>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.43 E-value=1.2e-12 Score=102.61 Aligned_cols=109 Identities=19% Similarity=0.323 Sum_probs=95.2 Q ss_pred CEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEEC Q ss_conf 129998630103677897986598179984188664224102999998766223564322333457678851-5657971 Q gi|254780426|r 97 VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVP 175 (320) Q Consensus 97 ~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vp 175 (320) T Consensus 1 tdv~tv~~~~tl~eA~~~m~~~~~~~~~Vvd~~~-~l~GIiT~~Di~~~~~~~~--------~~~~~V~~iMt~~~itv~ 71 (111) T cd04626 1 TDFPTIDEDASIREALHEMLKYNTNEIIVKDNEE-KLKGVVTFTDILDLDLFES--------FLEKKVFNIVSQDVFYVN 71 (111) T ss_pred CCCEEECCCCCHHHHHHHHHHHCCCEEEEECCCC-EEEEEEEHHHHHHHHHCCC--------CCCCCHHHHCCCCCEEEC T ss_conf 9973999629399999999984998899996999-7999999499999985268--------778888996069987999 Q ss_pred CCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH Q ss_conf 7885123234320135651165407766204667588999 Q gi|254780426|r 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS 215 (320) Q Consensus 176 e~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle 215 (320) T Consensus 72 ~~~~~~~a~~~M~~~~i~~LPVvd~-~klvGiit~~Dil~ 110 (111) T cd04626 72 EEDTIDEALDIMREKQIGRLPVVDD-NKLIGVVRTKDILD 110 (111) T ss_pred CCCCHHHHHHHHHHHCCCEEEEEEC-CEEEEEEEHHHHCC T ss_conf 9793999999999809988999999-99999999698148

HHsearch alignment for GI: 254780426 and conserved domain: cd04626