HHsearch alignment for GI: 254780426 and conserved domain: cd04629

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=99.43  E-value=8.8e-13  Score=103.62  Aligned_cols=112  Identities=18%  Similarity=0.180  Sum_probs=95.4

Q ss_pred             EEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHCC-CCEEECC
Q ss_conf             299986301036778979865981799841886642241029999987662235643223334576788515-6579717
Q gi|254780426|r   98 SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK-NILFVPS  176 (320)
Q Consensus        98 ~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~r-~~~~Vpe  176 (320)
T Consensus         2 ~pvtv~~~~tl~~a~~~m~~~~~~~~pVvd~~~-~lvGiit~~Dll~~~~~~~~~-----~~~~~~v~~iM~~~~~tv~~   75 (114)
T cd04629           2 NPVTFTPDMSVTEAVEKLLKSKISGGPVVDDNG-NLVGFLSEQDCLKQLLESSYH-----CDGVATVRDIMTTEVLTVSP   75 (114)
T ss_pred             CCEEECCCCCHHHHHHHHHHHCCCEEEEECCCC-EEEEEEEHHHHHHHHHHHHCC-----CCCCCEEHHHCCCCCEEEEC
T ss_conf             899979929999999999971997899994899-299999678999999775405-----88765918851468879957


Q ss_pred             CCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHH
Q ss_conf             8851232343201356511654077662046675889999
Q gi|254780426|r  177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV  216 (320)
Q Consensus       177 ~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~  216 (320)
T Consensus        76 ~~~~~~a~~~m~~~~~~~lpVvd~-g~lvGiIt~~DilrA  114 (114)
T cd04629          76 DDSIVDLAQLMLKAKPKRYPVVDD-GKLVGQISRRDVLRA  114 (114)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHHHCC
T ss_conf             999999999988669839999989-999999997996339