BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus
Liberibacter asiaticus str. psy62]
         (320 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040103|gb|ACT56899.1| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 320

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/320 (100%), Positives = 320/320 (100%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP
Sbjct: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR
Sbjct: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV
Sbjct: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF
Sbjct: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL
Sbjct: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300

Query: 301 DADVRCVRRVRIRRLVHFKN 320
           DADVRCVRRVRIRRLVHFKN
Sbjct: 301 DADVRCVRRVRIRRLVHFKN 320


>gi|315122128|ref|YP_004062617.1| hemolysin protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495530|gb|ADR52129.1| hemolysin protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 319

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 254/303 (83%), Gaps = 1/303 (0%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           MM DFK NSSE+PKEKNE IDLS SISK  + +FW R +RA  K WK  +L+H + +R  
Sbjct: 1   MMGDFKTNSSEYPKEKNENIDLSYSISKIPLDSFWNRFLRAWYKIWK-PRLNHQRDVRSL 59

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
             D +L+ + S  EKEIF N+L+FR+IRI DIMI RVSI+AVE+KAT+ E M+MFEKYG+
Sbjct: 60  WTDCALDDMLSAVEKEIFENVLQFREIRIGDIMIPRVSISAVEEKATISEVMMMFEKYGK 119

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           SWMPVY NSLDNPRGMVHMRD++SYI+ +Y    NINLN  LSESNLIK+ILFVPSSML 
Sbjct: 120 SWMPVYSNSLDNPRGMVHMRDLLSYIARIYLDIENINLNTTLSESNLIKDILFVPSSMLA 179

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           SDLL  IQES + MALVIDEHGGTDGLVS+ DIVSVL+ DITSEH+S K MISAVSDNTF
Sbjct: 180 SDLLRKIQESGVHMALVIDEHGGTDGLVSHRDIVSVLVGDITSEHNSIKEMISAVSDNTF 239

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           IVDARTDLEELAKIIG DC+ LKGEQDVDSLGGLIFSVLDRIPARGEV+L+IPGFEIVIL
Sbjct: 240 IVDARTDLEELAKIIGADCDSLKGEQDVDSLGGLIFSVLDRIPARGEVILDIPGFEIVIL 299

Query: 301 DAD 303
           D+D
Sbjct: 300 DSD 302


>gi|227820631|ref|YP_002824601.1| putative hemolysin-related protein [Sinorhizobium fredii NGR234]
 gi|227339630|gb|ACP23848.1| putative hemolysin-related protein [Sinorhizobium fredii NGR234]
          Length = 386

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 206/350 (58%), Gaps = 39/350 (11%)

Query: 2   MSDFKINSSEHPKEKNE--GIDLSPSISKTSVP-------AFWTRTIRALCKTWKLMKLS 52
           MSDFK   +    E+ +  G   + S S T+ P       +FW+R  R L +      L 
Sbjct: 1   MSDFKTQPATVASEEADASGDADAGSSSTTARPEGSKPISSFWSRAAR-LWRGAGASSLR 59

Query: 53  HHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM 112
                 L   DA     FS  E+ + NNILRFR+IR++D+M+ R  I AV+   T+ E M
Sbjct: 60  EDLADAL-MTDADSNTAFSPEERAMLNNILRFREIRVEDVMVPRADIEAVDQSITLGELM 118

Query: 113 LMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT------------------- 153
           ++FE+ GRS MPVY   LD+PRGMVH+RD+++Y++                         
Sbjct: 119 VLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTRQARNRRRNGKAPHAVGADRAEKSP 178

Query: 154 ---------NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGT 204
                    + ++LN  + E ++I+ +LFVP SML SDL+  +Q +RI+MALVIDE+GGT
Sbjct: 179 RQPRPGFDLSRVDLNKTVEEVSIIRQVLFVPPSMLASDLMQRMQAARIQMALVIDEYGGT 238

Query: 205 DGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           DGLVS EDIV +++ DI  EH   + M +  SD+ F+ DAR +LEE+A+ IG D +  + 
Sbjct: 239 DGLVSLEDIVEMVVGDIEDEHDDDEVMFARTSDDVFVADARVELEEIAEAIGPDFDVREQ 298

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            +DVD+LGGL+F+ L RIP RGEVV  IPGFE  ILDAD R V+RVRI R
Sbjct: 299 LEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDADPRRVKRVRIMR 348


>gi|15964161|ref|NP_384514.1| hypothetical protein SMc01112 [Sinorhizobium meliloti 1021]
 gi|307301306|ref|ZP_07581068.1| CBS domain containing protein [Sinorhizobium meliloti BL225C]
 gi|307317977|ref|ZP_07597414.1| CBS domain containing protein [Sinorhizobium meliloti AK83]
 gi|15073337|emb|CAC41845.1| CBS domain-containing protein [Sinorhizobium meliloti 1021]
 gi|306896379|gb|EFN27128.1| CBS domain containing protein [Sinorhizobium meliloti AK83]
 gi|306903762|gb|EFN34349.1| CBS domain containing protein [Sinorhizobium meliloti BL225C]
          Length = 387

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 194/315 (61%), Gaps = 32/315 (10%)

Query: 30  SVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRI 89
           S  +FW+R  R L +      L       L   DA     FS  E+ + NNILRFR++R+
Sbjct: 37  STSSFWSRAAR-LLRGVSPSSLREDLADAL-MTDADGNAAFSPEERAMLNNILRFREVRV 94

Query: 90  DDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHM 149
           +D+M+ R  I AV+   T+ E M++FE+ GRS MPVY   LD+PRGMVH+RD+++Y++  
Sbjct: 95  EDVMVPRADIEAVDQNITIGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTKQ 154

Query: 150 Y-----------AKTNN-------------------INLNIQLSESNLIKNILFVPSSML 179
                       A T N                   ++L+  + E+ +++ +LFVP SML
Sbjct: 155 ARNRRRNGKAQGATTTNGDKPERAPRQQKAGFDLSRVDLDKTVEEAGIVRQLLFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDL+  +Q +RI+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++ M +  SD+ 
Sbjct: 215 ASDLMQRMQAARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEEVMFARSSDDV 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           FI DAR +LEE+A+ +G D +  +  +DVD+LGGL+F+ L RIP RGEVV  IPGFE  I
Sbjct: 275 FIADARVELEEIAEAVGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQI 334

Query: 300 LDADVRCVRRVRIRR 314
           LDAD R V+RVRI R
Sbjct: 335 LDADPRRVKRVRIMR 349


>gi|222084696|ref|YP_002543225.1| hemolysin protein [Agrobacterium radiobacter K84]
 gi|221722144|gb|ACM25300.1| hemolysin protein [Agrobacterium radiobacter K84]
          Length = 388

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 206/353 (58%), Gaps = 41/353 (11%)

Query: 2   MSDFKINSSEHPKEKNEGIDL-------SPSISKTSVPAFWTRTIRALCKTWKLMKLSHH 54
           MSDF   ++    E  +G D        S S  K S  +FW R  R L       +L   
Sbjct: 1   MSDF---TTRPASEAKDGADTASSDEAGSSSNGKRSQSSFWARAARILRPAQGSARLRED 57

Query: 55  KGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLM 114
               L    A+ +  FS  E+ + +NILRFR++R++D+M+ R  I AV+   T+ E M++
Sbjct: 58  LADALI-AGATDDDAFSPDERAMLHNILRFREVRVEDVMVPRADIEAVDQNITIGELMIL 116

Query: 115 FEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY------------------------ 150
           FE+ GRS MPVY  +LD+PRGMVH+RD++SY++                           
Sbjct: 117 FEESGRSRMPVYAETLDDPRGMVHIRDLLSYVAKQARNKRRAGNGKAAAASAATPAEKPA 176

Query: 151 --AKTN----NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGT 204
             AK N     ++L   L+E+ +I+ ILFVP SML SDLL  +Q +R +MALVIDE+GGT
Sbjct: 177 RSAKPNFDLSRVDLQKTLAEAGIIRKILFVPPSMLASDLLRRMQVNRTQMALVIDEYGGT 236

Query: 205 DGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           DGL S+EDIV +++ DI  EH   + M   VS++ F+ DAR +LEE+A  IG+D +  + 
Sbjct: 237 DGLASHEDIVEMVVGDIDDEHDDDEVMFKRVSEDVFVADARVELEEIAAAIGSDFDISEQ 296

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVH 317
             +VD+LGGLIFS L RIP RGEVV  +PGFE  ILDAD R +++VRI R  H
Sbjct: 297 VDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPRRIKKVRITRKRH 349


>gi|116250161|ref|YP_765999.1| hemolysin-like protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254809|emb|CAK05883.1| putative hemolysin-like protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 381

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 196/318 (61%), Gaps = 36/318 (11%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L +  +  +L       L   DA+ +  FS  E+ + NNILRFR++R+ D+M
Sbjct: 37  FWSRAARIL-RPQQGSRLREDLADAL-MTDAAGDDAFSPDERAMLNNILRFREVRVADVM 94

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 95  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 154

Query: 151 ---------------------------AKTN----NINLNIQLSESNLIKNILFVPSSML 179
                                      AK N     ++L   L+E+ +I+ ILFVP SML
Sbjct: 155 RRGPTKPTTVVPAIEVAPENIQKTARSAKQNFDLARVDLQKTLAEAGIIRKILFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+++ 
Sbjct: 215 ASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDM 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           FI DAR +LEE+A+ IG D +  +   +VD+LGGLIFS L RIP RGEVV  +PGFE  I
Sbjct: 275 FIADARVELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHI 334

Query: 300 LDADVRCVRRVRIRRLVH 317
           LDAD R ++R+RI R  H
Sbjct: 335 LDADPRRIKRLRITRKRH 352


>gi|325291793|ref|YP_004277657.1| hemolysin [Agrobacterium sp. H13-3]
 gi|325059646|gb|ADY63337.1| hemolysin [Agrobacterium sp. H13-3]
          Length = 381

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 191/302 (63%), Gaps = 30/302 (9%)

Query: 43  CKTWKLMKLSHHKGIRLPRIDASLE-----GIFSETEKEIFNNILRFRKIRIDDIMISRV 97
            +  +L+K S  + +R    DA ++       FS  E+ + NNILRFR++R++DIMI RV
Sbjct: 42  SRIGRLLKPSQGERLREDLTDALMDDTEIGAAFSPEERAMLNNILRFREVRVEDIMIPRV 101

Query: 98  SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHM-------- 149
            I+ ++   T+ EA+++FE+ GRS MPVY  +LDNP+GM+H+RD+++Y++          
Sbjct: 102 DIDGLDQNMTIGEALILFEETGRSRMPVYDETLDNPKGMIHIRDLLAYVAKQARNKRRVG 161

Query: 150 -----YAKTN------------NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
                Y +               ++L   ++++ L++ ILF P SML SDLL  +Q  R 
Sbjct: 162 SRGVAYGEAKAPRSPRPNFDLARVDLEQTVADAGLVRKILFAPPSMLASDLLKTMQAQRT 221

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
           ++ALVIDE+GGTDGLVS+EDIV +++ DI  EH   ++M S +S +  + DAR +L ELA
Sbjct: 222 QLALVIDEYGGTDGLVSHEDIVEMVVGDIDDEHDKDETMFSRLSADVLVADARAELTELA 281

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           + IG + +  +  +++D+LGGLIF  L RIPA+GEVV  +PGFE  ILDAD R ++ VRI
Sbjct: 282 EAIGPEFDVREHLEEIDTLGGLIFFALGRIPAKGEVVRAVPGFEFQILDADTRRIKGVRI 341

Query: 313 RR 314
            R
Sbjct: 342 VR 343


>gi|159184275|ref|NP_353391.2| hemolysin [Agrobacterium tumefaciens str. C58]
 gi|159139602|gb|AAK86176.2| hemolysin [Agrobacterium tumefaciens str. C58]
          Length = 380

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 191/303 (63%), Gaps = 31/303 (10%)

Query: 43  CKTWKLMKLSHHKGIRLPRIDA-----SLEGIFSETEKEIFNNILRFRKIRIDDIMISRV 97
            +  +L+K S  + +R    DA      +   FS  E+ + NNILRFR++R++DIMI RV
Sbjct: 42  SRIGRLLKPSQGERLREDLTDALMADTEIGAAFSPEERAMLNNILRFREVRVEDIMIPRV 101

Query: 98  SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHM-------- 149
            I+ ++   T+ EA+++FE+ GRS MPVY  +LDNP+GM+H+RD+++Y++          
Sbjct: 102 DIDGLDQNMTIGEALILFEETGRSRMPVYDETLDNPKGMIHIRDLLAYVAKQARNKRRAG 161

Query: 150 -----YAKTN-------------NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
                Y +                ++L   ++++ L++ ILF P SML SDLL  +Q  R
Sbjct: 162 SRSVAYGEVKATTRSPRPNFDLARVDLEQTVADAGLVRKILFAPPSMLASDLLKTMQAQR 221

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
            ++ALVIDE+GGTDGLVS+EDIV +++ DI  EH   ++M S +S +  + DAR +L EL
Sbjct: 222 TQLALVIDEYGGTDGLVSHEDIVEMVVGDIDDEHDKDEAMFSRLSADVLVADARAELTEL 281

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           A++IG + +  +  +++D+LGGLIF  L RIPA+GEVV  +PGFE  ILDAD R ++ VR
Sbjct: 282 AEVIGPEFDVREHLEEIDTLGGLIFFALGRIPAKGEVVRAVPGFEFQILDADSRRIKGVR 341

Query: 312 IRR 314
           I R
Sbjct: 342 IVR 344


>gi|241202782|ref|YP_002973878.1| CBS domain containing protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856672|gb|ACS54339.1| CBS domain containing protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 377

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 139/318 (43%), Positives = 196/318 (61%), Gaps = 36/318 (11%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L +  +  +L       L   DA+ +  FS  E+ + NNILRFR++R+ D+M
Sbjct: 37  FWSRAARIL-RPQQGSRLREDLADAL-MTDAAGDDAFSPDERAMLNNILRFREVRVADVM 94

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 95  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 154

Query: 151 ---------------------------AKTN----NINLNIQLSESNLIKNILFVPSSML 179
                                      AK N     ++L   L+E+ +++ ILFVP SML
Sbjct: 155 RRGPAKPAAAVPAIEVAPENIHKATRSAKPNFDLARVDLQKTLAEAGIVRKILFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+++ 
Sbjct: 215 ASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDM 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           FI DAR +LEE+A+ IG D +  +   +VD+LGGLIFS L RIP RGEVV  +PGFE  I
Sbjct: 275 FIADARVELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHI 334

Query: 300 LDADVRCVRRVRIRRLVH 317
           LDAD R ++R+RI R  H
Sbjct: 335 LDADPRRIKRLRITRKRH 352


>gi|222147354|ref|YP_002548311.1| hemolysin [Agrobacterium vitis S4]
 gi|221734344|gb|ACM35307.1| hemolysin [Agrobacterium vitis S4]
          Length = 345

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 137/327 (41%), Positives = 208/327 (63%), Gaps = 15/327 (4%)

Query: 2   MSDFKINS-SEHPKEKNEGIDLSPSISKTSVPA------FWTRTIRALCKTWKLMKLSHH 54
           MSDF   S SE  KE++       S  + S  A      FW R  R L      ++    
Sbjct: 1   MSDFSTRSASEATKEQDGSSSEEGSSPQRSSAAHKPQSSFWARAARILKPAGGNLREDIA 60

Query: 55  KGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLM 114
             +     D + E  FS  E+ + +NILRFR++R++D+M+ R  I+AV+ + ++ E M +
Sbjct: 61  DALM---SDRAAEEAFSAEERAMLHNILRFREVRVEDVMVPRSDIHAVDVETSIGELMTL 117

Query: 115 FEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNN-----INLNIQLSESNLIK 169
           F++ G S MPVY ++LD+PRGMVH+RD++SYI+      N      ++L + L E+ +I+
Sbjct: 118 FQQTGHSRMPVYCDTLDDPRGMVHIRDLLSYITLKALNGNGLDLACVDLGVTLEEAGIIR 177

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
           +ILFVP SM  SDLL  +Q +R +MALVIDE+GGTDGLVS+EDIV +++ DI  EH  ++
Sbjct: 178 SILFVPPSMQASDLLARMQAARTQMALVIDEYGGTDGLVSHEDIVEMVVGDIEDEHDKEE 237

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           ++++ VS + ++ DAR +LEE+A++IG D +      +VD+LGGL+ + + R+P RGEVV
Sbjct: 238 ALVTRVSQDVYLADARIELEEIAEVIGPDFDISAEIDEVDTLGGLLSTAIGRVPQRGEVV 297

Query: 290 LEIPGFEIVILDADVRCVRRVRIRRLV 316
             + GFE+ ILDAD R V++VRI R+ 
Sbjct: 298 QAVAGFELHILDADPRRVKKVRITRMA 324


>gi|209547628|ref|YP_002279545.1| transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533384|gb|ACI53319.1| transporter-associated region [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 383

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/321 (42%), Positives = 192/321 (59%), Gaps = 40/321 (12%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L      ++      +     DA+    FS  E+ + +NILRFR++R+ D+M
Sbjct: 37  FWSRAARILRPQQGSLREDLADALM---TDAAGNDAFSPDERAMLHNILRFREVRVADVM 93

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 94  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 153

Query: 151 ------------------------------AKTN----NINLNIQLSESNLIKNILFVPS 176
                                         AK N     ++L   L+E+ +I+ ILFVP 
Sbjct: 154 RRGPTKPAAALPALPAIEVAPENIQKTTRPAKPNLDLARVDLQKTLTEAGIIRKILFVPP 213

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           SML SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+
Sbjct: 214 SMLASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVA 273

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           ++ FI DAR +LEE+A  IG D +  +   +VD+LGGLIFS L RIP RGEVV  +PGFE
Sbjct: 274 EDVFIADARVELEEIAAAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFE 333

Query: 297 IVILDADVRCVRRVRIRRLVH 317
             ILDAD R ++R+RI R  H
Sbjct: 334 FHILDADPRRIKRLRITRKRH 354


>gi|218681343|ref|ZP_03529240.1| putative hemolysin protein [Rhizobium etli CIAT 894]
          Length = 337

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 185/289 (64%), Gaps = 34/289 (11%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA+ +  FS  E+ + +NILRFR++R+ D+M+ R  I AV+   T+ E M++FE+ GRS 
Sbjct: 20  DAAGDDAFSPDERAMLHNILRFREVRVADVMVPRADIEAVDQNITIGELMILFEESGRSR 79

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMY------------------------------AK 152
           MPVY ++LD+PRGMVH+RD++SY++                                 AK
Sbjct: 80  MPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPTKPTVAAPAIEVAPENIQKTTRSAK 139

Query: 153 TN----NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLV 208
            N     ++L   L+E+ +I+ ILFVP SML SDLL  +Q +R +MALVIDE+GGTDGL 
Sbjct: 140 PNFDLARVDLQKTLAEAGIIRKILFVPPSMLASDLLRRMQVNRTQMALVIDEYGGTDGLA 199

Query: 209 SYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDV 268
           S+EDIV +++ DI  EH  ++ M   V+++ F+ DAR +LEE+A+ IG D +  +   +V
Sbjct: 200 SHEDIVEMVVGDIDDEHDDEEVMFKRVAEDVFVADARVELEEIAEAIGPDFDISEQVDEV 259

Query: 269 DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVH 317
           D+LGGLIFS L RIP RGEVV  +PGFE  ILDAD R ++R+RI R  H
Sbjct: 260 DTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPRRIKRLRITRKRH 308


>gi|150395271|ref|YP_001325738.1| CBS domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150026786|gb|ABR58903.1| CBS domain containing protein [Sinorhizobium medicae WSM419]
          Length = 391

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 190/322 (59%), Gaps = 36/322 (11%)

Query: 25  SISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRF 84
           S    S  +FW+R  R L +      L       L   D      FS  E+ + NNILRF
Sbjct: 32  SEGSKSTSSFWSRAAR-LLRGVSPSSLREDLADAL-MTDTGGNAAFSPEERAMLNNILRF 89

Query: 85  RKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVIS 144
           R++R++D+M+ R  I AV+   T+ E M +FE+ GRS MPVY   LD+PRGMVH+RD+++
Sbjct: 90  REVRVEDVMVPRADIEAVDQNITIGELMALFEESGRSRMPVYSEGLDDPRGMVHIRDLLA 149

Query: 145 YISHMYAKT----------------------------------NNINLNIQLSESNLIKN 170
           Y++                                        + ++L+  + E+ +I+ 
Sbjct: 150 YVAKQARNRRRNGKAPTAPTTATTTNGDKPEKAPRQQKPGFDLSRVDLDKTVEEAGIIRQ 209

Query: 171 ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS 230
           +LFVP SML SDL+  ++ +RI+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++ 
Sbjct: 210 LLFVPPSMLASDLMQRMRAARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEEV 269

Query: 231 MISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
           M +  SD+ FI DAR +LEE+A+ +G D +  +  +DVD+LGGL+F+ L RIP RGEVV 
Sbjct: 270 MFARSSDDVFIADARVELEEIAEAVGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQ 329

Query: 291 EIPGFEIVILDADVRCVRRVRI 312
            IPGFE  ILDAD R V+RVRI
Sbjct: 330 AIPGFEFQILDADPRRVKRVRI 351


>gi|190890043|ref|YP_001976585.1| hemolysin protein [Rhizobium etli CIAT 652]
 gi|190695322|gb|ACE89407.1| putative hemolysin protein [Rhizobium etli CIAT 652]
          Length = 381

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 195/318 (61%), Gaps = 36/318 (11%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L +  +  +L       L   DA+ +  FS  E+ + +NILRFR++R+ D+M
Sbjct: 37  FWSRAARIL-RPQQGSRLREDLADAL-MTDAAGDDAFSPDERAMLHNILRFREVRVADVM 94

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 95  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 154

Query: 151 ---------------------------AKTN----NINLNIQLSESNLIKNILFVPSSML 179
                                      AK N     ++L   L+E+ +I+ ILFVP SML
Sbjct: 155 RRGPAKPAVAVPAIDVAPENIQKPTRSAKPNFDLARVDLQKTLAEAGIIRKILFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+++ 
Sbjct: 215 ASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDI 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F+ DAR +LEE+A+ IG D +  +   +VD+LGGLIFS L RIP RGEVV  +P FE  I
Sbjct: 275 FVADARVELEEIAEAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPNFEFHI 334

Query: 300 LDADVRCVRRVRIRRLVH 317
           LDAD R ++R+RI R  H
Sbjct: 335 LDADPRRIKRLRITRKRH 352


>gi|327188596|gb|EGE55806.1| putative hemolysin protein [Rhizobium etli CNPAF512]
          Length = 381

