HHsearch alignment for GI: 254780426 and conserved domain: cd04631

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=97.84  E-value=9.7e-05  Score=50.91  Aligned_cols=52  Identities=23%  Similarity=0.359  Sum_probs=44.0

Q ss_pred             CCCEEECCCCCHHHHHHHHHCCCCCCEEEEEC-CCCCEEEEEHHHHHHHHHHH
Q ss_conf             56579717885123234320135651165407-76620466758899998742
Q gi|254780426|r  169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDE-HGGTDGLVSYEDIVSVLMRD  220 (320)
Q Consensus       169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE-~G~~~GiVTleDIle~ivGe  220 (320)
T Consensus         1 r~vvtv~~~~tl~ea~~~m~~~~v~~~PVvd~~~~~lvGiit~~Di~~~~~~~   53 (125)
T cd04631           1 KDVVTVPPTTPIMEAAKIMVRNGFRRLPVVDEGTGKLVGIITATDILKYLGGG   53 (125)
T ss_pred             CCCEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEHHHHHHHHHCC
T ss_conf             99779799094999999999839988999979999599999999999987335