDSGRLVGIVSRSDLLRA  111 (111)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEECCCEEEEEEEHHHHHCC
T ss_conf             9979999999997698199999689989999986886349