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/318 (42%), Positives = 194/318 (61%), Gaps = 36/318 (11%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L +  +  +L       L   DA+ +  FS  E+ + +NILRFR++R+ D+M
Sbjct: 37  FWSRAARIL-RPQQGSRLREDLADAL-MTDAAGDDAFSPDERAMLHNILRFREVRVADVM 94

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 95  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 154

Query: 151 ---------------------------AKTN----NINLNIQLSESNLIKNILFVPSSML 179
                                       K N     ++L   L+E+ +I+ ILFVP SML
Sbjct: 155 RRGPAKPAIAVPAIDVAPENIQKPTRSTKPNFDLARVDLQKTLAEAGIIRKILFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+++ 
Sbjct: 215 ASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDI 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F+ DAR +LEE+A+ IG D +  +   +VD+LGGLIFS L RIP RGEVV  +P FE  I
Sbjct: 275 FVADARVELEEIAEAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPNFEFHI 334

Query: 300 LDADVRCVRRVRIRRLVH 317
           LDAD R ++R+RI R  H
Sbjct: 335 LDADPRRIKRLRITRKRH 352


>gi|86356030|ref|YP_467922.1| putative hemolysin protein [Rhizobium etli CFN 42]
 gi|86280132|gb|ABC89195.1| putative hemolysin protein [Rhizobium etli CFN 42]
          Length = 381

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/318 (42%), Positives = 194/318 (61%), Gaps = 36/318 (11%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW+R  R L +  +  +L       L   DA+ +  FS  E+ + +NILRFR++R+ D+M
Sbjct: 37  FWSRAARIL-RPQQGSRLREDLADAL-MTDAAGDDAFSPDERAMLHNILRFREVRVADVM 94

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMY--- 150
           + R  I AV+   T+ E M++FE+ GRS MPVY ++LD+PRGMVH+RD++SY++      
Sbjct: 95  VPRADIEAVDQNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNK 154

Query: 151 ---------------------------AKTN----NINLNIQLSESNLIKNILFVPSSML 179
                                       K N     ++L   L+E+ +I+ ILFVP SML
Sbjct: 155 RRGPAKPAAATPAIEVAPENIQKPPRSTKPNFDLARVDLQKTLAEAGIIRKILFVPPSML 214

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
            SDLL  +Q +R +MALVIDE+GGTDGL S+EDIV +++ DI  EH  ++ M   V+++ 
Sbjct: 215 ASDLLRRMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDV 274

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F+ DAR +LEE+A+ IG D +  +   +VD+LGGLIFS L RIP RGEVV  +P FE  I
Sbjct: 275 FVADARVELEEIAEAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPNFEFHI 334

Query: 300 LDADVRCVRRVRIRRLVH 317
           LDAD R ++R+RI R  H
Sbjct: 335 LDADPRRIKRLRITRKRH 352


>gi|218670834|ref|ZP_03520505.1| putative hemolysin protein [Rhizobium etli GR56]
          Length = 333

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/289 (44%), Positives = 184/289 (63%), Gaps = 34/289 (11%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA+ +  FS  E+ + +NILRFR++R+ D+M+ R  I AV+   T+ E M++FE+ GRS 
Sbjct: 16  DAAGDDAFSPDERAMLHNILRFREVRVADVMVPRADIEAVDQNITIGELMILFEESGRSR 75

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMY------------------------------AK 152
           MPVY ++LD+PRGMVH+RD++SY++                                 AK
Sbjct: 76  MPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPTKPAVTLPAIDVAPENIQKPTRSAK 135

Query: 153 TN----NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLV 208
            N     ++L   L+E+ +I+ ILFVP SML SDLL  +Q +R +MALVIDE+GGTDGL 
Sbjct: 136 PNFDLARVDLQKTLAEAGIIRKILFVPPSMLASDLLRRMQVNRTQMALVIDEYGGTDGLA 195

Query: 209 SYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDV 268
           S+EDIV +++ DI  EH  ++ M   V+++ F+ DAR +LEE+A+ IG D +  +   +V
Sbjct: 196 SHEDIVEMVVGDIDDEHDDEEVMFKRVAEDVFVADARVELEEIAEAIGPDFDISEQVDEV 255

Query: 269 DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVH 317
           D+LGGLIFS L RIP RGEVV  +P FE  ILDAD R ++R+RI R  H
Sbjct: 256 DTLGGLIFSALGRIPVRGEVVQALPNFEFHILDADPRRIKRLRITRKRH 304


>gi|260461990|ref|ZP_05810235.1| transporter-associated protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032237|gb|EEW33503.1| transporter-associated protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 364

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 175/265 (66%), Gaps = 16/265 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           AS  G FS  E+ + NNILR R++R++D+M+ R  I  VE   T+ + +  FE+ G S M
Sbjct: 81  ASDAGAFSPGERAMLNNILRLREVRVEDVMVPRADIQGVEITTTLGDLLGTFEQSGHSRM 140

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMY----AKTN------------NINLNIQLSESNL 167
           PVY  +LD+PRGMVH+RDV+++I+ +      +T              ++L+  + E NL
Sbjct: 141 PVYSETLDDPRGMVHIRDVLAHITKLARVKKGRTTRKTPVATQLDLAQVDLSRTIGELNL 200

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           I+ +LFVP SML SDL+  +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH  
Sbjct: 201 IRQVLFVPPSMLASDLMGRMQTTRTQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDD 260

Query: 228 KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            + MI+   D  F+VD + +++E+AK+IG      +  + VD++GG+IF+ L R+PARGE
Sbjct: 261 DEPMITQAGDGVFVVDGKAEIDEVAKMIGEGFAAGEHGEYVDTIGGMIFNTLGRVPARGE 320

Query: 288 VVLEIPGFEIVILDADVRCVRRVRI 312
           VV  IPGFE  +LDAD R V+RVRI
Sbjct: 321 VVQAIPGFEFHVLDADPRRVKRVRI 345


>gi|90420539|ref|ZP_01228446.1| putative hemolysin with CBS domain [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335267|gb|EAS49020.1| putative hemolysin with CBS domain [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 306

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 164/255 (64%), Gaps = 18/255 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG FS  E+ + NNILR R++R++D+M+ R  I AV+   T+ E M  FE  G S MPVY
Sbjct: 24  EGAFSPEERAMLNNILRLRELRVEDVMVPRADIQAVDITTTLGELMKQFESSGHSRMPVY 83

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNN------------------INLNIQLSESNLI 168
             SLD+PRGM+H+RDV+ +I+ +    N                   INL  ++S+  +I
Sbjct: 84  GESLDDPRGMIHIRDVVGHITRVARPANGQGAKEPAARTRAGLDLRQINLARKVSDLGII 143

Query: 169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK 228
           + +LFVP SML +DL+  +Q +R +MALVIDE+GGTDGLVS EDI+ +++ +I  EH   
Sbjct: 144 RKVLFVPPSMLATDLMARMQATRTQMALVIDEYGGTDGLVSLEDIIEMVVGNIEDEHDDD 203

Query: 229 KSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
             MI+   D  +  DAR DL+E+ K++G D +  + E + D++GGL+FS L R+PARGEV
Sbjct: 204 APMITESGDGIYYADARADLDEVRKLVGEDFDISEYEDEADTIGGLLFSELGRVPARGEV 263

Query: 289 VLEIPGFEIVILDAD 303
           V  +PGFE  +LDAD
Sbjct: 264 VQAVPGFEFQVLDAD 278


>gi|13474617|ref|NP_106186.1| hemolysin [Mesorhizobium loti MAFF303099]
 gi|14025371|dbj|BAB51972.1| hemolysin [Mesorhizobium loti MAFF303099]
          Length = 358

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 173/259 (66%), Gaps = 16/259 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ + NNILR R++R++D+M+ R  I AVE   T+ + +  FE+ G S MPVY  +
Sbjct: 81  FSPGERAMLNNILRLREVRVEDVMVPRADIEAVEITTTLGDLLGTFEQSGHSRMPVYSET 140

Query: 130 LDNPRGMVHMRDVISYISHMY----AKTN------------NINLNIQLSESNLIKNILF 173
           LD+PRGMVH+RDV+++I+ +      +T              ++L   + E NLI+ +LF
Sbjct: 141 LDDPRGMVHIRDVLAHITKLARVKKGRTTRKTPVATQLDLAQVDLARTIGELNLIRQVLF 200

Query: 174 VPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMIS 233
           VP SML SDL+  +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH   + MI+
Sbjct: 201 VPPSMLASDLMGRMQTTRTQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEPMIT 260

Query: 234 AVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP 293
              D  FIVD + +++E+AK+IG D    +  + VD++GG+IF+ L R+PARGEVV  IP
Sbjct: 261 QAGDGVFIVDGKAEIDEVAKMIGEDFAAGEHGEYVDTIGGMIFNTLGRVPARGEVVQAIP 320

Query: 294 GFEIVILDADVRCVRRVRI 312
           GFE  +LDAD R V+RVRI
Sbjct: 321 GFEFHVLDADPRRVKRVRI 339


>gi|239833205|ref|ZP_04681534.1| Hemolysin C [Ochrobactrum intermedium LMG 3301]
 gi|239825472|gb|EEQ97040.1| Hemolysin C [Ochrobactrum intermedium LMG 3301]
          Length = 376

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 171/265 (64%), Gaps = 22/265 (8%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 74  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEISTPLWEVLELFEKSGHSRMPVYAET 133

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNN----------------------INLNIQLSESNL 167
           LD+PRGM+H+RDV++YI+    +                         I+L   + E NL
Sbjct: 134 LDDPRGMIHIRDVLNYITKQARQKTTRRSSPRSKATAEDKAAKFDMGRIDLTKTIGELNL 193

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           ++ +LFVP SM+ S L+  +Q + I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  
Sbjct: 194 MRKVLFVPPSMMASGLMARMQATHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDD 253

Query: 228 KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           ++ MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGE
Sbjct: 254 EEIMIAEEADGVFVVDARADLEELAAKIGPSFEVGEHGEDVDTVGGLIFSVLGRIPVRGE 313

Query: 288 VVLEIPGFEIVILDADVRCVRRVRI 312
           VV  IPG+E  +L+ D R V++VRI
Sbjct: 314 VVQAIPGYEFHVLEVDPRRVKKVRI 338


>gi|153008091|ref|YP_001369306.1| CBS domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559979|gb|ABS13477.1| CBS domain containing protein [Ochrobactrum anthropi ATCC 49188]
          Length = 373

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 171/265 (64%), Gaps = 22/265 (8%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEISTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNN----------------------INLNIQLSESNL 167
           LD+PRGM+H+RDV++YI+    +                         I+L   + E NL
Sbjct: 132 LDDPRGMIHIRDVLNYITKQARQKTTRRSSARSKATAEDKAAKFDMGRIDLTKTIGELNL 191

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           ++ +LFVP SM+ S L+  +Q + I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  
Sbjct: 192 MRKVLFVPPSMMASGLMARMQATHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDD 251

Query: 228 KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           ++ MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGE
Sbjct: 252 EEIMIAEEADGVFVVDARADLEELAAKIGPSFEVGEHGEDVDTVGGLIFSVLGRIPVRGE 311

Query: 288 VVLEIPGFEIVILDADVRCVRRVRI 312
           VV  IPG+E  +L+ D R V++VRI
Sbjct: 312 VVQAIPGYEFHVLEVDPRRVKKVRI 336


>gi|261324094|ref|ZP_05963291.1| CBS domain-containing protein [Brucella neotomae 5K33]
 gi|261300074|gb|EEY03571.1| CBS domain-containing protein [Brucella neotomae 5K33]
          Length = 372

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 175/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+ ++Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMAHMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|265983152|ref|ZP_06095887.1| CBS domain-containing protein [Brucella sp. 83/13]
 gi|306837708|ref|ZP_07470577.1| CBS domain-containing protein [Brucella sp. NF 2653]
 gi|264661744|gb|EEZ32005.1| CBS domain-containing protein [Brucella sp. 83/13]
 gi|306407266|gb|EFM63476.1| CBS domain-containing protein [Brucella sp. NF 2653]
          Length = 372

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEAAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAAGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|240849889|ref|YP_002971277.1| hemolysin [Bartonella grahamii as4aup]
 gi|240267012|gb|ACS50600.1| hemolysin [Bartonella grahamii as4aup]
          Length = 341

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 177/265 (66%), Gaps = 12/265 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E+ + +NILR R+ R+DD+MI R  I A+E   ++ E +  F K G S +PVY 
Sbjct: 68  ALFSPEERTMLHNILRLREARVDDVMIPRSEIEALEINTSLGETLKCFAKIGHSRLPVYA 127

Query: 128 NSLDNPRGMVHMRDVISYISHMYA------------KTNNINLNIQLSESNLIKNILFVP 175
            +LD+PRGM+H+RD+++Y++                + N+ +L+  + E +LI+ +LFVP
Sbjct: 128 ETLDDPRGMIHIRDILNYMTRFIVNPTKTEQKSDLLQLNHTDLHTPIGELDLIRTVLFVP 187

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
           SSML S LLT +Q +R +MALVIDEHGGTDGLVS EDIV +++ DI  EH +  + I   
Sbjct: 188 SSMLASKLLTRMQTTRTQMALVIDEHGGTDGLVSMEDIVELVVGDIEDEHDNVDNAIVRE 247

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            +N ++VDART+LE++ K +G D    +   DVD++GGLI S+LDRIPA+GE+V  +PG+
Sbjct: 248 PNNKWLVDARTELEDVEKALGPDFIVGEYGDDVDTIGGLIVSILDRIPAKGEIVEAVPGY 307

Query: 296 EIVILDADVRCVRRVRIRRLVHFKN 320
              IL+AD R ++R+RI R+   +N
Sbjct: 308 RFRILEADKRRIKRLRIFRIPKNEN 332


>gi|237816496|ref|ZP_04595489.1| Hemolysin C [Brucella abortus str. 2308 A]
 gi|237788563|gb|EEP62778.1| Hemolysin C [Brucella abortus str. 2308 A]
          Length = 374

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 74  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 133

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 134 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 193

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 194 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 253

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 254 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 313

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 314 QAIPGYEFHVLEVDPRRVKKVRI 336


>gi|148560645|ref|YP_001259951.1| CBS domain-containing protein [Brucella ovis ATCC 25840]
 gi|148371902|gb|ABQ61881.1| CBS domain protein [Brucella ovis ATCC 25840]
          Length = 374

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 74  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 133

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 134 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 193

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 194 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 253

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 254 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 313

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 314 QAIPGYEFHVLEVDPRRVKKVRI 336


>gi|254718194|ref|ZP_05180005.1| CBS domain-containing protein [Brucella sp. 83/13]
          Length = 342

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEAAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAAGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|261215103|ref|ZP_05929384.1| CBS domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261751295|ref|ZP_05995004.1| CBS domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|294851381|ref|ZP_06792054.1| CBS domain-containing protein [Brucella sp. NVSL 07-0026]
 gi|306843574|ref|ZP_07476175.1| CBS domain-containing protein [Brucella sp. BO1]
 gi|260916710|gb|EEX83571.1| CBS domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261741048|gb|EEY28974.1| CBS domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|294819970|gb|EFG36969.1| CBS domain-containing protein [Brucella sp. NVSL 07-0026]
 gi|306276265|gb|EFM57965.1| CBS domain-containing protein [Brucella sp. BO1]
          Length = 372

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|189025206|ref|YP_001935974.1| CBS domain containing protein [Brucella abortus S19]
 gi|254731317|ref|ZP_05189895.1| CBS domain containing protein [Brucella abortus bv. 4 str. 292]
 gi|260546257|ref|ZP_05821997.1| CBS domain-containing protein [Brucella abortus NCTC 8038]
 gi|260755828|ref|ZP_05868176.1| CBS domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260759051|ref|ZP_05871399.1| CBS domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260760776|ref|ZP_05873119.1| CBS domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884853|ref|ZP_05896467.1| CBS domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|297247380|ref|ZP_06931098.1| CBS domain-containing protein [Brucella abortus bv. 5 str. B3196]
 gi|189020778|gb|ACD73500.1| CBS domain containing protein [Brucella abortus S19]
 gi|260096364|gb|EEW80240.1| CBS domain-containing protein [Brucella abortus NCTC 8038]
 gi|260669369|gb|EEX56309.1| CBS domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260671208|gb|EEX58029.1| CBS domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675936|gb|EEX62757.1| CBS domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260874381|gb|EEX81450.1| CBS domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|297174549|gb|EFH33896.1| CBS domain-containing protein [Brucella abortus bv. 5 str. B3196]
          Length = 372

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|261217974|ref|ZP_05932255.1| CBS domain-containing protein [Brucella ceti M13/05/1]
 gi|261321176|ref|ZP_05960373.1| CBS domain-containing protein [Brucella ceti M644/93/1]
 gi|260923063|gb|EEX89631.1| CBS domain-containing protein [Brucella ceti M13/05/1]
 gi|261293866|gb|EEX97362.1| CBS domain-containing protein [Brucella ceti M644/93/1]
          Length = 372

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|261221203|ref|ZP_05935484.1| CBS domain-containing protein [Brucella ceti B1/94]
 gi|261316631|ref|ZP_05955828.1| CBS domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261759088|ref|ZP_06002797.1| CBS domain-containing protein [Brucella sp. F5/99]
 gi|265987703|ref|ZP_06100260.1| CBS domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265997164|ref|ZP_06109721.1| CBS domain-containing protein [Brucella ceti M490/95/1]
 gi|260919787|gb|EEX86440.1| CBS domain-containing protein [Brucella ceti B1/94]
 gi|261295854|gb|EEX99350.1| CBS domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261739072|gb|EEY27068.1| CBS domain-containing protein [Brucella sp. F5/99]
 gi|262551632|gb|EEZ07622.1| CBS domain-containing protein [Brucella ceti M490/95/1]
 gi|264659900|gb|EEZ30161.1| CBS domain-containing protein [Brucella pinnipedialis M292/94/1]
          Length = 372

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|225626523|ref|ZP_03784562.1| Hemolysin C [Brucella ceti str. Cudo]
 gi|225618180|gb|EEH15223.1| Hemolysin C [Brucella ceti str. Cudo]
          Length = 374

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 74  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 133

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 134 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 193

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 194 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 253

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 254 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 313

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 314 QAIPGYEFHVLEVDPRRVKKVRI 336


>gi|256060117|ref|ZP_05450299.1| CBS domain-containing protein [Brucella neotomae 5K33]
          Length = 342

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 175/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+ ++Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMAHMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|163844170|ref|YP_001628575.1| hemolysin C [Brucella suis ATCC 23445]
 gi|163674893|gb|ABY39004.1| Hemolysin C [Brucella suis ATCC 23445]
          Length = 372

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|161620065|ref|YP_001593952.1| hemolysin C [Brucella canis ATCC 23365]
 gi|260567376|ref|ZP_05837846.1| CBS domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|161336876|gb|ABX63181.1| Hemolysin C [Brucella canis ATCC 23365]
 gi|260156894|gb|EEW91974.1| CBS domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 372

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|62290994|ref|YP_222787.1| CBS domain-containing protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700903|ref|YP_415477.1| CBS/transport-associated domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|254690288|ref|ZP_05153542.1| CBS domain containing protein [Brucella abortus bv. 6 str. 870]
 gi|254696404|ref|ZP_05158232.1| CBS domain containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|256258541|ref|ZP_05464077.1| CBS domain containing protein [Brucella abortus bv. 9 str. C68]
 gi|62197126|gb|AAX75426.1| CBS domain protein [Brucella abortus bv. 1 str. 9-941]
 gi|82617004|emb|CAJ12113.1| CBS domain:Transporter associated domain [Brucella melitensis
           biovar Abortus 2308]
          Length = 342

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|254694776|ref|ZP_05156604.1| CBS domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|254700786|ref|ZP_05162614.1| CBS domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|254709131|ref|ZP_05170942.1| CBS domain-containing protein [Brucella pinnipedialis B2/94]
 gi|256030656|ref|ZP_05444270.1| CBS domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|256158658|ref|ZP_05456541.1| CBS domain-containing protein [Brucella ceti M490/95/1]
 gi|256254062|ref|ZP_05459598.1| CBS domain-containing protein [Brucella ceti B1/94]
 gi|256370552|ref|YP_003108063.1| CBS domain protein [Brucella microti CCM 4915]
 gi|260169560|ref|ZP_05756371.1| CBS domain-containing protein [Brucella sp. F5/99]
 gi|256000715|gb|ACU49114.1| CBS domain protein [Brucella microti CCM 4915]
          Length = 342

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|254707328|ref|ZP_05169156.1| CBS domain containing protein [Brucella pinnipedialis M163/99/10]
 gi|261314809|ref|ZP_05954006.1| CBS domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261303835|gb|EEY07332.1| CBS domain-containing protein [Brucella pinnipedialis M163/99/10]
          Length = 310

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 10  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 69

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 70  LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 129

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 130 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 189

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 190 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 249

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 250 QAIPGYEFHVLEVDPRRVKKVRI 272


>gi|254713444|ref|ZP_05175255.1| CBS domain-containing protein [Brucella ceti M644/93/1]
 gi|254716200|ref|ZP_05178011.1| CBS domain-containing protein [Brucella ceti M13/05/1]
          Length = 342

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|23503005|ref|NP_699132.1| CBS domain-containing protein [Brucella suis 1330]
 gi|23349045|gb|AAN31047.1| CBS domain protein [Brucella suis 1330]
          Length = 342

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|261755860|ref|ZP_05999569.1| CBS domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261745613|gb|EEY33539.1| CBS domain-containing protein [Brucella suis bv. 3 str. 686]
          Length = 372

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 173/263 (65%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYI---------SHMYAKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI             AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYIIRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 312 QAIPGYEFHVLEVDPRRVKKVRI 334


>gi|254705155|ref|ZP_05166983.1| hemolysin C [Brucella suis bv. 3 str. 686]
          Length = 342

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 173/263 (65%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYI---------SHMYAKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI             AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYIIRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IPG+E  +L+ D R V++VRI
Sbjct: 282 QAIPGYEFHVLEVDPRRVKKVRI 304


>gi|163867519|ref|YP_001608718.1| hemolysin [Bartonella tribocorum CIP 105476]
 gi|161017165|emb|CAK00723.1| hemolysin [Bartonella tribocorum CIP 105476]
          Length = 341

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 177/265 (66%), Gaps = 12/265 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E+ + +NILR R+ R+DD+MI R  I A+E   ++ EA+  F K G S +PVY 
Sbjct: 68  ALFSPEERTMLHNILRLREARVDDVMIPRSEIEALEINTSLGEALKCFAKIGHSRIPVYA 127

