HHsearch alignment for GI: 254780426 and conserved domain: cd04636

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=99.44  E-value=1e-12  Score=103.24  Aligned_cols=117  Identities=20%  Similarity=0.239  Sum_probs=96.9

Q ss_pred             CEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCC-------------CCCCCCCCC
Q ss_conf             1299986301036778979865981799841886642241029999987662235643-------------223334576
Q gi|254780426|r   97 VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTN-------------NINLNIQLS  163 (320)
Q Consensus        97 ~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~-------------~~~~~~~~~  163 (320)
T Consensus         1 rdvvtv~~~~tl~ea~~~m~~~~~~~lpVvd~~~-~lvGiit~~Dll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (132)
T cd04636           1 KDVITVKKDDTLRDVVEILLTGKISGVPVVDNEG-RVVGIVSEGDLIRKIYKGKGLFYVTLLYSVIFLDESKIKKLLGKK   79 (132)
T ss_pred             CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCCC-CEEEEEEHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
T ss_conf             9987968919799999999972997899995999-399998889999998626762000000000000233310203899


Q ss_pred             HHHHC-CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH
Q ss_conf             78851-56579717885123234320135651165407766204667588999
Q gi|254780426|r  164 ESNLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS  215 (320)
Q Consensus       164 l~~~~-r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle  215 (320)
T Consensus        80 v~diMt~~~~tv~~~~~l~~a~~~m~~~~i~~lpVvd~-~~lvGiIt~~Dilr  131 (132)
T cd04636          80 VEEIMTKKVITVDEDTTIEDVARIMSKKNIKRLPVVDD-GKLVGIISRGDIIR  131 (132)
T ss_pred             HHHHCCCCCEEECCCCCHHHHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHHHC
T ss_conf             99967899879999794999999999629878999989-99999999688234