HHsearch alignment for GI: 254780426 and conserved domain: cd04638

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=99.43  E-value=5.4e-13  Score=105.01  Aligned_cols=105  Identities=23%  Similarity=0.259  Sum_probs=91.3

Q ss_pred             CEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEEC
Q ss_conf             129998630103677897986598179984188664224102999998766223564322333457678851-5657971
Q gi|254780426|r   97 VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVP  175 (320)
Q Consensus        97 ~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vp  175 (320)
T Consensus         1 kdvvtv~~~~tv~ea~~lm~~~~i~~lpVvd~~~-~lvGivT~~Dl~~~~-------------~~~~v~~iMt~~~~tv~   66 (106)
T cd04638           1 ENVVYVTLPGTRDDVLELLKEYKVSGVPVVKKSG-ELVGIITRKDLLRNP-------------EEEQLALLMTRDPPTVS   66 (106)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHCCCEEEEECCCC-EEEEEEEHHHHHHCC-------------CCCHHHHHHCCCCEECC
T ss_conf             9989999949699999999976999899993899-999998978964487-------------50244675358973679


Q ss_pred             CCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHH
Q ss_conf             78851232343201356511654077662046675889999
Q gi|254780426|r  176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV  216 (320)
Q Consensus       176 e~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~  216 (320)
T Consensus        67 ~~~~~~~a~~~m~~~~i~~lpVvd~-~~lvGiIt~~DilkA  106 (106)
T cd04638          67 PDDDVKEAAKLMVENNIRRVPVVDD-GKLVGIVTVADIVRA  106 (106)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHHHCC
T ss_conf             9491999999998769759999999-999999997995359