Query: 128 NSLDNPRGMVHMRDVISYISHM------------YAKTNNINLNIQLSESNLIKNILFVP 175
            +LD+PRGM+H+RD+++Y++                + N+ +L+  + E +LI+ +LFVP
Sbjct: 128 ETLDDPRGMIHIRDILNYMTRFIINPTKTEQKSDLLQLNHTDLHTPIGELDLIRTVLFVP 187

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
           SSML S LLT +Q +R +MALVIDEHGGTDGLVS EDIV +++ DI  EH    + I   
Sbjct: 188 SSMLASKLLTRMQTTRTQMALVIDEHGGTDGLVSMEDIVELVVGDIEDEHDHVDNAIVRE 247

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            +N ++VDART+LE++ K +G D    +   +VD++GGLI S+LDRIP +GEVV  +PG+
Sbjct: 248 HNNKWLVDARTELEDVEKALGPDFIVGEYGDEVDTIGGLIVSILDRIPEKGEVVEAVPGY 307

Query: 296 EIVILDADVRCVRRVRIRRLVHFKN 320
           +  IL+AD R ++R+RI R+   +N
Sbjct: 308 KFRILEADKRRIKRLRIFRIPENEN 332


>gi|49475035|ref|YP_033076.1| hemolysin [Bartonella henselae str. Houston-1]
 gi|49237840|emb|CAF27035.1| Hemolysin [Bartonella henselae str. Houston-1]
          Length = 339

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 173/260 (66%), Gaps = 12/260 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E+ + +NILR R+ RIDD+MI R  I A++   ++ EA+  F K G S +PVY 
Sbjct: 66  ALFSPEERTMLHNILRLREARIDDVMIPRSEIEALDINTSLGEALKCFAKIGHSRIPVYA 125

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNI------------NLNIQLSESNLIKNILFVP 175
            +LD+PRGM+H+RD+++YI+    K+               +L+  + E +LI+ +LFVP
Sbjct: 126 ETLDDPRGMIHIRDILNYITRFITKSAQTEQTSDSLQLTYTDLHTPIGELDLIRTVLFVP 185

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
            SML S LLT +Q +R +MALVIDEHGGTDGLVS EDIV +++ DI  EH    + I   
Sbjct: 186 GSMLASTLLTRMQTTRTQMALVIDEHGGTDGLVSMEDIVELVVGDIEDEHDHVDNAIVRE 245

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            +N ++VDART+LE++ K +G D    +   +VD++GGLI S+LDRIPA+GE++  +PG+
Sbjct: 246 PNNKWLVDARTELEDVEKALGPDFIVGEYGDEVDTIGGLIVSILDRIPAKGEIIEAVPGY 305

Query: 296 EIVILDADVRCVRRVRIRRL 315
              IL+AD R ++R+RI R+
Sbjct: 306 RFRILEADKRRIKRLRIFRI 325


>gi|17988256|ref|NP_540890.1| CBS domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|260563056|ref|ZP_05833542.1| CBS domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|265992177|ref|ZP_06104734.1| CBS domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993915|ref|ZP_06106472.1| CBS domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17984024|gb|AAL53154.1| cbs domain containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153072|gb|EEW88164.1| CBS domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|262764896|gb|EEZ10817.1| CBS domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003243|gb|EEZ15536.1| CBS domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 372

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 173/263 (65%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IP +E  +L+ D R V++VRI
Sbjct: 312 QAIPDYEFHVLEVDPRRVKKVRI 334


>gi|225853582|ref|YP_002733815.1| hemolysin C [Brucella melitensis ATCC 23457]
 gi|265999238|ref|ZP_05465466.2| CBS domain-containing protein [Brucella melitensis bv. 2 str. 63/9]
 gi|225641947|gb|ACO01861.1| Hemolysin C [Brucella melitensis ATCC 23457]
 gi|263092808|gb|EEZ16983.1| CBS domain-containing protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 372

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 173/263 (65%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 72  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 131

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 132 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 191

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 192 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 251

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 252 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 311

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IP +E  +L+ D R V++VRI
Sbjct: 312 QAIPDYEFHVLEVDPRRVKKVRI 334


>gi|319408019|emb|CBI81673.1| hemolysin [Bartonella schoenbuchensis R1]
          Length = 342

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 183/268 (68%), Gaps = 18/268 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA+L   FS  E+ + +NILR R+ RIDD+MI R  I A+E    + EA+  FEK G S 
Sbjct: 64  DATL---FSPEERIMLHNILRLRETRIDDVMIPRSEIEALEINTPLGEALECFEKIGYSR 120

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISH-MYAKTNNIN--------------LNIQLSESNL 167
           MPVY  +LD+PRG++H+RD++S+I+  + + T+N N              L+  + + +L
Sbjct: 121 MPVYAETLDDPRGIIHIRDILSHITRFITSSTSNKNGQKSVPLQLNHTDGLDTPIGKLDL 180

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           I+ +LFVPSSML S LLT +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH +
Sbjct: 181 IRTVLFVPSSMLASKLLTRMQATRTQMALVIDEYGGTDGLVSMEDIVELIVGDIEDEHDN 240

Query: 228 KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
             ++I    DN ++VDART+LE++ K +G D    +   +VD++GGLI S+LDRIP++GE
Sbjct: 241 INNVIVREPDNKWLVDARTELEDVEKALGPDFIVGEYGDEVDTIGGLIVSILDRIPSKGE 300

Query: 288 VVLEIPGFEIVILDADVRCVRRVRIRRL 315
           ++  IPG++  IL+AD R ++R+RI R+
Sbjct: 301 IIEAIPGYKFRILEADKRRIKRLRIVRI 328


>gi|256045760|ref|ZP_05448638.1| CBS domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112479|ref|ZP_05453400.1| CBS domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|326410155|gb|ADZ67220.1| hemolysin C [Brucella melitensis M28]
 gi|326539873|gb|ADZ88088.1| hemolysin C [Brucella melitensis M5-90]
          Length = 342

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 173/263 (65%), Gaps = 20/263 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  EK + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +
Sbjct: 42  FSPEEKAMLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAET 101

Query: 130 LDNPRGMVHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIK 169
           LD+PRGM+H+RDV++YI+            AK+           + I+L   + E NL++
Sbjct: 102 LDDPRGMIHIRDVLNYITRQARQKARRRTTAKSAATEVAPKFDMSRIDLAKTIGELNLMR 161

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            +LFVP SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++
Sbjct: 162 KVLFVPPSMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            MI+  +D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV
Sbjct: 222 IMIAEDADGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVV 281

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
             IP +E  +L+ D R V++VRI
Sbjct: 282 QAIPDYEFHVLEVDPRRVKKVRI 304


>gi|319779779|ref|YP_004139255.1| transporter-associated region [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165667|gb|ADV09205.1| transporter-associated region [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 376

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 170/261 (65%), Gaps = 16/261 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G FS  E+ + NNILR R++R++D+M+ R  I  VE   T+ + +  FE+ G S MPVY 
Sbjct: 97  GAFSPGERAMLNNILRLREVRVEDVMVPRADIQGVEITTTLGDLLGTFEQSGHSRMPVYS 156

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNN----------------INLNIQLSESNLIKNI 171
            +LD+PRGMVH+RDV+++I+ +                      ++L   + + NLI+ +
Sbjct: 157 ETLDDPRGMVHIRDVLAHITKIARVKKGRSTRKAPVATVLDLAQVDLARTIGDLNLIRPV 216

Query: 172 LFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM 231
           LFVP SML SDL+  +Q +R +MALVIDE+GGTDGL S EDIV +++ DI  EH   + M
Sbjct: 217 LFVPPSMLASDLMARMQTTRTQMALVIDEYGGTDGLASLEDIVEMVVGDIEDEHDDDEPM 276

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I+   D  FIVD + +++++AK+IG D    +  + VD++GG+IF+ L R+PARGEVV  
Sbjct: 277 ITQSGDGVFIVDGKAEIDDVAKMIGGDFAAGEHGEYVDTIGGMIFNTLGRVPARGEVVQA 336

Query: 292 IPGFEIVILDADVRCVRRVRI 312
           IPGFE  +LDAD R V+RVRI
Sbjct: 337 IPGFEFHVLDADPRRVKRVRI 357


>gi|163757742|ref|ZP_02164831.1| hypothetical protein HPDFL43_20067 [Hoeflea phototrophica DFL-43]
 gi|162285244|gb|EDQ35526.1| hypothetical protein HPDFL43_20067 [Hoeflea phototrophica DFL-43]
          Length = 386

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 185/300 (61%), Gaps = 35/300 (11%)

Query: 33  AFWTRTIRALCKTWKLMKLSHHKGIRLPRIDA-----SLEGIFSETEKEIFNNILRFRKI 87
             W R  RAL         S  + IR    DA      L   FS  E+ + +NILR R++
Sbjct: 48  GLWQRLSRALFPP------SDRETIREDLTDALKSGGELHEAFSADERAMLHNILRLREV 101

Query: 88  RIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS 147
           R++D+M+ R  I AV+   T+   + +FE+ GRS MPVY ++LD+PRGM+H+RD++++I+
Sbjct: 102 RVEDVMVPRAEIEAVDQATTLGHLLEIFEESGRSRMPVYADNLDDPRGMIHIRDLLAWIT 161

Query: 148 -HMYAKT----------------------NNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
               AK                       + ++L+  L ES + + +LFVP+SML +DL+
Sbjct: 162 KQARAKRRPSAKGASAAALKRTSLNALELSRVDLSKTLQESGITRKVLFVPASMLANDLM 221

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVD 243
             +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH   ++++IS   D+ ++VD
Sbjct: 222 QRMQANRTQMALVIDEYGGTDGLVSLEDIVEMVVGDIADEHDDEEETLISKTGDDIWVVD 281

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           A+ +L+++AK IG D +  +  +DVD++GGLIFS L R+PARGEVV  +PGFE  + DAD
Sbjct: 282 AKAELDDIAKEIGPDFDVREQSEDVDTIGGLIFSELGRVPARGEVVQALPGFEFHVTDAD 341


>gi|49473878|ref|YP_031920.1| hemolysin [Bartonella quintana str. Toulouse]
 gi|49239381|emb|CAF25714.1| Hemolysin [Bartonella quintana str. Toulouse]
          Length = 339

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 116/260 (44%), Positives = 173/260 (66%), Gaps = 12/260 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E+ + +NILR R+ R+DD+MI R  I A++    + +A+  F K G S +PVY 
Sbjct: 66  ALFSPEERTMLHNILRLREARVDDVMIPRSEIEALDINTPLGKALKCFAKIGHSRIPVYA 125

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKT------------NNINLNIQLSESNLIKNILFVP 175
            +LD+PRGM+H+RD+++YI+    K+            N+ +L   + E +LI+ +LFVP
Sbjct: 126 ETLDDPRGMIHIRDILNYIARFITKSAQIKQTFDSLQLNHTDLYTPIGELDLIRPVLFVP 185

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
            SML S LLT +Q +R +MALVIDEHGGTDGLVS EDIV +++ DI  EH    + I   
Sbjct: 186 GSMLASKLLTRMQTTRTQMALVIDEHGGTDGLVSMEDIVELVVGDIEDEHDDVDNAIVRE 245

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            +N ++VDA+T+LE++ K +G D    +   +VD++GGLI S+LDRIPA+GEV+  +PG+
Sbjct: 246 PNNKWLVDAKTELEDVEKALGPDFIVGEYGDEVDTIGGLIVSILDRIPAKGEVIEAVPGY 305

Query: 296 EIVILDADVRCVRRVRIRRL 315
              IL+AD R ++R+RI R+
Sbjct: 306 RFRILEADKRRIKRLRIFRI 325


>gi|110636246|ref|YP_676454.1| transporter-associated region [Mesorhizobium sp. BNC1]
 gi|110287230|gb|ABG65289.1| transporter-associated region [Chelativorans sp. BNC1]
          Length = 353

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 170/255 (66%), Gaps = 16/255 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ + NNILR R++R++D+M+ R  I AVE   T+ + +  FE+   S MPVY  +LD+P
Sbjct: 78  ERAMLNNILRLRELRVEDVMVPRADIEAVEMSTTLGDLLNQFERGAHSRMPVYVETLDDP 137

Query: 134 RGMVHMRDVISYISHMYAKTN----------------NINLNIQLSESNLIKNILFVPSS 177
           RGMVH+RDV++++     + N                N++L+  + E  +++ +LFVP S
Sbjct: 138 RGMVHIRDVVAHLIRTARQKNGRGRKVLPANPSLLLGNVDLDRTVGELEIVRPLLFVPPS 197

Query: 178 MLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSD 237
           ML SDL+  +Q +RI+MALVIDE+GGTDGLVS EDIV +++ DI  EH   + MI    D
Sbjct: 198 MLASDLMARMQAARIQMALVIDEYGGTDGLVSLEDIVEMVIGDIEDEHDEDEPMIEKTGD 257

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
             F+VDAR +++E+A+ IG      +  +DVD++GG+IF++L R+PARGEVV  +PGFE 
Sbjct: 258 GIFVVDARAEIDEVAQAIGESFRPGEHAEDVDTIGGMIFNILGRVPARGEVVQAVPGFEF 317

Query: 298 VILDADVRCVRRVRI 312
            +LDAD R V+RVRI
Sbjct: 318 HVLDADPRRVKRVRI 332


>gi|121602803|ref|YP_989495.1| magnesium and cobalt efflux protein CorC [Bartonella bacilliformis
           KC583]
 gi|120614980|gb|ABM45581.1| magnesium and cobalt efflux protein CorC [Bartonella bacilliformis
           KC583]
          Length = 340

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 172/261 (65%), Gaps = 13/261 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E  + +NILR R+ R+DDIMI R  I A++    + EA   FE+ G S MPVY 
Sbjct: 66  ALFSSEESIMLHNILRLRETRVDDIMIPRSEIEALDINTPLGEAFECFERIGHSRMPVYV 125

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKT-------------NNINLNIQLSESNLIKNILFV 174
            +LD+PRGM+H+RD+++Y++    +              N+ +L+  + E +L++ +LFV
Sbjct: 126 ETLDDPRGMIHIRDILNYMTRFITREVHNGQKSSSALQLNHTHLSRPIGELDLVRTVLFV 185

Query: 175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISA 234
           PSSML   LLT +Q +R +MALVIDEHGGTDGLVS EDIV +++ DI  EH S  + I  
Sbjct: 186 PSSMLAKQLLTRMQMTRTQMALVIDEHGGTDGLVSMEDIVELVVGDIEDEHDSVDNAIVR 245

Query: 235 VSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPG 294
             DN ++VDART LE++ K +G D    +   +VD++GGLI SVLDRIP++GE++  +PG
Sbjct: 246 EPDNKWLVDARTKLEDVEKALGPDFIVGEYGDEVDTIGGLIVSVLDRIPSKGEIIEAVPG 305

Query: 295 FEIVILDADVRCVRRVRIRRL 315
           +   IL+AD R ++R+RI R+
Sbjct: 306 YRCRILEADKRRIKRLRIVRI 326


>gi|306842735|ref|ZP_07475377.1| CBS domain-containing protein [Brucella sp. BO2]
 gi|306287079|gb|EFM58584.1| CBS domain-containing protein [Brucella sp. BO2]
          Length = 294

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 170/256 (66%), Gaps = 20/256 (7%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           + +NILR R+IR++D+MI R  + AVE    ++E + +FEK G S MPVY  +LD+PRGM
Sbjct: 1   MLHNILRLREIRVEDVMIPRADVEAVEITTPLWEVLELFEKSGHSRMPVYAETLDDPRGM 60

Query: 137 VHMRDVISYISHMY---------AKT-----------NNINLNIQLSESNLIKNILFVPS 176
           +H+RDV++YI+            AK+           + I+L   + E NL++ +LFVP 
Sbjct: 61  IHIRDVLNYITRQARQKARRRTTAKSAATDAAPKFDMSRIDLAKTIGELNLMRKVLFVPP 120

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           SM+ S L+  +Q S I+MALVIDE+GGTDGLVS EDIV +++ DI  EH  ++ MI+  +
Sbjct: 121 SMMASGLMARMQASHIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDEEIMIAEDA 180

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           D  F+VDAR DLEELA  IG      +  +DVD++GGLIFSVL RIP RGEVV  IPG+E
Sbjct: 181 DGVFVVDARADLEELAARIGPGFAVGEHGEDVDTVGGLIFSVLGRIPVRGEVVQAIPGYE 240

Query: 297 IVILDADVRCVRRVRI 312
             +L+ D R V++VRI
Sbjct: 241 FHVLEVDPRRVKKVRI 256


>gi|319898345|ref|YP_004158438.1| hemolysin [Bartonella clarridgeiae 73]
 gi|319402309|emb|CBI75848.1| hemolysin [Bartonella clarridgeiae 73]
          Length = 340

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/265 (42%), Positives = 174/265 (65%), Gaps = 12/265 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
            +FS  E+ + +NIL  R+ R+D+IMI R  I A+E    + EA+  F K G S +PVY 
Sbjct: 66  ALFSPEERTMLHNILCLREARVDNIMIPRSEIEALEINTPLGEALKFFAKIGHSRIPVYA 125

Query: 128 NSLDNPRGMVHMRDVISYISHMYA------------KTNNINLNIQLSESNLIKNILFVP 175
            +LD+PRGM+H+ D+++YI+                + ++ +L+  + E +LI+ +LFVP
Sbjct: 126 ETLDDPRGMIHIHDILNYITPFITGFTQNEQKYDSLQLSHTDLHHPIGELDLIRTVLFVP 185

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
            SML S LLT +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH +  + I   
Sbjct: 186 RSMLASKLLTRMQTTRTQMALVIDEYGGTDGLVSMEDIVELVVGDIEDEHDNTDNAIVRE 245

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            DN ++VDA+T+L+++ K +G D    +   DVD++GGLI S+LDRIP++GE++  +PG+
Sbjct: 246 PDNKWLVDAKTELKDVEKALGPDFVVGEYGDDVDTIGGLIVSILDRIPSKGEIIETVPGY 305

Query: 296 EIVILDADVRCVRRVRIRRLVHFKN 320
              IL+AD R ++R+RI R+   +N
Sbjct: 306 RFRILEADKRRIKRLRIFRIPENEN 330


>gi|319403637|emb|CBI77222.1| hemolysin [Bartonella rochalimae ATCC BAA-1498]
          Length = 340

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 173/264 (65%), Gaps = 12/264 (4%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +FS  E+ + +NIL  R+ R+D+IMI R  I A+E    + EA+  F K G S +PVY  
Sbjct: 67  LFSPEERTMLHNILCLREARVDNIMIPRSEIEALEINTPLGEALKFFAKIGHSRIPVYAE 126

Query: 129 SLDNPRGMVHMRDVISYISHMYAKT------------NNINLNIQLSESNLIKNILFVPS 176
           +LD+PRGM+H+ D+++YI+     +            N+ +L   + E +LI+ +LFVP 
Sbjct: 127 TLDDPRGMIHIHDILNYITSFITSSTRNEQKYDSLQLNHKDLQHPIGELDLIRTVLFVPR 186

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           SML S LLT +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH +  + I    
Sbjct: 187 SMLASKLLTRMQTTRTQMALVIDEYGGTDGLVSMEDIVELVVGDIEDEHDNIDNAIIRQP 246

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           DN ++VDA+T+L++L K +G D    +   +VD++GGLIFS+LDRIP++GE++  +PG+ 
Sbjct: 247 DNKWLVDAKTELKDLEKALGPDFVVGEYGDEVDTIGGLIFSILDRIPSKGEIIETVPGYR 306

Query: 297 IVILDADVRCVRRVRIRRLVHFKN 320
             IL+AD R ++R+ I R+   +N
Sbjct: 307 FRILEADKRRIKRLCIFRISENEN 330


>gi|319406553|emb|CBI80195.1| hemolysin [Bartonella sp. 1-1C]
          Length = 340

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 173/264 (65%), Gaps = 12/264 (4%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +FS  E+ + +NIL  R+ R+D+IMI R  I A+E    + EA+  F K G S +PVY  
Sbjct: 67  LFSPEERTMLHNILCLREARVDNIMIPRSEIEALEINTPLGEALRFFAKIGHSRIPVYAE 126

Query: 129 SLDNPRGMVHMRDVISYISHMYAKT------------NNINLNIQLSESNLIKNILFVPS 176
           +LD+PRGM+H+ D+++YI+     +            N+ +L   + E +LI+ +LFVP 
Sbjct: 127 TLDDPRGMIHIHDILNYITSFITSSTRNEQKYDSLQLNHKDLQHPIGELDLIRTVLFVPR 186

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           SML S LLT +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH +  + I    
Sbjct: 187 SMLASKLLTRMQTTRTQMALVIDEYGGTDGLVSMEDIVELVVGDIEDEHDNIDNAIIRQP 246

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           DN ++VDA+T+L++L K +G D    +   +VD++GGLIFS+LDRIP++GE++  +PG+ 
Sbjct: 247 DNKWLVDAKTELKDLEKALGPDFVVGEYGDEVDTIGGLIFSILDRIPSKGEIIETVPGYR 306

Query: 297 IVILDADVRCVRRVRIRRLVHFKN 320
             IL+AD R ++R+ I R+   +N
Sbjct: 307 FRILEADKRRIKRLCIFRISENEN 330


>gi|319405107|emb|CBI78711.1| hemolysin [Bartonella sp. AR 15-3]
          Length = 340

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 173/264 (65%), Gaps = 12/264 (4%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +FS  E+ + +NIL  R+ R+D+IMI R  I A+E    + EA+  F K G S +PVY  
Sbjct: 67  LFSPEERTMLHNILCLREARVDNIMIPRSEIEALEINTPLGEALRFFAKIGHSRIPVYAE 126

Query: 129 SLDNPRGMVHMRDVISYISHMYAKT------------NNINLNIQLSESNLIKNILFVPS 176
           +LD+PRGM+H+ D+++YI+     +            ++ +L   + E +LI+ +LFVP 
Sbjct: 127 TLDDPRGMIHIHDILNYITSFITDSTRNAQKYDSLQLDDKDLQHPIGELDLIRTVLFVPR 186

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           SML S LLT +Q +R +MALVIDE+GGTDGLVS EDIV +++ DI  EH +  + I    
Sbjct: 187 SMLASKLLTRMQTTRTQMALVIDEYGGTDGLVSIEDIVELVVGDIEDEHDNIDNAIVREP 246

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           DN ++VDA+T+L+++ K +G D    +   +VD++GGLI S+LDRIP++GE++  +PG+ 
Sbjct: 247 DNKWLVDAKTELKDVEKALGPDFIVGEYGDEVDTIGGLIVSILDRIPSKGEIIETVPGYR 306

