>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=98.22 E-value=6.5e-06 Score=58.61 Aligned_cols=85 Identities=19% Similarity=0.323 Sum_probs=54.3 Q ss_pred CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHH-HCCCHHHCCCCCCCCEEEEECCCC Q ss_conf 5657971788512323432013565116540776620466758899998742221-000000001246773378304535 Q gi|254780426|r 169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITS-EHHSKKSMISAVSDNTFIVDARTD 247 (320) Q Consensus 169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~d-e~d~~~~~i~~~~~g~~~v~G~~~ 247 (320) T Consensus 1 r~pvtv~~~~tl~~a~~~m~~~~~~~~pVvd~~~~lvGiit~~Dll~~~~~~~~~~~~~~~v~~iM--~~~~~tv~~~~~ 78 (114) T cd04629 1 RNPVTFTPDMSVTEAVEKLLKSKISGGPVVDDNGNLVGFLSEQDCLKQLLESSYHCDGVATVRDIM--TTEVLTVSPDDS 78 (114) T ss_pred CCCEEECCCCCHHHHHHHHHHHCCCEEEEECCCCEEEEEEEHHHHHHHHHHHHCCCCCCCEEHHHC--CCCCEEEECCCC T ss_conf 989997992999999999997199789999489929999967899999977540588765918851--468879957999 Q ss_pred HHHHHHHH Q ss_conf 99999982 Q gi|254780426|r 248 LEELAKII 255 (320) Q Consensus 248 l~~l~~~l 255 (320) T Consensus 79 ~~~a~~~m 86 (114) T cd04629 79 IVDLAQLM 86 (114) T ss_pred HHHHHHHH T ss_conf 99999998

HHsearch alignment for GI: 254780426 and conserved domain: cd04629