HHsearch alignment for GI: 254780426 and conserved domain: cd04630

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=99.43  E-value=1.1e-12  Score=102.94  Aligned_cols=111  Identities=23%  Similarity=0.308  Sum_probs=96.8

Q ss_pred             EEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEECC
Q ss_conf             29998630103677897986598179984188664224102999998766223564322333457678851-56579717
Q gi|254780426|r   98 SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVPS  176 (320)
Q Consensus        98 ~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vpe  176 (320)
T Consensus         2 dvitv~~~~tv~eA~~~M~~~~i~~v~V~~~~~~~~vGiiT~~Di~~~~~~~~~~------~~~~~V~~vMt~~v~tv~~   75 (114)
T cd04630           2 NVVTIDGLATVAEALQLMKEHGVSSLVVEKRRESDAYGIVTMRDILKKVVAEGRD------PDRVNVYEIMTKPLISVSP   75 (114)
T ss_pred             CEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEEHHHHHHHHHCCCC------CCCCCHHHHCCCCEEEECC
T ss_conf             8499998293999999999829988999978996089999818989999846789------4444986827035499999


Q ss_pred             CCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             885123234320135651165407766204667588999
Q gi|254780426|r  177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       177 ~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus        76 d~~~~~a~~~m~~~~i~~lpVvd-~~~lvGiit~~Dil~  113 (114)
T cd04630          76 DMDIKYCARLMERTNIRRAPVVE-NNELIGIISLTDIFL  113 (114)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEE-CCEEEEEEEHHHHHC
T ss_conf             49499999999977972999999-999999997689647