Query: 297 IVILDADVRCVRRVRIRRLVHFKN 320
             IL+AD R ++R+RI R+   +N
Sbjct: 307 FRILEADKRRIKRLRIFRISENEN 330


>gi|254471143|ref|ZP_05084546.1| CBS domain containing protein [Pseudovibrio sp. JE062]
 gi|211960285|gb|EEA95482.1| CBS domain containing protein [Pseudovibrio sp. JE062]
          Length = 406

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 189/322 (58%), Gaps = 40/322 (12%)

Query: 32  PAFWTRTIRALCKTWKLMKLSHHKGIR------LPRIDASLEGIFSETEKEIFNNILRFR 85
           P  WTR +++    ++  + S    +R      L R     +  F++ E+E+  NIL+ R
Sbjct: 65  PGVWTR-LKSKLNPFRGFRKSAAVSLREDLEDELARDSEGADAAFTKEERELLTNILQLR 123

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           + R++D+MI R  I AVED  T+ E M +F+  G S MPVY ++LD+PRGMVH++D++SY
Sbjct: 124 ESRVEDVMIPRADIEAVEDTTTIGEVMALFKASGHSRMPVYHDNLDDPRGMVHIKDLMSY 183

Query: 146 ISHMYAKTNN-----------------------------INLNIQLSESNLIKNILFVPS 176
              +  K                                ++L+  L+ + LI+ + FVP 
Sbjct: 184 FVELAVKAKKSEVPLTLVKPEKNASEKTAEEKSLLDLSCVDLSTPLNVTGLIRPLHFVPP 243

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-SVLMRDITSEHHSKKSMISAV 235
           SM  SDL+  +Q +R++MALVIDE+GGTDGLVS EDIV +V+          ++ +I  V
Sbjct: 244 SMSSSDLMKKMQVTRVQMALVIDEYGGTDGLVSLEDIVETVVGDIEDEHDKDEEELIMNV 303

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGE-QDVDSLGGLIFSVLDRIPARGEVVLE--I 292
           S   ++VD R DLE+L + +G D    + + ++VD+LGGL+FS+LDR+P RGE++++  +
Sbjct: 304 SPGVWVVDPRIDLEDLQEELGADFKLGEEQTEEVDTLGGLLFSILDRVPVRGELIIDRSL 363

Query: 293 PGFEIVILDADVRCVRRVRIRR 314
           P FE  ++DAD+R ++R+RI +
Sbjct: 364 PAFEFEVIDADLRRIKRLRISK 385


>gi|114706889|ref|ZP_01439789.1| hemolysin [Fulvimarina pelagi HTCC2506]
 gi|114537837|gb|EAU40961.1| hemolysin [Fulvimarina pelagi HTCC2506]
          Length = 382

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/336 (35%), Positives = 180/336 (53%), Gaps = 40/336 (11%)

Query: 8   NSSEHPKEKNE---GIDLS-PSISKTSVPAFWTRTI-RALCKTWKLMKLSHHKGIRLPRI 62
              EH   + E   G D S P         F++  + R   +  KLM+    + +  P  
Sbjct: 18  GGDEHAGPQTEPASGEDRSRPQGEAKGREGFFSNVLWRFRPRMPKLMREDLTQALSQPND 77

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           D      FS  E+ + NNIL  R++R++DIM+ R  I A +   T+ + M +FE  G S 
Sbjct: 78  DDDGVDSFSPEERAMLNNILALREVRVEDIMVPRADIQAADINMTLGDLMKLFESSGHSR 137

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMY--AKTNN------------------------- 155
           MPVY  SLD+PRGM+H+RDV+ +I+ +   A++ N                         
Sbjct: 138 MPVYGESLDDPRGMIHIRDVVGHITRVARPARSRNGSGHGRSNGNGNGGGSNGSDKDKKP 197

Query: 156 --------INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
                   INL   +    +++ +LFVP SM  SDL+  +Q +R +MALVIDE+GGTDGL
Sbjct: 198 KSGLDLRQINLARTVESLGILRKVLFVPPSMPASDLMARMQATRTQMALVIDEYGGTDGL 257

Query: 208 VSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQD 267
           VS ED++ +++ +I  EH  +  MI    D  +  DAR  L+E+  +IG D +  + E++
Sbjct: 258 VSLEDVIEMVVGNIEDEHDDEAPMIRQAGDGIYTADARAGLDEVKAMIGEDFDVSEYEEE 317

Query: 268 VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            D++GGL+FS L R+P RGEVV  +PGFE  +L+AD
Sbjct: 318 ADTVGGLLFSELGRVPTRGEVVQAVPGFEFQVLEAD 353


>gi|118590492|ref|ZP_01547894.1| hypothetical protein SIAM614_02916 [Stappia aggregata IAM 12614]
 gi|118436955|gb|EAV43594.1| hypothetical protein SIAM614_02916 [Stappia aggregata IAM 12614]
          Length = 398

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 168/276 (60%), Gaps = 39/276 (14%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +  FS  E+ +  NILR R++R+DD+MI R  I+AV+ + ++   M +F+  G S MPVY
Sbjct: 70  DAAFSPEERMLLGNILRLRELRVDDVMIPRADIDAVDQETSLSRVMELFQTSGHSRMPVY 129

Query: 127 KNSLDNPRGMVHMRDVISYISH------------------MYAKTNN------------- 155
           + +LD+PRGMVH++D+++YI+                    Y  +N+             
Sbjct: 130 EETLDDPRGMVHIKDLMAYIAERGASNRPATSVDNENDTIAYQPSNSNSPARNGHNMPDL 189

Query: 156 ----INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYE 211
               ++L++ L +++L++N+LFVP SM  +DL+  +Q  RI+MALVIDE+GGTDGLVS E
Sbjct: 190 DLSCVDLSVSLKDTDLLRNVLFVPPSMPATDLMAKMQADRIQMALVIDEYGGTDGLVSLE 249

Query: 212 DIV-SVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDS 270
           D+V  V+          +++M+++  +  +I D R  LE+L + +GT  N  +  +DVD+
Sbjct: 250 DLVEEVVGDIEDEHDEDEEAMLASAGEGVWIADPRLPLEDLDEALGTHLNDGEISEDVDT 309

Query: 271 LGGLIFSVLDRIPARGEVVL---EIPGFEIVILDAD 303
           LGGL++  + R+P RGE++L   E+PGFE  ++DAD
Sbjct: 310 LGGLLYVSVGRVPVRGELLLVPDEVPGFEFEVMDAD 345


>gi|328545925|ref|YP_004306034.1| hemolysin-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415665|gb|ADZ72728.1| Putative hemolysin-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 332

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 165/266 (62%), Gaps = 25/266 (9%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           D   +  FS  E+ +  NILR R++R+DD+MI R  I+AV+D  T+   M +F+  G S 
Sbjct: 30  DTGADAAFSPEERMLLGNILRLRELRVDDVMIPRADIDAVDDTITLGRLMEVFQDNGHSR 89

Query: 123 MPVYKNSLDNPRGMVHMRDVISYIS----------------------HMYAKTNNINLNI 160
           MPVY  +LD+PRGMVH++D++++I+                      ++    + ++L +
Sbjct: 90  MPVYHETLDDPRGMVHIKDLMAFIAARARASGSGNGETRPEAAGAVRNVALDLSQVDLTL 149

Query: 161 QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-SVLMR 219
            L++++L++ +LFVP SM  +DL+  +Q SR++MALVIDE+GGTDGLVS ED+V +V+  
Sbjct: 150 SLAQTDLLRPLLFVPPSMPATDLMAKMQASRVQMALVIDEYGGTDGLVSLEDLVETVVGD 209

Query: 220 DITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVL 279
                   +++M++   D  +I D R  LE+L + +G         ++VD+LGGL+F+++
Sbjct: 210 IEDEHDEDEEAMLTPAGDGIWIADPRMPLEDLEQELGAGLTIGDVAEEVDTLGGLLFTLV 269

Query: 280 DRIPARGEVVL--EIPGFEIVILDAD 303
            R+P RGE++   ++PG+E  +LDAD
Sbjct: 270 GRVPVRGELIAARQVPGYEFEVLDAD 295


>gi|299133381|ref|ZP_07026576.1| CBS domain containing protein [Afipia sp. 1NLS2]
 gi|298593518|gb|EFI53718.1| CBS domain containing protein [Afipia sp. 1NLS2]
          Length = 368

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/303 (36%), Positives = 174/303 (57%), Gaps = 19/303 (6%)

Query: 28  KTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKI 87
           + +  ++ +R IR+L   WK         + L       E  F+  E+ +  NIL     
Sbjct: 30  RPAAESWLSRAIRSLFG-WKAGSARADIQVVLDATAPDDETSFTAVERTMLRNILSLHDR 88

Query: 88  RIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS 147
           RI D+M+ R  I AV    ++ E M +FE  G S + VY ++LD P G+VH+RD++++I+
Sbjct: 89  RIADVMVPRADIVAVRRDISLAELMSLFESAGHSRLVVYNDTLDEPEGIVHIRDLVAFIT 148

Query: 148 -------HMYAKTN----------NINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
                   + AK            ++NL IQL+++ +++ +L+VP SM   DLL  +Q +
Sbjct: 149 SKAKVDPEVNAKRKKPFPAGLDLKSVNLAIQLADTAIMRELLYVPPSMPAIDLLAQMQAT 208

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDLE 249
           RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S ++  +   +DN+FI D R  LE
Sbjct: 209 RIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSDETPSVVRQADNSFIADGRASLE 268

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
           ++  ++G   N  +  ++VD+LGG I + + R P RGE++     FEI +LDAD R V+R
Sbjct: 269 DVQSVVGDTFNTGEAGEEVDTLGGYIVNQVGRFPVRGEIIPGPGEFEIEVLDADPRRVKR 328

Query: 310 VRI 312
           VRI
Sbjct: 329 VRI 331


>gi|158421635|ref|YP_001522927.1| HlyC/CorC family transporter [Azorhizobium caulinodans ORS 571]
 gi|158328524|dbj|BAF86009.1| HlyC/CorC family transporter [Azorhizobium caulinodans ORS 571]
          Length = 328

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 167/258 (64%), Gaps = 16/258 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS +E+++  NIL  +++ I DIM+ R  I AV+   T+   ++ F K   S + VY ++
Sbjct: 55  FSPSERQMLRNILHLKEVGIGDIMVPRAEIVAVQKDITLGALLIEFAKASHSRLVVYDDT 114

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNN--------------INLNIQLSESNLIKNILFVP 175
           LD+P GMVH+RD++++++ ++   N               +NL   L++++LI+ +L+VP
Sbjct: 115 LDDPVGMVHIRDLLAFMTGLHPGENGEIEVAEGHVPDLSAVNLGQSLADTDLIRRLLYVP 174

Query: 176 SSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV 235
            SM   DLL ++Q +RI +ALVIDE+GGTDGLVS ED+V  ++ +I  EH  + ++I   
Sbjct: 175 PSMPAVDLLVSMQAARIHLALVIDEYGGTDGLVSMEDVVEEIVGEIEDEHDDETALIQLQ 234

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPG- 294
            D +++ DART LE++A+++G+D    +   +VD+LGGL+ ++  R+P  GE++ ++PG 
Sbjct: 235 PDGSYLADARTALEDVAEVVGSDFVPGEAADEVDTLGGLVVTLAARVPNTGEII-QLPGD 293

Query: 295 FEIVILDADVRCVRRVRI 312
           + + +++AD R V+ +RI
Sbjct: 294 YRVEVVEADPRRVKALRI 311


>gi|254503539|ref|ZP_05115690.1| CBS domain pair protein [Labrenzia alexandrii DFL-11]
 gi|222439610|gb|EEE46289.1| CBS domain pair protein [Labrenzia alexandrii DFL-11]
          Length = 338

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 162/270 (60%), Gaps = 36/270 (13%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NILR R+ R+DD+MI R  I AV+   ++   M +F   G S MPVY+++
Sbjct: 19  FSPEERMLLGNILRLREKRVDDVMIPRADIEAVDIGTSLSRVMELFRNSGHSRMPVYEDT 78

Query: 130 LDNPRGMVHMRDVISYISHMYAKTN---------------------------------NI 156
           LD+PRGMVH++D++++I+   A ++                                 ++
Sbjct: 79  LDDPRGMVHIKDLMAFIAEQGAGSSVNGSDSLPPSEDTERLTIVAPAPGHNSSDLDLSSV 138

Query: 157 NLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-S 215
           +L+I L + NLI+N+LFVP SM  +DL+  +Q  RI+MALVIDE+GGTDGLVS ED+V  
Sbjct: 139 DLSISLRDVNLIRNLLFVPPSMPATDLMAKMQAGRIQMALVIDEYGGTDGLVSLEDLVEE 198

Query: 216 VLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLI 275
           V+          +++M++   D  +I D R  LE+L + +GT  +  +  +DVD+LGGL+
Sbjct: 199 VVGDIEDEHDEDEEAMLADAGDGIWIADPRLPLEDLDEALGTLLSDGEISEDVDTLGGLL 258

Query: 276 FSVLDRIPARGEVVL--EIPGFEIVILDAD 303
           +  + R+P RGE+VL  ++PG+E  ++DAD
Sbjct: 259 YVTVGRVPVRGELVLVDDVPGYEFEVMDAD 288


>gi|85714182|ref|ZP_01045171.1| CTransporter-associated region [Nitrobacter sp. Nb-311A]
 gi|85699308|gb|EAQ37176.1| CTransporter-associated region [Nitrobacter sp. Nb-311A]
          Length = 374

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 174/305 (57%), Gaps = 27/305 (8%)

Query: 30  SVPAFW-TRTIRALCKTWKLMKLSHHKGIRLPRIDASL--EGIFSETEKEIFNNILRFRK 86
             P  W  R IR+L   WK   +     + L   DAS   E  F+  E+ +  NIL   +
Sbjct: 31  PAPERWLMRAIRSLF-GWKAGSVRADLQVVL---DASTPDETSFTAIERTMLRNILSLHE 86

Query: 87  IRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYI 146
            RI D+M+ R  I AV+    + E + +FE    S + VY  +LD+P GMVH+RD+++++
Sbjct: 87  RRIADVMVHRADIVAVKRDIPLGELINLFESAAHSRLVVYNENLDDPEGMVHIRDLLAFM 146

Query: 147 SHMYAKT------------------NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           +   A+T                    I+L + LSE+N+I+ +L+VP SM   DLL  +Q
Sbjct: 147 AQ-RARTAMPSTAKRKKAPPAGLDLRAIDLALPLSEANIIRKLLYVPPSMPAIDLLAQMQ 205

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTD 247
            SRI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH   +   I   ++N+FI DAR  
Sbjct: 206 ASRIHLALVVDEYGGTDGLVSIEDIVEQVVGEIDDEHDGDEPPSIVRQTENSFIADARAS 265

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LE++  +IG      +  ++VD+LGG + S + R+P RGEV+L    FEI +LDAD R V
Sbjct: 266 LEDVCDMIGEAFETGEAGEEVDTLGGFLVSYVGRLPVRGEVILGPGPFEIEVLDADPRRV 325

Query: 308 RRVRI 312
           +R+RI
Sbjct: 326 KRLRI 330


>gi|154245757|ref|YP_001416715.1| CBS domain-containing protein [Xanthobacter autotrophicus Py2]
 gi|154159842|gb|ABS67058.1| CBS domain containing protein [Xanthobacter autotrophicus Py2]
          Length = 324

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 180/305 (59%), Gaps = 20/305 (6%)

Query: 23  SPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDA-------SLEGIFSETEK 75
            P+   ++ P  +   +RAL  T++      H  +R   ++          EG F+ +E+
Sbjct: 6   QPTTETSAEPQSFLDRLRALLGTFR-----PHGSLRTDLVEVLDAAEAPEEEGEFTPSER 60

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           ++  NIL  +++ I DIM+ R  I AV    ++ E + +F   G S + VY ++LD+P G
Sbjct: 61  KMLRNILHLKEVGIGDIMVPRAEIVAVRKDVSLGELLKLFVGVGHSRLVVYDDTLDDPVG 120

Query: 136 MVHMRDVISYIS-HMYAKTNN------INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           MVH+RD+I++++  + ++  N      +NL+  L ++ LI+ IL+VP SM   DLL  +Q
Sbjct: 121 MVHIRDLIAFLAGDLTSQPGNKLDLGAVNLDGSLEDAGLIRRILYVPPSMPAVDLLVAMQ 180

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTD 247
            +R  +ALVIDE+GGTDGLVS ED+V  ++ +I  EH  + ++++    D +F+ DART 
Sbjct: 181 AARTHLALVIDEYGGTDGLVSIEDVVEEIVGEIEDEHDEAAETLLIRQPDGSFLADARTP 240

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LE   +++G      +  ++VDSLGGL+  V  R+P +GEV+    GFE  +L+AD R V
Sbjct: 241 LEAAVEVLGPTFASEEAMEEVDSLGGLLVMVASRVPKQGEVIALPGGFEAEVLEADPRRV 300

Query: 308 RRVRI 312
           +++R+
Sbjct: 301 KKLRV 305


>gi|220920278|ref|YP_002495579.1| CBS domain containing protein [Methylobacterium nodulans ORS 2060]
 gi|219944884|gb|ACL55276.1| CBS domain containing protein [Methylobacterium nodulans ORS 2060]
          Length = 373

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 173/320 (54%), Gaps = 55/320 (17%)

Query: 44  KTW--KLMKLSHHKGIRLPR---IDASLEG-----IFSETEKEIFNNILRFRKIRIDDIM 93
           + W  +L+ + H K    PR    DA  E       FS  E+ +  N+L   ++R+DD+M
Sbjct: 25  EPWYDRLLTIFHLKPRETPRDEITDALAEAQSGDHAFSPVERAMLKNVLSLHRVRVDDVM 84

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT 153
           + R  I AV D  ++ E + +F   G S +PVY  +LD+PRGMVH+RD   ++ H+ A+ 
Sbjct: 85  VPRADIVAVPDDISLGELLKVFRTAGHSRLPVYGETLDDPRGMVHIRD---FVDHLAARA 141

Query: 154 NN-----------------------------------INLNIQLSESNLIKNILFVPSSM 178
                                                ++LN  L+ + +++ +LFVP SM
Sbjct: 142 EGGSGRGVKPAAEPPPVIQDDGRARRPQLARTPSLCEVDLNATLASTRILRPVLFVPPSM 201

Query: 179 LVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH---HSKKSMISAV 235
              DLL  +Q SR  MALVIDE+GGTDGL+S ED+V V++ DI  EH      + +    
Sbjct: 202 PAIDLLVRMQASRTHMALVIDEYGGTDGLISIEDLVEVVVGDIEDEHDVAEGHRVLRVEG 261

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGEVVLEIP 293
               ++ DAR  L+++A+  G D     GE  ++VD++GGL+ ++  R+P+RGEV+  +P
Sbjct: 262 ESEIYVADARASLDDVAEATGFDIAAAVGEMAEEVDTIGGLVVTITGRVPSRGEVIA-VP 320

Query: 294 G-FEIVILDADVRCVRRVRI 312
           G FE+ +LDAD R ++R+R+
Sbjct: 321 GDFEVEVLDADPRRIKRLRL 340


>gi|75674216|ref|YP_316637.1| ctransporter-associated region [Nitrobacter winogradskyi Nb-255]
 gi|74419086|gb|ABA03285.1| CTransporter-associated region [Nitrobacter winogradskyi Nb-255]
          Length = 375

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 174/306 (56%), Gaps = 28/306 (9%)

Query: 30  SVPAFW-TRTIRALCKTWKLMKLSHHKGIRLPRIDASL--EGIFSETEKEIFNNILRFRK 86
             P  W  R IR+L   WK   +     + L   DAS   E  F+  E+ +  NIL   +
Sbjct: 31  PAPERWLMRAIRSLFG-WKAGSVRADLQVVL---DASTPDETSFTAVERTMLRNILNLHE 86

Query: 87  IRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYI 146
            RI D+M+ R  I AV+    + E + +FE    S + VY  +LD+P GMVH+RD+++++
Sbjct: 87  RRIADVMVHRADIVAVKRDIPLGELINLFESAAHSRLVVYHENLDDPEGMVHIRDLLAFM 146

Query: 147 SHMYAKT-------------------NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +   A+T                     I+L + LSE+++ + +L+VP SM   DLL  +
Sbjct: 147 AQ-RARTAMPSTAKRKKKTPPAGLDLRAIDLALPLSEADITRKLLYVPPSMPAIDLLAQM 205

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDART 246
           Q SRI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   I   ++N+FI DAR 
Sbjct: 206 QASRIHLALVVDEYGGTDGLVSIEDIVEQVVGEIDDEHDSDEPPSIVRQTENSFIADARA 265

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            LE++  +IG      +  ++VD+LGG + + + R+P RGEV+L    FEI +LDAD R 
Sbjct: 266 SLEDVRAMIGEAFETGEAGEEVDTLGGFLVTYVGRLPVRGEVILGPGPFEIEVLDADPRR 325

Query: 307 VRRVRI 312
           V+R+RI
Sbjct: 326 VKRLRI 331


>gi|146337218|ref|YP_001202266.1| transporter [Bradyrhizobium sp. ORS278]
 gi|146190024|emb|CAL74016.1| putative transporter with CBS domain; putative Magnesium and cobalt
           efflux protein corC [Bradyrhizobium sp. ORS278]
          Length = 399

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 158/261 (60%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL   + RI D+M+ R  I AV    T+ E M +FE    S + VY ++
Sbjct: 71  FSAVERTLLRNILDLHERRIADVMVHRADIVAVRRDITLGELMSLFESASHSRLVVYNDT 130

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNN-----------------INLNIQLSESNLIKNIL 172
           LD+P GMVH+RD+++Y++     +++                 + L++ L E+N+I+ +L
Sbjct: 131 LDDPEGMVHIRDLLAYMTAQARVSDDAKARRKKPLPAGLDLKSVELSMPLFEANIIRKLL 190

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q SRI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 191 YVPPSMRAIDLLAQMQASRIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSDEPPA 250

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I   +DN FI DAR  LE++ ++IG +    +  + V++LGG + + + R+P RGE++  
Sbjct: 251 IMRQADNAFIADARASLEDVRRVIGEEFVTGEAGEGVETLGGYLVNHVGRLPVRGELISG 310

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FE+ +LDAD R V+R+RI
Sbjct: 311 PGNFEVEVLDADPRRVKRLRI 331


>gi|182678044|ref|YP_001832190.1| CBS domain-containing protein [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633927|gb|ACB94701.1| CBS domain containing protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 344

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/275 (37%), Positives = 162/275 (58%), Gaps = 27/275 (9%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           D + +   S  ++ +  N+L   ++R++D+M+ R  I AV   +T+ E + +F   G S 
Sbjct: 51  DTATDAEISPQQRTMLKNVLGLHEVRVEDVMVPRTDIIAVSLDSTLAEVLDLFRSAGHSR 110

