HHsearch alignment for GI: 254780426 and conserved domain: cd04801

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=97.90  E-value=1.4e-05  Score=56.50  Aligned_cols=84  Identities=17%  Similarity=0.298  Sum_probs=45.6

Q ss_pred             CCCEEECCCCCHHHHHHHH-HCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCCEEEEECCCC
Q ss_conf             5657971788512323432-013565116540776620466758899998742221000000001246773378304535
Q gi|254780426|r  169 KNILFVPSSMLVSDLLTNI-QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD  247 (320)
Q Consensus       169 r~~~~Vpe~~~l~~lL~~m-~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g~~~v~G~~~  247 (320)
T Consensus         1 Rdv~tv~~~~tl~e~~~~~~~~~~~~~~pVvd~~g~l~Givt~~dl~~~~~~~~~---~~~v~~v~~~~~~~~~v~~~~~   77 (114)
T cd04801           1 RDFPTVPAHLTLREFVREYVLGSNQRRFVVVDNEGRYVGIISLADLRAIPTSQWA---QTTVIQVMTPAAKLVTVLSEES   77 (114)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCEEEEEEEHHHHHHHHHHCCC---CCCHHHHCCCCCCCEEECCCCC
T ss_conf             9955849999599999999850796689998789979999999998754540256---8847782102778758999997


Q ss_pred             HHHHHHHH
Q ss_conf             99999982
Q gi|254780426|r  248 LEELAKII  255 (320)
Q Consensus       248 l~~l~~~l  255 (320)
T Consensus        78 l~~al~~m   85 (114)
T cd04801          78 LAEVLKLL   85 (114)
T ss_pred             HHHHHHHH
T ss_conf             99999999