BLAST/PSIBLAST alignment of GI: 254780426 and GI: 15964161 at iteration 1
>gi|15964161|ref|NP_384514.1| hypothetical protein SMc01112 [Sinorhizobium meliloti 1021] Length = 387
>gi|307301306|ref|ZP_07581068.1| CBS domain containing protein [Sinorhizobium meliloti BL225C] Length = 387
>gi|307317977|ref|ZP_07597414.1| CBS domain containing protein [Sinorhizobium meliloti AK83] Length = 387
>gi|15073337|emb|CAC41845.1| CBS domain-containing protein [Sinorhizobium meliloti 1021] Length = 387
>gi|306896379|gb|EFN27128.1| CBS domain containing protein [Sinorhizobium meliloti AK83] Length = 387
>gi|306903762|gb|EFN34349.1| CBS domain containing protein [Sinorhizobium meliloti BL225C] Length = 387
 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 194/315 (61%), Gaps = 32/315 (10%)

Query: 30  SVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRI 89
           S  +FW+R  R L +      L       L   DA     FS  E+ + NNILRFR++R+
Sbjct: 37  STSSFWSRAAR-LLRGVSPSSLREDLADAL-MTDADGNAAFSPEERAMLNNILRFREVRV 94

Query: 90  DDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHM 149
           +D+M+ R  I AV+   T+ E M++FE+ GRS MPVY   LD+PRGMVH+RD+++Y++  
Sbjct: 95  EDVMVPRADIEAVDQNITIGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTKQ 154

Query: 150 Y-----------AKTNN-------------------INLNIQLSESNLIKNILFVPSSML 179
                       A T N                   ++L+  + E+ +++ +LFVP SML
Sbjct: 155 ARNRRRNGKAQGATTTNGDKPERAPRQQKAGFDLSRVDLDKTVEEAGIVRQLLFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDL+  +Q +RI+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++ M +  SD+ 
Sbjct: 215 ASDLMQRMQAARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEEVMFARSSDDV 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           FI DAR +LEE+A+ +G D +  +  +DVD+LGGL+F+ L RIP RGEVV  IPGFE  I
Sbjct: 275 FIADARVELEEIAEAVGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQI 334

Query: 300 LDADVRCVRRVRIRR 314
           LDAD R V+RVRI R
Sbjct: 335 LDADPRRVKRVRIMR 349