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHM-YAKTNNI-------------------NLNI-- 160
           +PV+ ++LD+PRGMVH+RD + Y++ +   +T  +                    L+I  
Sbjct: 111 LPVHGDTLDDPRGMVHIRDFVDYLAGLALPETETVPSHADKTPPAVVKTLAGPYKLDIGA 170

Query: 161 -QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMR 219
             L+E+ +++ +LFVP SM V DLL  +Q +R  MALVIDE+GGTDGL S EDIV +++ 
Sbjct: 171 TTLAEAKILRPVLFVPPSMPVLDLLVKMQATRTHMALVIDEYGGTDGLASIEDIVEMIVG 230

Query: 220 DITSEHHSKKS-MISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSV 278
           DI  EH  ++S  I A  D  FIVDAR DLEE+  + G D   +   +  D+LGGLI ++
Sbjct: 231 DIEDEHDLEESPKIEATEDGAFIVDARADLEEVGAVTGIDFEAMDVTESFDTLGGLITAM 290

Query: 279 LDRIPARGEVVLE-IPGFEIVILDADVRCVRRVRI 312
           +  +P RGE++ E    FE  ILDAD + + R++I
Sbjct: 291 MGHVPVRGEMIEEGTLSFE--ILDADRQKIERIKI 323


>gi|307942738|ref|ZP_07658083.1| CBS domain-containing protein [Roseibium sp. TrichSKD4]
 gi|307773534|gb|EFO32750.1| CBS domain-containing protein [Roseibium sp. TrichSKD4]
          Length = 416

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 152/268 (56%), Gaps = 34/268 (12%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NILR R++RIDD+MI R +I AV+   ++   + +F + G S MPVY  +
Sbjct: 95  FSPEERLLLGNILRLRELRIDDVMIPRANIEAVDSCTSLGRVLDLFRESGHSRMPVYHET 154

Query: 130 LDNPRGMVHMRDVISYISHMYAKT-------------------------------NNINL 158
           LD+PRGMVH++D+++YI+                                       ++L
Sbjct: 155 LDDPRGMVHIKDLMAYIAECGGHCKPDAPGEPEPVAEEDDEQVDPRGHNSREIDLGAVDL 214

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-SVL 217
           +  L ++NL++++LFVP SM  +DL+  +Q  RI+MALVIDE+GGTDGLVS ED+V  V+
Sbjct: 215 STGLRDTNLVRDLLFVPPSMPATDLMAKMQAGRIQMALVIDEYGGTDGLVSLEDLVEEVV 274

Query: 218 MRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
                      + M+    +  +  D R  LEEL K +G+     +  +DVD+LGGL++ 
Sbjct: 275 GDIEDEHDEDDEVMMVPGEEGVWAADPRLPLEELDKALGSKIATGELTEDVDTLGGLLYV 334

Query: 278 VLDRIPARGEV--VLEIPGFEIVILDAD 303
              R+P RGE+  V E+PG+E  ILDAD
Sbjct: 335 TAGRVPVRGELLYVAEVPGYEFEILDAD 362


>gi|323138531|ref|ZP_08073599.1| CBS domain containing protein [Methylocystis sp. ATCC 49242]
 gi|322396165|gb|EFX98698.1| CBS domain containing protein [Methylocystis sp. ATCC 49242]
          Length = 314

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 159/263 (60%), Gaps = 13/263 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  +  E+ +  N+L    +R++D MI R  I AV   A + EA+ +F + G S +PVY 
Sbjct: 51  GDVTPHERALLKNVLSLHDLRVEDAMIPRADIIAVPMDAPLREALKVFREAGHSRLPVYA 110

Query: 128 NSLDNPRGMVHMRDVISYISHMY-----------AKTNNINLNIQLSESNLIKNILFVPS 176
           ++LD+PRGMVH+RD +++++              A+   ++ +  LS ++L+K +LFVP 
Sbjct: 111 DTLDDPRGMVHIRDFVNHLASCAELRAAQSGGTPAEGKKVDFDTPLSAASLLKPVLFVPR 170

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAV 235
           SM   DLL  +Q +R  +ALVIDE+GGTDGLV+ EDI+ +++ DI  EH  S +  I A+
Sbjct: 171 SMPALDLLIRMQATRTHLALVIDEYGGTDGLVTIEDIMEMIVGDIEDEHDVSDEPAIEAL 230

Query: 236 SDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL-EIPG 294
            +  ++VDAR DL+E+   +G D        +V ++GGL+  +  R+P RGE++   +  
Sbjct: 231 ENGDYLVDARADLDEVTVRLGVDFRLEDTPTEVTTIGGLVAWLAGRVPMRGEIIATPVEA 290

Query: 295 FEIVILDADVRCVRRVRIRRLVH 317
           +E  I+DAD R V+++R+R   H
Sbjct: 291 YEFEIVDADPRRVQKLRVRARRH 313


>gi|217979025|ref|YP_002363172.1| CBS domain containing protein [Methylocella silvestris BL2]
 gi|217504401|gb|ACK51810.1| CBS domain containing protein [Methylocella silvestris BL2]
          Length = 357

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 158/281 (56%), Gaps = 39/281 (13%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E+ +  N+L   +++++D+M+ R  I AV    ++ + +  F   G S +PV+ ++L
Sbjct: 59  SPQERAMLKNVLGLHEVQVEDVMVPRADIVAVPLDMSLADVLSTFRTAGHSRLPVHGDTL 118

Query: 131 DNPRGMVHMRDVISYISHMYAKTNN----------------------------------- 155
           D+PRGM+H+RD+++Y +    +  +                                   
Sbjct: 119 DDPRGMIHIRDLVAYFAAGLPEPAHRGEQDFGEAAPETPSGAAQPRELAPRSEPAAAKLW 178

Query: 156 --INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI 213
              +L+I LS++NL++ +LFVP SM   DLL  +Q +R  MALVIDE+GGTDGL S EDI
Sbjct: 179 AFPDLDIPLSQANLLRPVLFVPPSMPALDLLVRMQATRTHMALVIDEYGGTDGLASIEDI 238

Query: 214 VSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLG 272
           V +++ DI  EH   +S  I    D +FIVDAR  LE++++ I  D   +   ++V+++G
Sbjct: 239 VEMIVGDIEDEHDFDESPKIEEAPDGSFIVDARAGLEDVSEAIKADLTAISDAEEVETVG 298

Query: 273 GLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           GLI ++   +P RGE++ E    E  ILDAD R V+RVRIR
Sbjct: 299 GLISTLAGHVPVRGEIITEG-DIEFEILDADPRRVKRVRIR 338


>gi|154254051|ref|YP_001414875.1| CBS domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154158001|gb|ABS65218.1| CBS domain containing protein [Parvibaculum lavamentivorans DS-1]
          Length = 319

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 150/247 (60%), Gaps = 4/247 (1%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            +  E+ +  NIL+F ++R+DD+M+ R  +  VE+   + E + +F     S MP+Y+ +
Sbjct: 61  LTAEERHMLVNILKFGELRVDDVMVPRADVIGVEESCPLEECLRLFHVSSHSRMPIYRET 120

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LD+P GMVH++DV+++++    +          S  ++ +NILFVP SM   DLL  +Q 
Sbjct: 121 LDDPIGMVHLKDVLAWLA---PQEEEAPPRPAFSLRSIRRNILFVPPSMPALDLLVKMQA 177

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDL 248
           +RI +ALVIDE+GGTDGLVS ED+V  ++ +I  EH + +   +    D T   DAR  +
Sbjct: 178 TRIHLALVIDEYGGTDGLVSIEDLVEEIVGEIEDEHDTDEGPALVRREDGTIDADARCPI 237

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           E+L  +IG      + E DVD+L GL+FS+L R+P RGE+V    G E  + DAD R ++
Sbjct: 238 EDLEDMIGLRLVEEEHEDDVDTLAGLVFSLLGRVPLRGELVRHPAGLEFEVKDADARRIK 297

Query: 309 RVRIRRL 315
           R+RI  L
Sbjct: 298 RMRIHLL 304


>gi|91974721|ref|YP_567380.1| HlyC/CorC family transporters [Rhodopseudomonas palustris BisB5]
 gi|91681177|gb|ABE37479.1| putative HlyC/CorC family of transporters [Rhodopseudomonas
           palustris BisB5]
          Length = 375

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 157/261 (60%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           F+  E+ +  NIL   + RI D+M+ R  I A++ +  + E M +FE    S + VY  +
Sbjct: 74  FTALERTMLRNILGLHERRIADVMVHRADIVAIKQEIPLGELMSLFEGAAHSRLVVYNET 133

Query: 130 LDNPRGMVHMRDVISYIS-------HMYAKTNN----------INLNIQLSESNLIKNIL 172
           LD+P G+VH+RD++++++          AK             I+L + L+E+ +I+ +L
Sbjct: 134 LDDPVGLVHIRDLVAFMTSKAKVAPQTVAKRKKTLPAGLDLRAIDLKMPLTETGIIRKLL 193

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 194 YVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSAEPPS 253

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I    D +FI DART LE+ + +IG D    +  +DV++LGG + + + R+P RGEV+  
Sbjct: 254 IVRQPDGSFIADARTSLEDASVMIGDDFVTGEAGEDVETLGGYLVNHVGRLPVRGEVISG 313

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FEI +LDAD R V+R+RI
Sbjct: 314 PGNFEIEVLDADPRRVKRLRI 334


>gi|86747719|ref|YP_484215.1| HlyC/CorC family transporter [Rhodopseudomonas palustris HaA2]
 gi|86570747|gb|ABD05304.1| HlyC/CorC family transporter with CBS domain [Rhodopseudomonas
           palustris HaA2]
          Length = 376

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 116/332 (34%), Positives = 182/332 (54%), Gaps = 27/332 (8%)

Query: 6   KINSSEHPKEKN--EGIDLSPSISKTSV-----PAFWTRTIRALCKTWKLMKLSHHKGIR 58
           +  S+  P E++   G  L   + +  V      A+  R IR+L   WK   +     + 
Sbjct: 6   RAQSAAQPAEQDLPRGQQLPAVVHQGEVLRPAGAAWLMRAIRSLFG-WKPGSVRDDLQVV 64

Query: 59  LPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKY 118
           L    A   G FS  E+ +  NIL   + RI D+M+ R  I A++    + E M +FE  
Sbjct: 65  LDTSPADDTG-FSALERTMLRNILGLHERRIADVMVHRADIVAIKQDIALGELMSLFEGA 123

Query: 119 GRSWMPVYKNSLDNPRGMVHMRDVISYIS-------HMYAKTNN----------INLNIQ 161
             S + VY  +LD+P G+VH+RD++++++          AK             I+L + 
Sbjct: 124 AHSRLVVYDETLDDPVGLVHIRDLVAFMTARAKVAPETVAKRKKALPAGLDLRAIDLKMP 183

Query: 162 LSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI 221
           L+E+ +I+ +L+VP SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I
Sbjct: 184 LTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVGEI 243

Query: 222 TSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLD 280
             EH S +   I   +D +F+ DART LE+  ++IG      +  +DV++LGG + + + 
Sbjct: 244 DDEHDSAEPPSIVQQADGSFVADARTSLEDAREMIGDGFVTGEAGEDVETLGGYLVNHVG 303

Query: 281 RIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           R+P RGEV+     +EI +LDAD R V+R+RI
Sbjct: 304 RLPVRGEVISGPGNYEIEVLDADPRRVKRLRI 335


>gi|115522232|ref|YP_779143.1| CBS domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115516179|gb|ABJ04163.1| CBS domain containing protein [Rhodopseudomonas palustris BisA53]
          Length = 370

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 118/325 (36%), Positives = 179/325 (55%), Gaps = 29/325 (8%)

Query: 8   NSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASL- 66
           N S  P   + G  L P+       ++  R IR L   WK   +     + L   DAS  
Sbjct: 13  NGSNLPAVVHHGDVLRPAAE-----SWLIRAIRTLFG-WKQGSVREDLQVVL---DASAP 63

Query: 67  -EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPV 125
            E  FS  E+ +  NIL   + RI D+M+ R  + AV+   ++ E M +FE    S + V
Sbjct: 64  DEAGFSVIERTMLRNILELNERRIADVMVHRADMVAVKSDISIGELMRLFEDAAHSRLVV 123

Query: 126 YKNSLDNPRGMVHMRDVISYISH-------MYAKTN----------NINLNIQLSESNLI 168
           Y  +LD+P GMVH+RD+++Y++          AK             ++L   L ++N++
Sbjct: 124 YNETLDDPVGMVHIRDLLAYMTARARVIPVAGAKRKKAHPAGLDLRQVDLAQPLMDTNIV 183

Query: 169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS- 227
           + +L+VP SM   DLL  +Q  RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S 
Sbjct: 184 RKLLYVPPSMRAIDLLAQMQALRIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSD 243

Query: 228 KKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +   I   +DN+FI DAR  L+++  +IG +    +  ++V++LGG + S + R+P RGE
Sbjct: 244 EPPSIVRQADNSFIADARASLDDVRTVIGEEFVTGEAGEEVETLGGYLVSHVGRLPVRGE 303

Query: 288 VVLEIPGFEIVILDADVRCVRRVRI 312
           V+     FE V+LDAD R V+R+RI
Sbjct: 304 VIAGPGNFETVVLDADPRRVKRLRI 328


>gi|148251673|ref|YP_001236258.1| transporter [Bradyrhizobium sp. BTAi1]
 gi|146403846|gb|ABQ32352.1| putative transporter with CBS domain [Bradyrhizobium sp. BTAi1]
          Length = 386

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 156/261 (59%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL   + RI D+M+ R  I AV     + E M +FE    S + VY ++
Sbjct: 69  FSAVERTLLRNILDLHERRIADVMVHRADIVAVRRDIPLGELMSLFESASHSRLVVYNDT 128

Query: 130 LDNPRGMVHMRDVISYISHMY-----AKT------------NNINLNIQLSESNLIKNIL 172
           LD+P GMVH+RD++++++        AK               ++L + L E+N+I+ +L
Sbjct: 129 LDDPEGMVHIRDLLAFMTAQARVSDEAKARRKKPLPAGLDLKTVDLAMPLFEANIIRKLL 188

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q SRI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 189 YVPPSMRAIDLLAQMQASRIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSDEPPA 248

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I   +DN FI DAR  L+++ ++IG +    +  + V++LGG + + + R+P RGE++  
Sbjct: 249 IMRQADNAFIADARASLDDVRRVIGEEFVTGEAGEGVETLGGYLVNHVGRLPVRGELISG 308

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FE+ +LDAD R V+R+RI
Sbjct: 309 PGNFEVEVLDADPRRVKRLRI 329


>gi|304393795|ref|ZP_07375720.1| hemolysin [Ahrensia sp. R2A130]
 gi|303293994|gb|EFL88369.1| hemolysin [Ahrensia sp. R2A130]
          Length = 399

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 166/286 (58%), Gaps = 45/286 (15%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NILRFR+ R++D+M+ R  I+AV    T+ E +  F+  G S MPVY ++
Sbjct: 100 FSPEERALLQNILRFREQRVEDVMVPRAEIHAVSHDDTLEEVLREFQDNGHSRMPVYDDT 159

Query: 130 LDNPRGMVHMRDVISYI--------------------------SHMYAKT---------- 153
           LD+PRGMV ++D++++I                          +   +KT          
Sbjct: 160 LDDPRGMVLVKDLLTHIIATAQAPKKKRTTKAKTDKPAKVATKAKTASKTATKPAEIESG 219

Query: 154 ----NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVS 209
                 ++L+I L ++++++ +LFVP SML SDL+  +Q +R +MALVIDE+GGTDGLVS
Sbjct: 220 SIDLTKVSLSIPLRDTDIMRKVLFVPPSMLASDLMARMQATRTQMALVIDEYGGTDGLVS 279

Query: 210 Y-EDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQ-- 266
             + +  V+             +I++  D  ++VD R +LE+L + IG   + + GE+  
Sbjct: 280 LEDVVEEVVGEIEDEHDDDDDDLITSQGDGLWLVDPRIELEKLVEEIGD--HFIPGERGD 337

Query: 267 DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           DVD+LGGL F++   +P RGEVV  IPGFE+ +L+AD R +RR+++
Sbjct: 338 DVDTLGGLAFAIAGHVPVRGEVVRGIPGFELRVLEADPRRIRRLQL 383


>gi|209883671|ref|YP_002287528.1| CBS:transporter-associated [Oligotropha carboxidovorans OM5]
 gi|209871867|gb|ACI91663.1| CBS:transporter-associated [Oligotropha carboxidovorans OM5]
          Length = 367

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 111/319 (34%), Positives = 174/319 (54%), Gaps = 29/319 (9%)

Query: 23  SPSISKT-SVPAFWTRTIRALCKTWKLMKLSHHKGIRLPR--------IDASL--EGIFS 71
           +PS + T  VP      +R    +W L  +    G +           +DAS   E  F+
Sbjct: 11  TPSSNTTLPVPVQHGEVLRPTADSWLLRAIRSLFGWKAGSARADIQVVLDASAPDETSFT 70

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
             E+ +  NIL     RI D+M+ R  I AV    ++ E   +FE  G S + VY ++LD
Sbjct: 71  AAERTMLRNILALHDRRIVDVMVPRADIVAVRRDISLGELTSLFESAGHSRLVVYNDTLD 130

Query: 132 NPRGMVHMRDVISYIS-------HMYAKTN----------NINLNIQLSESNLIKNILFV 174
            P G+VH+RD++++I+        + AK            ++NL I LSE+ +++ +L+V
Sbjct: 131 EPEGIVHIRDLVAFIASKAKVDPEVNAKRKKPFPAGLDLKSVNLAIPLSETLIMRELLYV 190

Query: 175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-IS 233
           P SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S ++  + 
Sbjct: 191 PPSMPAIDLLAQMQATRIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSDEAPSVV 250

Query: 234 AVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP 293
              D +FI D R  L+++   +G   N  +  ++VD+LGG + + + R P RGE++    
Sbjct: 251 RQPDGSFIADGRASLDDVKAAVGDAFNTGEAGEEVDTLGGYLVNQIGRFPVRGEIIPGPG 310

Query: 294 GFEIVILDADVRCVRRVRI 312
            FE+ +LDAD R ++RVRI
Sbjct: 311 NFEVEVLDADPRRIKRVRI 329


>gi|92115657|ref|YP_575386.1| CBS:transporter-associated [Nitrobacter hamburgensis X14]
 gi|91798551|gb|ABE60926.1| CBS:transporter-associated [Nitrobacter hamburgensis X14]
          Length = 374

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 171/299 (57%), Gaps = 24/299 (8%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASL--EGIFSETEKEIFNNILRFRKIRIDD 91
           +  R IR+L   WK   +     + L   DAS   E  F+  E+ +  NIL   + RI D
Sbjct: 36  WLMRAIRSLF-GWKAGSVRADLQVVL---DASTPDETSFTAVERAMLRNILNLHERRIAD 91

Query: 92  IMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISH--- 148
           +M+ R  I AV+    + E + +FE    S + VY  +LD+P G+VH+RD++++++    
Sbjct: 92  VMVHRADIVAVKRDIPLGELINLFESAAHSRLVVYHENLDDPEGIVHIRDLLAFMAARAR 151

Query: 149 --MYAKTNN------------INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
             M +K               I+L + L E+N+ + +L+VP SM   DLL  +Q +RI +
Sbjct: 152 TAMPSKAKRKKAPPAGLDLRAIDLALPLCEANITRKLLYVPPSMPAIDLLAQMQATRIHL 211

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAK 253
           ALV+DE+GGTDGLVS EDIV  ++ +I  EH   +   I   +D++FI DAR  LE++  
Sbjct: 212 ALVVDEYGGTDGLVSLEDIVEQIVGEIDDEHDGDEPPSIVRQADHSFIADARASLEDVRA 271

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +IG +    +  +DVD+LGG + + + R+P RGEV+     FEI +LDAD R V+R+RI
Sbjct: 272 MIGDEFVIGEAGEDVDTLGGFLVTHVGRLPVRGEVISGPGPFEIEVLDADPRRVKRLRI 330


>gi|170741364|ref|YP_001770019.1| CBS domain-containing protein [Methylobacterium sp. 4-46]
 gi|168195638|gb|ACA17585.1| CBS domain containing protein [Methylobacterium sp. 4-46]
          Length = 389

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 109/334 (32%), Positives = 179/334 (53%), Gaps = 67/334 (20%)

Query: 44  KTW--KLMKLSHHKGIRLPR---IDASLEG-----IFSETEKEIFNNILRFRKIRIDDIM 93
           + W  +L+ + H K    PR    DA  E       FS  E+ +  N+L   ++R+DD+M
Sbjct: 25  EPWYDRLLTIFHLKPREAPRDEITDALAEAQSGDHAFSPVERAMLKNVLSLHRVRVDDVM 84

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS------ 147
           + R  I AV  + ++ E + +F   G S +PVY ++LD+PRGMVH+RD + +++      
Sbjct: 85  VPRADIVAVPAEISLGELLKVFRTAGHSRLPVYGDTLDDPRGMVHIRDFVDHLATRAEAG 144

Query: 148 ----------------------------------------HMYAKTNN---INLNIQLSE 164
                                                   H+ A+T +   ++L++ L+ 
Sbjct: 145 AAHGAKSPARSPANSPANSPAKPAAEPPPVIQGDGRARRPHL-ARTPDLCEVDLDLSLAA 203

Query: 165 SNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE 224
           + +++ +L+VP SM   DLL  +Q SR  MALVIDE+GGTDGL+S ED++ V++ DI  E
Sbjct: 204 TRILRPVLYVPPSMPAIDLLVRMQASRTHMALVIDEYGGTDGLISIEDLIEVVVGDIEDE 263

Query: 225 HHSKKSMISAVSDNT---FIVDARTDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVL 279
           H   +       D     ++ DAR  L+++A+  G D     GE  ++VD++GGL+ ++ 
Sbjct: 264 HDVAEGHRVLRVDGEAEIYVADARASLDDVAEATGFDIAGAVGELAEEVDTIGGLVVTIT 323

Query: 280 DRIPARGEVVLEIPG-FEIVILDADVRCVRRVRI 312
            R+P+RGEVV  +PG FE+ +LDAD R ++R+R+
Sbjct: 324 GRVPSRGEVVA-VPGDFEVEVLDADPRRIKRLRL 356


>gi|27375903|ref|NP_767432.1| magnesium and cobalt efflux protein [Bradyrhizobium japonicum USDA
           110]
 gi|27349041|dbj|BAC46057.1| magnesium and cobalt efflux protein [Bradyrhizobium japonicum USDA
           110]
          Length = 381

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 155/261 (59%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL   + RI D+M+ R  I AV+    + E M  FE  G S + VY  +
Sbjct: 77  FSAVERTMLRNILGLHERRIADVMVHRADIIAVKRDIPLGELMDRFESAGHSRLVVYNET 136

Query: 130 LDNPRGMVHMRDVISYISHMY-----AKTN------------NINLNIQLSESNLIKNIL 172
           LD+P G+VH+RD++++++         KT              ++L + L ++ +I+ +L
Sbjct: 137 LDDPVGIVHIRDLLAFMTARARVSDATKTKRKKPLPAGLDLRTVDLAMPLEDARIIRKLL 196

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q +RI +ALV+DE+GG+DGLVS EDIV  ++ +I  EH S +   
Sbjct: 197 YVPPSMRAIDLLAQMQATRIHLALVVDEYGGSDGLVSLEDIVEQIVGEIDDEHDSDEPPS 256

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I  + DN FI DAR  L+++  +IG D    +  ++V++LGG + S + R+P RGEV+  
Sbjct: 257 IVRLPDNAFIADARASLDDVRTVIGADFVTGEAGEEVETLGGYLVSFVGRLPVRGEVISG 316

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              +E+ +LDAD R V+R+RI
Sbjct: 317 PGNYEVEVLDADPRRVKRLRI 337


>gi|90421995|ref|YP_530365.1| CBS [Rhodopseudomonas palustris BisB18]
 gi|90104009|gb|ABD86046.1| CBS [Rhodopseudomonas palustris BisB18]
          Length = 420

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 161/294 (54%), Gaps = 51/294 (17%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL   + RI D+M+ R  I A++   T+ E M +FE    S + VY  +
Sbjct: 73  FSAIERTMLRNILGLHERRIADVMVHRADIVAIKQDITLGELMGLFESAAHSRLVVYNET 132

Query: 130 LDNPRGMVHMRDVISYISHMY---------------------------------AKTNN- 155
           LD+P G+VH+RD+++Y++                                    AKT+  
Sbjct: 133 LDDPVGIVHIRDLLAYMTARARDELPSKSKASSKAAAAATPAAAVKTSPAKTSPAKTSPG 192

Query: 156 ----------------INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
                           I+L I L+E+ +I+ +L+VP SM   DLL  +Q SRI +ALV+D
Sbjct: 193 KSSRKKPSPNSLDLRAIDLKIPLTETGIIRKLLYVPPSMRAIDLLAQMQASRIHLALVVD 252

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GGTDGLVS EDIV  ++ +I  EH S +   I   +DN+FI DAR  LE++ ++IG D
Sbjct: 253 EYGGTDGLVSIEDIVEQIVGEIDDEHDSAEPPSIVRQADNSFIADARASLEDVRQVIGED 312

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
               +  ++V++LGG + + + R+P RGEV+     +EI +LDAD R V+R+RI
Sbjct: 313 FVTGEAGEEVETLGGYLVTHVGRLPVRGEVISGPGNYEIEVLDADPRRVKRLRI 366


>gi|163852622|ref|YP_001640665.1| CBS domain-containing protein [Methylobacterium extorquens PA1]
 gi|218531463|ref|YP_002422279.1| CBS domain containing protein [Methylobacterium chloromethanicum
           CM4]
 gi|240139955|ref|YP_002964432.1| putative HlyC/CorC family of transporters with CBS domains
           [Methylobacterium extorquens AM1]
 gi|254562380|ref|YP_003069475.1| HlyC/CorC family of transporters with CBS domains [Methylobacterium
           extorquens DM4]
 gi|163664227|gb|ABY31594.1| CBS domain containing protein [Methylobacterium extorquens PA1]
 gi|218523766|gb|ACK84351.1| CBS domain containing protein [Methylobacterium chloromethanicum
           CM4]
 gi|240009929|gb|ACS41155.1| Putative HlyC/CorC family of transporters with CBS domains
           [Methylobacterium extorquens AM1]
 gi|254269658|emb|CAX25630.1| Putative HlyC/CorC family of transporters with CBS domains
           [Methylobacterium extorquens DM4]
          Length = 382

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 159/293 (54%), Gaps = 48/293 (16%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           E  FS  E+ +  N+L   K+R+DD+M+ R  I AV    ++ + + +F   G S +PVY
Sbjct: 57  EDAFSPLERAMLKNVLGLHKVRVDDVMLPRADIVAVASDTSLGDLLKLFRTAGHSRLPVY 116

Query: 127 KNSLDNPRGMVHMRDVISYISHMY------------------AKT--------------- 153
             +LD+PRGMVH+RD + Y++                     AK                
Sbjct: 117 GETLDDPRGMVHIRDFVEYLATQAEAAPRRAAPQPVVATGAEAKPTPRPRRTASARGALR 176

Query: 154 ----NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVS 209
                 ++L   L+ + + + +LFVP SM   DLL  +Q +R  MALVIDE+GGTDGL+S
Sbjct: 177 SLDLGKVDLTATLASTRIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYGGTDGLIS 236

Query: 210 YEDIVSVLMRDITSEHH-SKKSMISAVSDNT--FIVDARTDLEELAKIIGTDCNCLKGE- 265
            ED++ +++ DI  EH  ++  +++ +   T  +I DAR  L E++   G D     GE 
Sbjct: 237 IEDLIEMVVGDIEDEHDVAEGQLVNRMEGETEAYIADARAGLAEVSAATGLDLAAAFGEL 296

Query: 266 -QDVDSLGGLIFSVLDRIPARGEVVLEIPG---FEIVILDADVRCVRRVRIRR 314
            +++D++GGLI ++  R+PARGE    IPG    E  +LDAD R V+R++++R
Sbjct: 297 AEEIDTIGGLIVTLAGRVPARGE---RIPGPDDIEFEVLDADPRRVKRIKLQR 346


>gi|298293908|ref|YP_003695847.1| hypothetical protein Snov_3958 [Starkeya novella DSM 506]
 gi|296930419|gb|ADH91228.1| CBS domain containing protein [Starkeya novella DSM 506]
          Length = 423

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 180/326 (55%), Gaps = 37/326 (11%)

Query: 23  SPSISKTSVP--AFWTRTIRALCKTWKLM-KLSHHKGIRLPRIDASLEGIFSETEKEIFN 79
           SP+ +++S P    + R +RAL   W+    L       L    A      S TE+ +  
Sbjct: 40  SPADARSSEPRGGIFDR-LRALIGGWRSSGSLRTDLAEVLSAASAEAGSDLSATERAMLK 98

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           +IL  R++RI D+M+ R  I AV+   ++ E + +F   G S + VY ++LD+P GMVH+
Sbjct: 99  SILDLRELRIGDLMVPRADIIAVQKDISLGELLTVFADAGHSRLVVYDDTLDDPVGMVHI 158

Query: 140 RDVISYISHMY---------AKTNN-----------------------INLNIQLSESNL 167
           RD+++Y++              T N                       I+L   LS + L
Sbjct: 159 RDLVTYLTQRAMTPRHPAPRGTTPNTSPEEKPAEQPAGKPVPSFNLKAIDLGTPLSAAKL 218

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           I+ +LFVP SM   +LL ++Q SRI +ALVIDE+GGTDG+VS ED+V  ++ DI  EH  
Sbjct: 219 IRRLLFVPPSMPSIELLASMQASRIHLALVIDEYGGTDGIVSMEDLVEEIVGDIEDEHDE 278

Query: 228 KKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            ++  I+   D +FI DAR  LE++A+++       +  ++VD+LGGL+ ++  R+P RG
Sbjct: 279 DETPDIARQPDGSFIADARASLEDVAEMVDPAFALGEEAEEVDTLGGLLVTLAGRVPVRG 338

Query: 287 EVVLEIPGFEIVILDADVRCVRRVRI 312
           E+VL    FEI +LDAD R V+R+R+
Sbjct: 339 EIVLGPGNFEIEVLDADPRRVKRLRL 364


>gi|300024989|ref|YP_003757600.1| CBS domain containing protein [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526810|gb|ADJ25279.1| CBS domain containing protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 343

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 161/275 (58%), Gaps = 26/275 (9%)

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           + DAS    F++TE+++   +LRF   R+ ++M+ R  I A+++  ++ E +  FE+ G 
Sbjct: 53  KTDASTS--FTDTERKMLERLLRFGSSRVVELMVPRAEITALDENESIAELLETFEEAGV 110

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYI-------------------SHMYAKT--NNINLN 159
           S +P+++ +LD+PRGM+H++D+  +                    + +  K    NI+LN
Sbjct: 111 SRIPLFRETLDDPRGMIHIKDLFRWFMAEASGRPVRSGKIEGGEDAPVAGKIVLQNIDLN 170

Query: 160 IQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMR 219
             ++   + + IL+VP SM   DLL  +Q +RI MALV+DE+GGTDGLV+ ED+V  ++ 
Sbjct: 171 RPITTVKIRRQILYVPPSMPAVDLLIRMQSTRIHMALVVDEYGGTDGLVTIEDLVEQVVG 230

Query: 220 DITSEHHSKKSMISAVSDNTF--IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
           +I    H     I+ VSD     +   RT++EEL K +         E DVD+LGGLIFS
Sbjct: 231 NIED-EHDDDEEINIVSDPKLGVVAAGRTEIEELEKHLKLKLTPEDEESDVDTLGGLIFS 289

Query: 278 VLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +L R+PARGE++    G E  ILDAD R V++V+I
Sbjct: 290 MLGRVPARGELIHHPSGIEFEILDADPRRVKKVKI 324


>gi|316931570|ref|YP_004106552.1| CBS domain-containing protein [Rhodopseudomonas palustris DX-1]
 gi|315599284|gb|ADU41819.1| CBS domain containing protein [Rhodopseudomonas palustris DX-1]
          Length = 379

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 153/261 (58%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL     RI D+M+ R  I A++    + E + +F+    S + VY  +
Sbjct: 74  FSTLERTMLRNILGLHDRRIADVMVHRADIVAIKQDIQLGELLSLFQNAAHSRLVVYNET 133

Query: 130 LDNPRGMVHMRDVISYIS-------HMYAKTNN----------INLNIQLSESNLIKNIL 172
           LD+P G+VH+RD++++++          AK             I+L + L+E+ +I+ +L
Sbjct: 134 LDDPVGIVHIRDLVAFMTANAKVPPETVAKRKKALPAGLDLRAIDLKMPLTETGIIRKLL 193

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 194 YVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSTEPPA 253

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I   +D +FI DA+  LE++  +IG      +  +DV++LGG + + + R+P RGEV+  
Sbjct: 254 IVRQADGSFIADAKASLEDVCAMIGDQFVTGEAGEDVETLGGYLVNHVGRLPVRGEVIAG 313

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FE  +LDAD R V+R+RI
Sbjct: 314 PGNFEFEVLDADPRRVKRLRI 334


>gi|192288880|ref|YP_001989485.1| CBS domain containing protein [Rhodopseudomonas palustris TIE-1]
 gi|192282629|gb|ACE99009.1| CBS domain containing protein [Rhodopseudomonas palustris TIE-1]
          Length = 381

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 153/261 (58%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL     RI D+M+ R  I A++    + E + +F+    S + VY  +
Sbjct: 74  FSTLERTMLRNILGLHDRRIADVMVHRADIVAIKQDIQLGELLSLFQDAAHSRLVVYNET 133

Query: 130 LDNPRGMVHMRDVISYISH-------MYAKTNN----------INLNIQLSESNLIKNIL 172
           LD+P G+VH+RD++++++          AK             I+L + L+E+ +I+ +L
Sbjct: 134 LDDPVGIVHIRDLVAFMTAKAKVPPATVAKRKKALPAGLDLRAIDLKMPLTETGIIRKLL 193

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 194 YVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSTEPPS 253

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I   +D +FI DAR  LE++  +IG      +  +DV++LGG + + + R+P RGEV+  
Sbjct: 254 IVRQADGSFIADARASLEDVRAMIGDQFVTGEAGEDVETLGGYLVNHVGRLPVRGEVIAG 313

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FE  +LDAD R V+R+RI
Sbjct: 314 PGTFEFEVLDADPRRVKRLRI 334


>gi|39933522|ref|NP_945798.1| HlyC/CorC family transporter [Rhodopseudomonas palustris CGA009]
 gi|39647368|emb|CAE25889.1| possible HlyC/CorC family of transporters with CBS domains
           [Rhodopseudomonas palustris CGA009]
          Length = 381

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 153/261 (58%), Gaps = 18/261 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FS  E+ +  NIL     RI D+M+ R  I A++    + E + +F+    S + VY  +
Sbjct: 74  FSTLERTMLRNILGLHDRRIADVMVHRADIVAIKQDIQLGELLSLFQDAAHSRLVVYNET 133

Query: 130 LDNPRGMVHMRDVISYISH-------MYAKTNN----------INLNIQLSESNLIKNIL 172
           LD+P G+VH+RD++++++          AK             I+L + L+E+ +I+ +L
Sbjct: 134 LDDPVGIVHIRDLVAFMTAKAKVPPATVAKRKKALPAGLDLRAIDLKMPLTETGIIRKLL 193

Query: 173 FVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSM 231
           +VP SM   DLL  +Q +RI +ALV+DE+GGTDGLVS EDIV  ++ +I  EH S +   
Sbjct: 194 YVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVGEIDDEHDSTEPPS 253

Query: 232 ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
           I   +D +FI DAR  LE++  +IG      +  +DV++LGG + + + R+P RGEV+  
Sbjct: 254 IVRQADGSFIADARASLEDVRAMIGDQFVTGEAGEDVETLGGYLVNHVGRLPVRGEVIAG 313

Query: 292 IPGFEIVILDADVRCVRRVRI 312
              FE  +LDAD R V+R+RI
Sbjct: 314 PGTFEFEVLDADPRRVKRLRI 334


>gi|296447882|ref|ZP_06889793.1| CBS domain containing protein [Methylosinus trichosporium OB3b]
 gi|296254623|gb|EFH01739.1| CBS domain containing protein [Methylosinus trichosporium OB3b]
          Length = 324

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 162/286 (56%), Gaps = 34/286 (11%)

Query: 62  IDASLE---GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKY 118
           I+ +LE   G  +  E+ +  N+L    +R+ D M+ R  I AV   AT+ E + +F   
Sbjct: 40  IEEALEDATGDVTPHERVLLKNVLALHDLRVADAMVPRADIVAVGQDATLGETLALFRNA 99

Query: 119 GRSWMPVYKNSLDNPRGMVHMRDVISYISHM----------------------YAKTNN- 155
           G S +PVY ++LD+PRGM+H+RD + Y++ +                      +A T + 
Sbjct: 100 GHSRLPVYGDTLDDPRGMIHIRDFVDYLASLAERAEPAAAAPKGDAQDHASMEHAPTASL 159

Query: 156 --INLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI 213
             I+ +  LS  +++K +L+VP SM   DLL  +Q +   +ALVIDE+GGT GL + EDI
Sbjct: 160 AAIDFSTPLSTVDVLKPVLYVPPSMPALDLLVKMQATHTHLALVIDEYGGTHGLATMEDI 219

Query: 214 VSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLG 272
           V +++ DI  EH   ++  I  VS+  +++DA+ DLEE+++ +G D    +   +V +LG
Sbjct: 220 VEMIVGDIEDEHDIDEEPRIETVSEGVYMIDAKADLEEVSRRLGVDFTPEENGAEVTTLG 279

Query: 273 GLIFSVLDRIPARGEVV-LEIPGFEIVILDADVRCVRRVRIRRLVH 317
           GL+ S+   +P RGE+V   + G+E  I+DAD R V R+    LVH
Sbjct: 280 GLVASLAGHVPMRGEIVPAPVEGWEFEIVDADPRRVGRL----LVH 321


>gi|170747070|ref|YP_001753330.1| CBS domain-containing protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170653592|gb|ACB22647.1| CBS domain containing protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 377

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 160/297 (53%), Gaps = 46/297 (15%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA   G+ +  E+ +  N+L   K+R+DD+M+ R  I AV +  ++ + + +F   G S 
Sbjct: 55  DAGESGL-TPLERVMLKNVLGLHKVRVDDVMVPRADIVAVSNDTSLGDLLKLFRTAGHSR 113

Query: 123 MPVYKNSLDNPRGMVHMRDVISYIS----------HMYAKT------------------- 153
           +PVY  +LD+PRGMVH+RD++ +I+             AK                    
Sbjct: 114 LPVYGETLDDPRGMVHIRDLVDHIAAKAEPARRSAPAVAKPVEVAVDGAADTPAAPRPRR 173

Query: 154 -----------NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHG 202
                        ++L   L+ + + + +LFVP SM   DLL  +Q +R  MALVIDE+G
Sbjct: 174 PAARLPRGLDLGKVDLTTTLAAARIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYG 233

Query: 203 GTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAV--SDNTFIVDARTDLEELAKIIGTDC 259
           GTDGL+S ED++ V++ DI  EH  ++   +  V      F+ DART L E++++ G D 
Sbjct: 234 GTDGLISIEDLIEVVVGDIEDEHDVAEDKHVQRVEGEGEVFVADARTPLAEVSEVTGVDL 293

Query: 260 NCLKGE--QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
               GE  +++D+LGG+I ++  R+P+RGE++      E  +LDAD R ++R+R  +
Sbjct: 294 VAAVGEMAEEIDTLGGMIVTLAGRVPSRGELIAGPGDLEFEVLDADPRRLKRLRFHK 350


>gi|188582643|ref|YP_001926088.1| CBS domain containing protein [Methylobacterium populi BJ001]
 gi|179346141|gb|ACB81553.1| CBS domain containing protein [Methylobacterium populi BJ001]
          Length = 384

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 154/292 (52%), Gaps = 44/292 (15%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           E  FS  E+ +  N+L   K+R+DD+M+ R  I AV    ++ + + +F   G S +PVY
Sbjct: 57  EDAFSPLERAMLKNVLGLHKVRVDDVMLPRADIVAVASDTSLGDLLRLFRTAGHSRLPVY 116

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKT--------------------------------- 153
             +LD+PRGMVH+RD + Y++                                       
Sbjct: 117 GETLDDPRGMVHIRDFVEYLATQAEAAPRRPAPRVVNDGEADGESKPAPRPRRTASARGA 176

Query: 154 ------NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
                   ++L   L+ + + + +LFVP SM   DLL  +Q +R  MALVIDE+GGTDGL
Sbjct: 177 LRSLDLGKVDLTATLASTRIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYGGTDGL 236

Query: 208 VSYEDIVSVLMRDITSEHH-SKKSMISAVSD--NTFIVDARTDLEELAKIIGTDCNCLKG 264
           +S ED++ +++ DI  EH  ++  +++ +      +I DAR  L E+++  G D     G
Sbjct: 237 ISIEDLIEMVVGDIEDEHDVAEGRLVNRMEGEAEAYIADARAGLAEVSEATGLDLAAAFG 296

Query: 265 E--QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
           E  +++D++GGL+ ++  R+P RGE +      E  +LDAD R V+R++++R
Sbjct: 297 EVAEEIDTIGGLVVTLAGRVPERGERIAGPEDIEFEVLDADPRRVKRIKLQR 348


>gi|83944998|ref|ZP_00957364.1| CBS domain protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851780|gb|EAP89635.1| CBS domain protein [Oceanicaulis alexandrii HTCC2633]
          Length = 309

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 144/238 (60%), Gaps = 4/238 (1%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F+ +R+DD+M+ R  I A+E +  + E   +F +   S +PV++ +LD+P G+ H+
Sbjct: 49  NMREFQDMRVDDVMVPRADIVAIEIETPLKELARVFGEATHSRLPVFRETLDDPVGLAHI 108

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLI---KNILFVPSSMLVSDLLTNIQESRIRMAL 196
           +DV+ Y+S    +      +       L    + +L+VP+SM   DLL  +Q  R+ MAL
Sbjct: 109 KDVLGYMSRFAEEGAGAGPDSWADMRILPAIRRPLLYVPASMRAFDLLLKMQSRRMHMAL 168

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKII 255
           V+DE GGTDGLV+ ED++  ++ DI  EH  ++   I A   + +  DAR  +E+L +I+
Sbjct: 169 VVDEFGGTDGLVTLEDLIEPIVGDIEDEHDEAETPNILAKGPHCWEADARAMIEDLEEIV 228

Query: 256 GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           G D    + E DVD+LGGL+F +  R+P RGEV+    GFE  +LD+D R ++R+R++
Sbjct: 229 GCDIASEEEENDVDTLGGLVFHLAGRVPERGEVLAHPSGFEFEVLDSDPRRIKRLRVK 286


>gi|329113343|ref|ZP_08242124.1| Hemolysin C [Acetobacter pomorum DM001]
 gi|326697168|gb|EGE48828.1| Hemolysin C [Acetobacter pomorum DM001]
          Length = 319

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 144/244 (59%), Gaps = 11/244 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+M+ R  I A+    ++ EA+ M  +   S MPVY++ LD+ 
Sbjct: 66  ERALIANVLRLRNISADDVMVPRADIVAMPVSISLDEALAMMRRENHSRMPVYRDQLDDI 125

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM+H++D+I+Y+      +   NL +      L++  L +   + V DLL  +++ +  
Sbjct: 126 VGMIHVKDLIAYV----GTSEAFNLEV------LLRQPLMIAPQIPVLDLLLQMRQRQTH 175

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELA 252
           MALVIDE+GG DGLV+ ED++  ++ DI+ EH      MI+   D +F +DAR  +EE  
Sbjct: 176 MALVIDEYGGIDGLVTIEDLIETIVGDISDEHDEPAIVMITPRPDGSFDIDARCPIEEFE 235

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           K IG      + E +++++GGL+F +   +P RGEV+    G+   +LDAD R +RRVR+
Sbjct: 236 KTIGPILTESEREAEIETIGGLVFRMAGHVPTRGEVLTHENGYLFRVLDADARHIRRVRV 295

Query: 313 RRLV 316
           R+L 
Sbjct: 296 RKLT 299


>gi|304320425|ref|YP_003854068.1| CBS domain protein [Parvularcula bermudensis HTCC2503]
 gi|303299327|gb|ADM08926.1| CBS domain protein [Parvularcula bermudensis HTCC2503]
          Length = 325

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 145/246 (58%), Gaps = 4/246 (1%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
            ++E+   I+ F + R+DD+ I R  I AV+ +  + + +  F     S +PVY+  LD+
Sbjct: 62  ADREMVERIVAFNQKRVDDVAIPRADIVAVDIETNLSDLLQTFSSANHSRLPVYRGDLDD 121

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
           P GM+H++D I  ++    K         + +S +++ +L+VP SM V++LL  +Q SR+
Sbjct: 122 PLGMIHIKDFIGLLASNGLKDIEGEEGRHVVQS-ILRKLLYVPPSMPVTELLLRMQASRV 180

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDLEEL 251
            MALVIDE GGTDGL++ ED++ +++ DI  EH    +  I  ++D  +  D+R  LEEL
Sbjct: 181 HMALVIDEFGGTDGLLTIEDLIELIVGDIRDEHDEGDTHAIHKIADYRWEADSRVPLEEL 240

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
             +IG        + D D++GGL+FS+  R+P RGEV+    G E  I+DAD R +RRVR
Sbjct: 241 EDVIG--AAFALDDHDADTMGGLVFSLAGRVPLRGEVITHPNGAEFEIIDADHRRIRRVR 298

Query: 312 IRRLVH 317
           I    H
Sbjct: 299 ITEAAH 304


>gi|258542171|ref|YP_003187604.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633249|dbj|BAH99224.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636308|dbj|BAI02277.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639361|dbj|BAI05323.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642417|dbj|BAI08372.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645472|dbj|BAI11420.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648525|dbj|BAI14466.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651578|dbj|BAI17512.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654569|dbj|BAI20496.1| hemolysin/magnesium/cobalt transporter CorC/HlyC [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 314

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 144/244 (59%), Gaps = 11/244 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+M+ R  I A+    ++ EA+ M  +   S MPVY++ LD+ 
Sbjct: 61  ERALIANVLRLRNISADDVMVPRADIVAMPVSISLDEALAMMRRENHSRMPVYRDQLDDI 120

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM+H++D+I+Y+      +   NL +      L++  L +   + V DLL  +++ +  
Sbjct: 121 VGMIHVKDLIAYV----GTSEAFNLEV------LLRQPLMIAPQIPVLDLLLQMRQRQTH 170

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDLEELA 252
           MALVIDE+GG DGLV+ ED++  ++ DI+ EH      MI+   D +F +DAR  +EE  
Sbjct: 171 MALVIDEYGGIDGLVTIEDLIETIVGDISDEHDEPAIIMITPRPDGSFDIDARCPIEEFE 230

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           K IG      + E +++++GGL+F +   +P RGEV+    G+   +LDAD R +RRVR+
Sbjct: 231 KAIGPILTDSEREAEIETVGGLVFRMAGHVPTRGEVLTHENGYLFRVLDADARHIRRVRV 290

Query: 313 RRLV 316
           R+L 
Sbjct: 291 RKLA 294


>gi|312113953|ref|YP_004011549.1| hypothetical protein Rvan_1180 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219082|gb|ADP70450.1| CBS domain containing protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 340

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 144/248 (58%), Gaps = 5/248 (2%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            S+ E+ +  N+L F + ++ +IM+ R  + A E++ TV + + +F + G + +PVY+ S
Sbjct: 53  MSQQERMMLLNVLGFGESKVSEIMLPRADVVAAEEQQTVGDLLALFAQEGHARIPVYRES 112

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLN-----IQLSESNLIKNILFVPSSMLVSDLL 184
           LD+  GMVH++D + ++    AK   ++L+       +++S L++ +LFVP+SM    LL
Sbjct: 113 LDDAIGMVHIKDAMVWVMKHGAKEGQVDLSQDVLKTTIADSKLVREVLFVPASMSALALL 172

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             ++     +A+V+DE GGTDGLV+ +D+V  ++ DI  EH        AV D TF+  A
Sbjct: 173 AKMKAKTTHLAIVVDEFGGTDGLVTLQDLVDSIVGDIADEHDDAHQFSIAVKDETFVASA 232

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           R  +E++ +++G          DVD+LGGLI +++   P RG+++    G    I++A  
Sbjct: 233 RAPIEDVEQVLGLSLATPGVTDDVDTLGGLILAMVGSFPKRGQLIHHHSGVTFEIMEAGP 292

Query: 305 RCVRRVRI 312
           R +  VRI
Sbjct: 293 RRLHTVRI 300


>gi|163747522|ref|ZP_02154872.1| hemolysin-like protein, putative [Oceanibulbus indolifex HEL-45]
 gi|161379200|gb|EDQ03619.1| hemolysin-like protein, putative [Oceanibulbus indolifex HEL-45]
          Length = 300

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 149/247 (60%), Gaps = 12/247 (4%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           +E E+   + ++  R++R+DD+ + +  I AV   AT+ E + +F++ G + +PVY  +L
Sbjct: 56  AEAERPTGHGMINLRRMRVDDVAVPKADITAVPVSATLDELVAVFKESGMTRLPVYDGTL 115

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D P GMVH++D+   ++H +   N  N    L    +++ +++VP SM +  LLT +Q  
Sbjct: 116 DTPVGMVHLKDLA--LNHGF---NGKNTKFDLR--AMLRPLVYVPPSMTIGVLLTKMQAE 168

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLE 249
           R  MALVIDE+GG DGLV+ ED++  ++ +I  EH   +     V    T++  A+T L 
Sbjct: 169 RRHMALVIDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEGTYWTVEKPGTYLALAKTPLG 228

Query: 250 ELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           +    IG   TD   +  E+++D+LGGL+F +  R+PARGEVVL   G E  ++DAD R 
Sbjct: 229 DFEAEIGHSLTDHETVD-EEEIDTLGGLVFMLSGRVPARGEVVLHPDGPEFEVIDADPRR 287

Query: 307 VRRVRIR 313
           ++R+R+R
Sbjct: 288 IKRLRVR 294


>gi|46204790|ref|ZP_00049475.2| COG1253: Hemolysins and related proteins containing CBS domains
           [Magnetospirillum magnetotacticum MS-1]
          Length = 316

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 153/283 (54%), Gaps = 45/283 (15%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +  N+L   K+R+DD+M+ R  I AV    ++ + + +F   G S +PVY  +LD+PRGM
Sbjct: 1   MLKNVLGLHKVRVDDVMLPRADIVAVSIDTSLGDLLKLFRTAGHSRLPVYGETLDDPRGM 60

Query: 137 VHMRDVISYIS------------------------------HMYAKTNNINLNIQLSESN 166
           VH+RD + Y++                                   + ++   + L + +
Sbjct: 61  VHIRDFVEYLATKAEAPIRRPPDQPAAAAAANAATKPSPRPRRATTSRSVLRGLDLGKVD 120

Query: 167 LIKN----------ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV 216
           L ++          +LFVP SM   DLL  +Q +R  MALVIDE+GGTDGL+S ED++ +
Sbjct: 121 LTRDAGPPPGIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYGGTDGLISIEDLIEM 180

Query: 217 LMRDITSEHH-SKKSMISAVSDNT--FIVDARTDLEELAKIIGTDCNCLKGE--QDVDSL 271
           ++ DI  EH  ++  ++  +   T  ++ DAR  L E+++  G D     GE  +++D++
Sbjct: 181 VVGDIEDEHDVAEGQLVHRLEGETEAYVADARAGLAEVSETTGVDLVAAAGELAEEIDTI 240

Query: 272 GGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
           GGLI ++  R+P+RGEV+      E  +L+AD R V+R++++R
Sbjct: 241 GGLIVTLAGRVPSRGEVIAGPGEIEFEVLEADPRRVKRLKLQR 283


>gi|295687478|ref|YP_003591171.1| CBS domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295429381|gb|ADG08553.1| CBS domain containing protein [Caulobacter segnis ATCC 21756]
          Length = 306

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 156/280 (55%), Gaps = 14/280 (5%)

Query: 27  SKTSVPAFWTRTIRA-LCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFR 85
            + + PA  +R +RA L +  K + +   +  R P   A         E ++ +    F+
Sbjct: 8   QQPAAPARRSRGVRAFLRRMRKRLTVGGGESPRPPEPPAQT------GEVDLVDQAEAFQ 61

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAML-MFEKYGRSWMPVYKNSLDNPRGMVHMRDVIS 144
            +R+ D+M  R  I AVE  +T +EA++  F + G S MP+Y+ +LD+P G+VH++DV  
Sbjct: 62  TLRVADVMTPRADIIAVE-LSTPFEALVAQFVEAGHSRMPIYRETLDDPVGVVHVKDVFK 120

Query: 145 YISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGT 204
            ++    +  + +L +    + L +  L+VP+SM  +DLL  ++ SRI MALVIDE GGT
Sbjct: 121 LLAEDVRRPTSADLVL----NKLRREALYVPASMKAADLLLRMRTSRIHMALVIDEFGGT 176

Query: 205 DGLVSYEDIVSVLMRDITSEHHSKKSMISAV-SDNTFIVDARTDLEELAKIIGTDCNCLK 263
           DG+V+ ED++  ++ +I  EH    ++         +  DAR  LEEL   +G +     
Sbjct: 177 DGVVTMEDLIEAVVGEIDDEHDDAAAVAIVARPGGVYDADARAPLEELEAALGRELAPAD 236

Query: 264 GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            E+D+D++ GL+ ++  R+P RGEV+    G+E  +++AD
Sbjct: 237 MEEDIDTVAGLVVALAGRVPQRGEVIAHPDGYEFEVVEAD 276


>gi|163734562|ref|ZP_02142001.1| hemolysin-like protein, putative [Roseobacter litoralis Och 149]
 gi|161392055|gb|EDQ16385.1| hemolysin-like protein, putative [Roseobacter litoralis Och 149]
          Length = 298

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 146/239 (61%), Gaps = 12/239 (5%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVH 138
           + ++  R++R++D+ I +  I A+   +T+ EA+ +F++ G + +PVY  +LD P G +H
Sbjct: 62  HGMMNLRRMRVEDVAIPKADITAIPATSTLDEAIAVFKESGSTRLPVYDGTLDTPIGFLH 121

Query: 139 MRDVISYISHMY-AKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           ++DV   ++H +   + + +L        +++ +L+VP SM +  LLT +Q  R  MALV
Sbjct: 122 LKDVA--LNHGFNGGSKSFDLRA------MLRPLLYVPPSMTIGVLLTKMQAERRHMALV 173

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   + +  +      ++  A+T LE+    IG
Sbjct: 174 IDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEDVYFTEEKPGCYLALAKTPLEDFEAEIG 233

Query: 257 TDCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           T     +   E+++D+LGGL+F +  R+PARGEVV+   G E  ++DAD R ++R+R+R
Sbjct: 234 TSLTAHEEVDEEEIDTLGGLVFMLSGRVPARGEVVVHPDGPEFEVIDADPRRIKRLRVR 292


>gi|330813321|ref|YP_004357560.1| magnesium and cobalt efflux protein CorC [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486416|gb|AEA80821.1| magnesium and cobalt efflux protein CorC [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 280

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 150/246 (60%), Gaps = 13/246 (5%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            S  EK I  NIL   K++  DIMI R  I +    +     + +      S +P+++  
Sbjct: 46  LSNKEKTILENILTINKLKAADIMIPRAEIVSASYDSDFNTLIKIINTESHSRIPIFRKD 105

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LD+  GMVH++D+I++ +    + +  + N+Q     +++++LFVP SM + ++L  +Q 
Sbjct: 106 LDDVMGMVHVKDLINFTN----QRSQADFNLQ----QIMRDVLFVPPSMPILNVLLKMQS 157

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDL 248
           +++ MALVIDEHGGTDGL++ ED+V  ++ +I  EH H   +    ++++TFI +A  +L
Sbjct: 158 TKLHMALVIDEHGGTDGLLTIEDLVEEIVGEIQDEHDHDDVTEFKKINESTFIANATMEL 217

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           +E  K+     N   G +++++LGG IFS+++R+P +GE++ +IP +   I+DAD R ++
Sbjct: 218 DEFEKM----ANIKFGIENIETLGGYIFSIVNRVPQKGEIIKDIPNYMFEIIDADPRKIK 273

Query: 309 RVRIRR 314
            ++I +
Sbjct: 274 VLKITK 279


>gi|83854731|ref|ZP_00948261.1| hemolysin, putative [Sulfitobacter sp. NAS-14.1]
 gi|83842574|gb|EAP81741.1| hemolysin, putative [Sulfitobacter sp. NAS-14.1]
          Length = 302

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 149/247 (60%), Gaps = 12/247 (4%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++T++     ++  R++R+DD+ + +  I AV   +T+ E + +F+  G + +PVY  +L
Sbjct: 59  AQTDRLSTRGMMNLRRMRVDDVAVPKADITAVPVTSTLDELVGVFKDSGLTRLPVYDGTL 118

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D P GM H++D+   ++H +    N   ++Q     +++ +LFVP SM +  LLT +Q  
Sbjct: 119 DTPVGMAHLKDLA--LTHGF-NGRNTEFDLQ----AMLRPLLFVPPSMTIGVLLTKMQAE 171

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLE 249
           R  MALVIDE+GG DGLV+ ED++  ++ +I  EH   +     V     ++  A+T L+
Sbjct: 172 RRHMALVIDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEGKYWTVEKPGCYLALAKTPLD 231

Query: 250 ELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           +    IG   TD + +  E+++D+LGGL+F +  R+PARGEVV+   G E  ++DAD R 
Sbjct: 232 DFEAEIGHSLTDHDDVD-EEEIDTLGGLVFMLSGRVPARGEVVVHPDGPEFEVIDADPRR 290

Query: 307 VRRVRIR 313
           ++R+R+R
Sbjct: 291 IKRLRVR 297


>gi|162147624|ref|YP_001602085.1| magnesium and cobalt efflux protein corC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542255|ref|YP_002274484.1| CBS domain-containing protein [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786201|emb|CAP55783.1| putative magnesium and cobalt efflux protein corC
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529932|gb|ACI49869.1| CBS domain containing protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 324

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 140/241 (58%), Gaps = 11/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+M+ R  I A+    ++ EA+ +  +   S MPVY+  LD+ 
Sbjct: 84  ERALIANVLRLRGITADDVMVPRADIVAMPVSLSLDEALALMRRENHSRMPVYREQLDDI 143

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM+H++D+I+Y+        +   N++    +L++  L V   + V DLL  +++ R+ 
Sbjct: 144 VGMIHVKDLIAYVG------TSEGFNVE----SLLRQPLMVAPQIPVLDLLLQMRQRRVH 193

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDLEELA 252
           +AL+IDE+GG DGLV+ ED+V  ++ DI+ EH    + +I    D TF VDAR  +E+  
Sbjct: 194 LALIIDEYGGIDGLVTIEDLVETIVGDISDEHDEPTAVLIQERPDGTFDVDARLPVEQFE 253

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
             +G      + E +++++GGL+F +   +P RGEV+    G    +LDAD   +R+VR+
Sbjct: 254 SRLGPLLTDAEREAEIETVGGLVFYLAGHVPTRGEVLTHDSGLVFRVLDADSLHIRKVRV 313

Query: 313 R 313
           R
Sbjct: 314 R 314


>gi|83941254|ref|ZP_00953716.1| hemolysin, putative [Sulfitobacter sp. EE-36]
 gi|83847074|gb|EAP84949.1| hemolysin, putative [Sulfitobacter sp. EE-36]
          Length = 302

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 154/266 (57%), Gaps = 21/266 (7%)

Query: 61  RIDASLEGIFSETEKEIF---------NNILRFRKIRIDDIMISRVSINAVEDKATVYEA 111
           R+  +L    +E E+EI            ++  R++R+DD+ + +  I AV   +T+ E 
Sbjct: 40  RVMGALSASDNEEEEEITAAQADRLSTRGMMNLRRMRVDDVAVPKADITAVPVTSTLDEL 99

Query: 112 MLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNI 171
           + +F+  G + +PVY  +LD P GM H++D+   ++H +    N   ++Q     +++ +
Sbjct: 100 VGVFKDSGLTRLPVYDGTLDTPVGMAHLKDLA--LTHGF-NGRNTEFDLQ----AMLRPL 152

Query: 172 LFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM 231
           LFVP SM +  LLT +Q  R  MALVIDE+GG DGLV+ ED++  ++ +I  EH   +  
Sbjct: 153 LFVPPSMTIGVLLTKMQAERRHMALVIDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEGK 212

Query: 232 ISAVS-DNTFIVDARTDLEELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              V     ++  A+T L++    IG   TD + +  E+++D+LGGL+F +  R+PARGE
Sbjct: 213 YWTVEKPGCYLALAKTPLDDFEAEIGHSLTDHDDVD-EEEIDTLGGLVFMLSGRVPARGE 271

Query: 288 VVLEIPGFEIVILDADVRCVRRVRIR 313
           VV+   G E  ++DAD R ++R+R+R
Sbjct: 272 VVVHPDGPEFEVIDADPRRIKRLRVR 297


>gi|85374529|ref|YP_458591.1| hemolysin [Erythrobacter litoralis HTCC2594]
 gi|84787612|gb|ABC63794.1| hemolysin [Erythrobacter litoralis HTCC2594]
          Length = 289

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/282 (30%), Positives = 162/282 (57%), Gaps = 15/282 (5%)

Query: 32  PAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDD 91
           P    R++RA  +     K+  H+      ++AS +G  S  E+++  N+L F +   DD
Sbjct: 10  PQAGDRSLRAQLEE----KIDEHEEDESSGLEASADGDLSPVERQMLRNLLHFSEHDADD 65

Query: 92  IMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYA 151
           + + R  I AV   AT  + + +F ++G S +PVY++ LD+  GM+H++DV  Y+++  A
Sbjct: 66  VAVPRGEIVAVSAAATWQDLLDVFSEHGHSRLPVYRDQLDDVIGMIHIKDVFPYLTNGKA 125

Query: 152 KTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYE 211
             ++  +        L++  L+VP S    D+L +++++R+ +A+V+DE  GTDG+++ E
Sbjct: 126 PPDDWTV--------LMRQPLYVPQSRNALDVLADMRQNRMHLAIVLDEFSGTDGIITIE 177

Query: 212 DIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDS 270
           D+V  ++ DI  EH     + I+ + +  +  DAR +L+++A+ I  D    + ++ VD+
Sbjct: 178 DLVEEIVGDIEDEHDDAPEIWIADIGEGMWDCDARAELDDVAEQI--DPRLAEVDEAVDT 235

Query: 271 LGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           LGGL F + +R+P  GEV+    G+ I + D D   V+R+R+
Sbjct: 236 LGGLTFVLAERVPPVGEVIEHPSGWRIEVTDGDETHVKRLRL 277


>gi|254486473|ref|ZP_05099678.1| CBS domain protein [Roseobacter sp. GAI101]
 gi|214043342|gb|EEB83980.1| CBS domain protein [Roseobacter sp. GAI101]
          Length = 301

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 149/246 (60%), Gaps = 12/246 (4%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           +T++     ++  R++R+DD+ + +  I AV    ++ E + +F++ G + +PVY+ +LD
Sbjct: 59  QTDRLSARGMMNLRRMRVDDVAVPKAEITAVPVTCSLDELVEVFKESGLTRLPVYEGTLD 118

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
            P GM H++D ++      A T++ +L      + +++ +LFVP SM +  LLT +Q  R
Sbjct: 119 TPVGMAHLKD-LALTYGFNANTDDFDL------TAMLRPLLFVPPSMTIGVLLTKMQAER 171

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLEE 250
             MALVIDE+GG DGLV+ ED++  ++ +I  EH   +     V     ++  A+T LE+
Sbjct: 172 RHMALVIDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEGKNWVVEKPGCYLALAKTPLED 231

Query: 251 LAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
               IG   TD + +  E+++D+LGGL+F +  R+PARGEVV+   G E  ++DAD R +
Sbjct: 232 FEAEIGYSLTDHDDVD-EEEIDTLGGLVFMLSGRVPARGEVVVHPDGPEFEVIDADPRRI 290

Query: 308 RRVRIR 313
           +R+R+R
Sbjct: 291 KRLRVR 296


>gi|262277762|ref|ZP_06055555.1| CBS domain containing protein [alpha proteobacterium HIMB114]
 gi|262224865|gb|EEY75324.1| CBS domain containing protein [alpha proteobacterium HIMB114]
          Length = 281

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 143/248 (57%), Gaps = 14/248 (5%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            S  EK I +NIL   K++ DD+MI R SI A+   ++    +   +K   S MPV++  
Sbjct: 47  LSSKEKSILSNILSINKLKADDVMIPRASIVAISQNSSFKNVIDTIDKESHSRMPVFRKD 106

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LD+  GM+H++D+I +    Y   N+ N+        +++ +LFVP +M V +LL  +Q 
Sbjct: 107 LDDVLGMIHIKDIIKFAGSNY---NDFNI------KKIMREVLFVPPTMPVMNLLLKMQA 157

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDL 248
           +++ MALVIDEHGGTDGL++ ED++  ++ +I  EH          +  NTF   A   L
Sbjct: 158 TKLHMALVIDEHGGTDGLITIEDVIEEIVGEIEDEHDKDDDFNFKKIDSNTFEAKADMTL 217

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           ++       + N    E++VD+LGG IFS ++R+P  GEV+     ++  I++AD R ++
Sbjct: 218 DDF----NHESNLSIVEENVDTLGGYIFSKINRVPYAGEVIKVDNTYQFEIIEADPRKIK 273

Query: 309 RVRIRRLV 316
           ++RI +++
Sbjct: 274 KIRIFKVL 281


>gi|296116298|ref|ZP_06834914.1| CBS domain containing protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977117|gb|EFG83879.1| CBS domain containing protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 311

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 136/241 (56%), Gaps = 11/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+MI R  I A+    ++ EA+ M  +   S MPVY++ LD+ 
Sbjct: 66  ERALLANVLRLRGITADDVMIPRADIVAMPASISLDEALAMMRRENHSRMPVYRDQLDDI 125

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM+H++D+I+Y+    A           S   L++  L V   + V DLL  ++   + 
Sbjct: 126 VGMIHVKDLIAYLGTSEA----------FSIEPLLRQPLMVAPQLPVLDLLLQMRLRHVH 175

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELA 252
           +ALVIDE+GG DGLV+ ED++  ++ DI+ EH     +M+   +D TF VDAR  + +  
Sbjct: 176 LALVIDEYGGIDGLVTIEDLIETIVGDISDEHDEPTVAMLQERNDGTFDVDARLPIAQFE 235

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
              G      + E +++++GGL+F +   +P RGEVV    G    ILDAD R +R++R+
Sbjct: 236 LRTGPILTQDEREAEIETVGGLVFRLAGHVPTRGEVVTHESGTVFRILDADARHIRKLRV 295

Query: 313 R 313
           R
Sbjct: 296 R 296


>gi|307293145|ref|ZP_07572991.1| CBS domain containing protein [Sphingobium chlorophenolicum L-1]
 gi|306881211|gb|EFN12427.1| CBS domain containing protein [Sphingobium chlorophenolicum L-1]
          Length = 315

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 147/251 (58%), Gaps = 12/251 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  S  E+++  N+L F +  +DD+ + R  I A+E+KA+  +   +F + G S +PVY+
Sbjct: 67  GDLSAIERQMVRNLLHFSEHTVDDVAVPRADIVAIEEKASFADLAALFAEAGHSRIPVYR 126

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++LD   GM+H+RD  + ++      +++          LI+  L+VP SM   DLL  +
Sbjct: 127 DTLDTIVGMIHIRDAFAILAGKAPVPDSLE--------PLIRQPLYVPESMGALDLLAEM 178

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  R  +A+V+DE+ GT+GL+++ED+V  ++ ++  EH    ++M+  +    +  DAR 
Sbjct: 179 RAKRTHLAIVLDEYSGTEGLLTFEDLVEEIVGEVEDEHDEEPEAMLVPLEGGLWEADARA 238

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL-EIPGFEIVILDADVR 305
           +LE++AK I  D      E+DVD+LGGL F +  R+P  GE+V  E  G+++ IL +D R
Sbjct: 239 ELEDVAKEI--DGKLADVEEDVDTLGGLAFVIAGRVPEPGEIVEHEESGWKLEILASDGR 296

Query: 306 CVRRVRIRRLV 316
            V R+R+   V
Sbjct: 297 RVSRLRLHPPV 307


>gi|144899564|emb|CAM76428.1| hemolysin [Magnetospirillum gryphiswaldense MSR-1]
          Length = 342

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 148/246 (60%), Gaps = 16/246 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  NIL  R +   D+M+ R  I  VED  T+ + + +F + G S +PV++ +LD+ 
Sbjct: 103 ERILLGNILHLRDVTAYDVMVPRADIQGVEDGTTLDDLIDLFIRCGHSRLPVHRGTLDDI 162

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GMVH++DV++      A  ++ + ++     ++++ +LFV  +M V D+L  ++  R  
Sbjct: 163 IGMVHIKDVLA------ATRSDQSFHL----PHIMRRVLFVSPAMRVPDMLLEMRLKRTH 212

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELA 252
           MALV+DE+GG DGLV+ ED+V  ++ +I  EH      ++S  +D T   DAR  +EE  
Sbjct: 213 MALVVDEYGGIDGLVTTEDLVEQIVGEIEDEHDEHDDPVMSIAADGTIEADARASIEEFE 272

Query: 253 KIIGTDCNCLKGEQ--DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
             +G     L  E+  +VD+LGGL+F +  RIP+RGE+++   G E  ++DAD R ++ +
Sbjct: 273 AALGA---VLTDEERDEVDTLGGLVFFIAGRIPSRGELIVHSSGLEFEVVDADPRRIKWL 329

Query: 311 RIRRLV 316
           R+RRL+
Sbjct: 330 RVRRLL 335


>gi|167643997|ref|YP_001681660.1| CBS domain-containing protein [Caulobacter sp. K31]
 gi|167346427|gb|ABZ69162.1| CBS domain containing protein [Caulobacter sp. K31]
          Length = 304

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 152/293 (51%), Gaps = 28/293 (9%)

Query: 24  PSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGI--FSET-------- 73
           PS  ++S PA   R  R +   ++ M           R D +  G+   +ET        
Sbjct: 2   PSDDQSSAPAGPARLSRGVRAFFRKM-----------RKDLAGRGVPGLAETSRPADPTL 50

Query: 74  --EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
             E ++ +    F+ +R+ D+M  R  I AVE  +     +  F +   S MP+Y+ +LD
Sbjct: 51  VHEVDMVDQAEAFQSLRVADVMTPRADIVAVEASSPFEAVVAQFTEAEHSRMPIYRETLD 110

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +P G++H++DV   ++    +    +  +      L +  L+VP+SM  +DLL  ++ SR
Sbjct: 111 DPVGVIHVKDVFRLLADEEKRPTPSDQVLH----RLRREALYVPASMRAADLLLRMRTSR 166

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEE 250
           I MALVIDE GGTDGLV+ ED++  ++ +I  EH   + S I A     F  DAR  LE+
Sbjct: 167 IHMALVIDEFGGTDGLVTMEDLIEAVVGEIDDEHDDAQVSSIVARPGGVFEADARAPLED 226

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           L   +  D      E+D+D++ GL+ ++  R+P RGEV+    GF++ +++AD
Sbjct: 227 LEAALDRDLAPPDMEEDIDTVAGLVVALAGRVPQRGEVIAHPAGFDLEVVEAD 279


>gi|296532213|ref|ZP_06894963.1| CBS domain protein [Roseomonas cervicalis ATCC 49957]
 gi|296267457|gb|EFH13332.1| CBS domain protein [Roseomonas cervicalis ATCC 49957]
          Length = 306

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 145/266 (54%), Gaps = 19/266 (7%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           + AL +  +  +     G   P +DA         E+ +  N+L+ R    +D+M+ R  
Sbjct: 37  VEALVEGREHHEHHEPSGPPRPELDAQ--------ERAMLRNVLKLRGKTANDVMVPRAD 88

Query: 99  INAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL 158
           I A+ +  T+ +A+ + ++ G S  PVY+  LD   GMVH++DV +          ++  
Sbjct: 89  IVAMPEDLTLEQAIRLIQREGHSRFPVYRGQLDEIVGMVHIKDVFA----------SVGR 138

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM 218
               S + +++  LFV  S+ V DLL  ++++R+ +ALV+DE+GG DGLV+ ED+V  + 
Sbjct: 139 EAPFSMAAVLRKPLFVVPSVPVLDLLLQMRQARMHLALVVDEYGGIDGLVTIEDLVETIT 198

Query: 219 RDITSEHHSKKS-MISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
            DI+ EH    +  I    D    +DART +E   + +G      + EQD+D++GGL+F+
Sbjct: 199 GDISDEHDEDAAPQIVERPDGLIDIDARTPIETFEQQVGAVLTEDEREQDIDTVGGLVFT 258

Query: 278 VLDRIPARGEVVLEIPGFEIVILDAD 303
           +  R+PARGE+V    G E  +L+AD
Sbjct: 259 LAGRVPARGELVSHGSGLEFRVLEAD 284


>gi|294012046|ref|YP_003545506.1| magnesium and cobalt transporter [Sphingobium japonicum UT26S]
 gi|292675376|dbj|BAI96894.1| magnesium and cobalt transporter [Sphingobium japonicum UT26S]
          Length = 315

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 145/247 (58%), Gaps = 12/247 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  S  E+++  N+L F +  +DD+ + R  I A+E+ A+  +   +F + G S +PVY+
Sbjct: 67  GDLSAIERQMVRNLLHFSEHTVDDVAVPRADIIAIEENASFADLAALFAEAGHSRIPVYR 126

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            +LD   GM+H+RD  + ++      + +          LI+  L+VP SM   DLL  +
Sbjct: 127 ENLDTIVGMIHIRDAFAILAGKAPVPDRLE--------PLIRQPLYVPESMGALDLLAEM 178

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDART 246
           +  R  +A+V+DE+ GT+GL+++ED+V  ++ ++  EH  + ++M+  +    +  DAR 
Sbjct: 179 RAKRTHLAIVLDEYSGTEGLLTFEDLVEEIVGEVEDEHDEEPEAMLVPLDGGLWEADARA 238

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP-GFEIVILDADVR 305
           +LE++AK I  D    + E+DVD+LGGL F +  R+P  GE+V     G+++ ILD+D R
Sbjct: 239 ELEDVAKEI--DEKLAEVEEDVDTLGGLAFVIAGRVPEPGEIVEHAQSGWKLEILDSDGR 296

Query: 306 CVRRVRI 312
            V R+R+
Sbjct: 297 RVSRLRL 303


>gi|84502867|ref|ZP_01000980.1| hemolysin, putative [Oceanicola batsensis HTCC2597]
 gi|84388850|gb|EAQ01720.1| hemolysin, putative [Oceanicola batsensis HTCC2597]
          Length = 252

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 135/236 (57%), Gaps = 10/236 (4%)

Query: 81  ILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMR 140
           ++  R++R++D+ I +  I AV   AT  + +  F   G + +PV++++LD P GM+H++
Sbjct: 1   MINLRRMRVEDVAIPKAEIVAVPLNATRDQLVKTFSDSGMTRLPVFQDTLDTPVGMIHLK 60

Query: 141 DVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDE 200
           D  +       K+    L        +++ +LFVP SM +  LL  +Q  R  MALVIDE
Sbjct: 61  D-FALRYGFNGKSGRFTLK------TMLRPLLFVPPSMPIGVLLQKMQTERRHMALVIDE 113

Query: 201 HGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDN-TFIVDARTDLEELAKIIGTDC 259
           +GG DGLV+ ED++  ++  I  EH  ++       D  T++  ART L+E A   G D 
Sbjct: 114 YGGVDGLVTIEDLIEQVIGQIEDEHDVEEDKFWTREDGATYLAVARTPLDEFAAETGIDL 173

Query: 260 NCLKG--EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                  E+++D+LGGL+F +  R+PARGEVV    G E  ++DAD R ++R+R+R
Sbjct: 174 TSHDSVDEEEIDTLGGLVFMLSGRVPARGEVVEHPAGHEFEVVDADPRRIKRLRVR 229


>gi|114326779|ref|YP_743936.1| magnesium and cobalt efflux protein corC [Granulibacter
           bethesdensis CGDNIH1]
 gi|114314953|gb|ABI61013.1| magnesium and cobalt efflux protein corC [Granulibacter
           bethesdensis CGDNIH1]
          Length = 308

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 131/243 (53%), Gaps = 13/243 (5%)

Query: 64  ASLEGIFSE---TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           A L G   E    E+ +  N+LR R    DD+M+ R  I A+       + + +  + G 
Sbjct: 54  AQLPGELPELDRQERALIGNVLRLRGTTADDVMVPRADIVAIRADTAFEDVLALIRQEGH 113

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S +PVY   LD+  GM+H++DV  Y+              +   +++++  L V   M V
Sbjct: 114 SRLPVYNEELDDAIGMIHIKDVFGYVGD----------PAEFRLTDILRKPLLVGPHMPV 163

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
            +LL  +++  + +ALVIDE+GG DGLV+ ED+V  ++ DI+ EH      I+   D T 
Sbjct: 164 LELLLQMRQHHMHLALVIDEYGGVDGLVTIEDLVETIVGDISDEHDEAAPSITERPDGTL 223

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
            +DAR  +E+  K +G      + E D+D++GGL+F++  R+PARGEV+    G E  +L
Sbjct: 224 DLDARIPIEDFEKRLGAVLTEDEREADIDTVGGLVFTLAGRVPARGEVIGHSSGMEFRVL 283

Query: 301 DAD 303
           +AD
Sbjct: 284 EAD 286


>gi|56708800|ref|YP_164841.1| hemolysin, putative [Ruegeria pomeroyi DSS-3]
 gi|56680485|gb|AAV97150.1| hemolysin, putative [Ruegeria pomeroyi DSS-3]
          Length = 295

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/237 (35%), Positives = 136/237 (57%), Gaps = 12/237 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            IL  R++R++D+ I    I +V    +  E + +F   G + +PVY+N+LD P G VH+
Sbjct: 60  GILNLRRMRVEDVAIPTAEIVSVPLTVSKEELVHVFRDSGMTRIPVYENTLDTPLGFVHL 119

Query: 140 RDVISYISHMYAKTNNINLN-IQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVI 198
           +D        +A T+  N N  Q    ++++ +LFVP SM +  LL  +Q  R  MALVI
Sbjct: 120 KD--------FALTHGFNGNSTQFDLRSMLRPLLFVPPSMPIGVLLAKMQTERRHMALVI 171

Query: 199 DEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLEELAKIIGT 257
           DE+GG DGL++ ED++  ++ +I  EH + ++          +I  ART L+E    IG 
Sbjct: 172 DEYGGVDGLLTIEDLIEQVVGEIEDEHDTDEAQTWVKERPGCYIAQARTPLDEFETEIGR 231

Query: 258 DCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                +   E+++D+LGGL+F +  R+PARGEVV    G E  ++DAD R ++R+R+
Sbjct: 232 SLTNHEDVDEEEIDTLGGLVFMLSGRVPARGEVVPHPDGVEFEVIDADPRRIKRLRV 288


>gi|16124309|ref|NP_418873.1| CBS domain-containing protein [Caulobacter crescentus CB15]
 gi|221232990|ref|YP_002515426.1| magnesium and cobalt efflux protein CorC [Caulobacter crescentus
           NA1000]
 gi|13421147|gb|AAK22041.1| CBS domain protein [Caulobacter crescentus CB15]
 gi|220962162|gb|ACL93518.1| magnesium and cobalt efflux protein CorC [Caulobacter crescentus
           NA1000]
          Length = 308

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 136/230 (59%), Gaps = 7/230 (3%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAML-MFEKYGRSWMPVYKNSLDNPR 134
           ++ +    F+ +R+ D+M  R  I AVE  +T +EA+   F +   S MP+Y+ +LD+P 
Sbjct: 53  DLVDQAEAFQSLRVADVMTPRADIVAVE-LSTPFEAVAAQFAEAEHSRMPIYRETLDDPV 111

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G++H++DV   ++    +    +L +    + L ++ L+VP+SM  +DLL  ++ SRI M
Sbjct: 112 GVIHVKDVFRLLADEAKRPAPSDLIL----NKLRRDALYVPASMKAADLLLRMRTSRIHM 167

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAK 253
           ALVIDE GGTDGLVS ED++  ++ +I  EH    ++ + A     F  DAR  LEEL  
Sbjct: 168 ALVIDEFGGTDGLVSMEDLIEAVVGEIDDEHDDATAVAVVARPGGIFDADARAPLEELEA 227

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            +  D      ++D+D++ GL+ ++  R+P RGEV+    GFE  +++AD
Sbjct: 228 ALSHDLAPPDMDEDIDTVAGLVVALAGRVPQRGEVIAHPDGFEFEVVEAD 277


>gi|254509732|ref|ZP_05121799.1| CBS domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221533443|gb|EEE36431.1| CBS domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 294

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/237 (35%), Positives = 135/237 (56%), Gaps = 12/237 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+ I    I +V       E   +F   G S +PVY+N+LD P G VH+
Sbjct: 59  GMINLRRMRVEDVAIPTAEIISVPLITPKDELAQVFRDSGLSRVPVYENTLDTPLGFVHL 118

Query: 140 RDVISYISHMYAKTNNINLN-IQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVI 198
           +D        +A T+  N N  +    ++++ +LFVP SM +  LLT +Q  R  MALVI
Sbjct: 119 KD--------FALTHGFNGNSAEFDLKSMLRTLLFVPPSMPIGVLLTKMQTERRHMALVI 170

Query: 199 DEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIGT 257
           DE+GG DGLV+ ED++  ++ +I  EH + +  +        ++V AR  LE+    IG 
Sbjct: 171 DEYGGVDGLVTIEDLIEQVVGEIADEHDADEDQLWIQEKPGCYVVQARVPLEDFEAEIGR 230

Query: 258 DCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                +   E+++D+LGGL+F +  R+PARGEVV    G E  +LDAD R ++R+R+
Sbjct: 231 SLTSHEDVDEEEIDTLGGLVFMLSGRVPARGEVVCHPEGAEFEVLDADPRRIKRLRV 287


>gi|114770163|ref|ZP_01447701.1| hemolysin, putative [alpha proteobacterium HTCC2255]
 gi|114549000|gb|EAU51883.1| hemolysin, putative [alpha proteobacterium HTCC2255]
          Length = 285

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 145/259 (55%), Gaps = 19/259 (7%)

Query: 72  ETEKEIFNN---------ILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           ET K++ N          I + + +R++D+ I R  I +V  +      +  F + G S 
Sbjct: 35  ETSKDLINQNETSLPDEGISKLKTLRVEDVAIPRADIVSVSSELNSDVLIKEFRESGYSR 94

Query: 123 MPVYKNSLDNPRGMVHMRDV-ISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
           +PV++++LDNP GMVH++D+ + YI    ++  N           L++ +LFVP SM + 
Sbjct: 95  LPVFEDTLDNPIGMVHLKDLALKYIFDDKSEAFNF--------VELVRPVLFVPPSMPLD 146

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTF 240
            LL  +Q  R  MALV+DE+GG DGL + ED+V  L+ +I+ EH +        V    +
Sbjct: 147 VLLQKMQTERTHMALVVDEYGGVDGLATIEDLVEQLVGNISDEHDTDDDATWFKVKTGVY 206

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           I  +R  LEE  K++G D      +++++++GGL+F +  R+P RGEV+    G++  ++
Sbjct: 207 ICQSRAPLEEFEKVLGVDLASDTDDEEIETMGGLVFMMTGRVPVRGEVISHPSGYDFEVI 266

Query: 301 DADVRCVRRVRIRRLVHFK 319
           +AD R ++R+R+ + +  K
Sbjct: 267 EADPRRIKRLRVYQKLQKK 285


>gi|255261212|ref|ZP_05340554.1| CBS domain protein [Thalassiobium sp. R2A62]
 gi|255103547|gb|EET46221.1| CBS domain protein [Thalassiobium sp. R2A62]
          Length = 298

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 156/290 (53%), Gaps = 30/290 (10%)

Query: 33  AFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASL-EGIFSETEKEIFNNILRFRKIRIDD 91
            F+TR I AL         S    I  P++ A +  G+           +L  R++R++D
Sbjct: 27  GFFTRIIGALSP-------SDTPEIAEPQVTAPVAPGL----------GMLNLRRMRVED 69

Query: 92  IMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYA 151
           + I +  I AVE    + E + +F + G + +PV+  +LD P G  H++D  +       
Sbjct: 70  VAIPKADIVAVEVGMELDELVGVFRESGLTRLPVFDGTLDTPVGFAHLKD-FALTYGFNG 128

Query: 152 KTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYE 211
           K+   +L       ++++ +L+VP SM +  LLT +Q  RI MALVIDE+GGTDGLV+ E
Sbjct: 129 KSAAFHLR------DVVRPLLYVPPSMQIGVLLTKMQADRIHMALVIDEYGGTDGLVTIE 182

Query: 212 DIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIG---TDCNCLKGEQD 267
           D++  ++ +I  EH  ++    +  S   ++  A+T LE+    IG   T+   +  E+ 
Sbjct: 183 DLIEQVIGEIEDEHDIAEGEFWTVESPGVYLAKAKTPLEDFQAEIGITLTEAEDVDAEE- 241

Query: 268 VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVH 317
           +D+LGGL+F +   +PARGEV+    G E  +++AD R ++R+R+R   H
Sbjct: 242 IDTLGGLVFMLSGHVPARGEVIPHPDGPEFEVIEADPRSIKRLRVRLAGH 291


>gi|94498014|ref|ZP_01304578.1| CBS [Sphingomonas sp. SKA58]
 gi|94422597|gb|EAT07634.1| CBS [Sphingomonas sp. SKA58]
          Length = 311

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 150/257 (58%), Gaps = 14/257 (5%)

Query: 66  LEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPV 125
           ++G  S  E+++  N+L F +  +DD+ + R  I A+E+ A+  +   +F + G S +PV
Sbjct: 62  VKGDLSAIERQMLRNLLHFSEHTVDDVAVPRADIVAIEETASFADLAALFAEAGHSRIPV 121

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y+ +LD   GM+H+RD  + ++      + +        + LI+  L+VP SM   DLL 
Sbjct: 122 YRENLDTIVGMIHIRDAFAILAGKAPAPDTL--------APLIRQPLYVPESMGALDLLA 173

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDA 244
            ++  R  +A+V+DE+ GT+GL+++ED+V  ++ D+  EH  + ++M+  + D  +  DA
Sbjct: 174 EMRAKRTHLAIVLDEYSGTEGLLTFEDLVEEIVGDVEDEHDDAPEAMLVPLDDGLWDADA 233

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP--GFEIVILDA 302
           R +L+++A+ I  D      E+DVD+LGGL F +  R+P  GE +L+ P  G+++ I  +
Sbjct: 234 RAELDDVAEEI--DARLGDVEEDVDTLGGLAFVLAGRVPEMGE-ILDHPESGWKLEITAS 290

Query: 303 DVRCVRRVRIRRLVHFK 319
           D R V R+R+   V  +
Sbjct: 291 DSRRVTRLRLHPPVALE 307


>gi|146279877|ref|YP_001170035.1| hypothetical protein Rsph17025_3875 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145558118|gb|ABP72730.1| hypothetical protein Rsph17025_3875 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 314

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 136/239 (56%), Gaps = 9/239 (3%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            I   R++R+DD+ I +V I AV       + + +F ++G S +PVY+ +LD P G+V +
Sbjct: 66  GIANLRRLRVDDVAIPKVEIVAVPVDLGKEDLVAVFREHGFSRLPVYRETLDQPLGLVLL 125

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+   + H +      N        ++++ +L+ P SM +  LL  +Q  R+ MALVID
Sbjct: 126 KDLA--LQHGFNGGGEFNFR------SMLRPLLYAPPSMPIGVLLQKMQRERVHMALVID 177

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GG DGLV+ ED++  ++ +I  EH  ++  + +      ++  +R  L+E    IG  
Sbjct: 178 EYGGVDGLVTIEDLIETVIGEIEDEHDEAEGPLWTLEKPGVYMAQSRAPLDEFEAEIGLR 237

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVH 317
               + ++++D+LGGL+F    R+P RGE+V +  G E  ++DAD R ++R+R+R   H
Sbjct: 238 LRRDEEDEEIDTLGGLVFLRTGRVPVRGEIVPDESGAEFEVIDADARKIKRLRVRLPGH 296


>gi|259415568|ref|ZP_05739489.1| CBS domain protein [Silicibacter sp. TrichCH4B]
 gi|259348798|gb|EEW60560.1| CBS domain protein [Silicibacter sp. TrichCH4B]
          Length = 300

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 154/275 (56%), Gaps = 25/275 (9%)

Query: 56  GIRLPRIDASLEGIFSET-EKEIFNN------------ILRFRKIRIDDIMISRVSINAV 102
           G+  P   + + G FS+T E ++ +N            ++  R++R++D+ I    I+AV
Sbjct: 27  GVETPGFLSKIFGSFSQTAEDDVPDNGNEEVLADPPPGMMNLRRLRVEDVAIPTAEIDAV 86

Query: 103 EDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQL 162
               +  E + +F   G + +PVY+ +LD P G VH++D ++       ++++ +L    
Sbjct: 87  PVTISRDELVQVFRDTGFTRIPVYEGTLDTPLGFVHLKD-LALTYGFECESDDFDL---- 141

Query: 163 SESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT 222
             +++++ +LFVP SM +  LLT +Q  R  MALVIDE+GG DGL++ ED++  ++ +I 
Sbjct: 142 --AHMLRPLLFVPPSMPIGVLLTKMQAERRHMALVIDEYGGVDGLLTIEDLIEQVVGEIE 199

Query: 223 SEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIG---TDCNCLKGEQDVDSLGGLIFSV 278
            EH S +           ++  ART L E    IG   T    + GE+ +D+LGGL+F +
Sbjct: 200 DEHDSGEDQTWVQEKPGCYVAQARTPLGEFEGEIGISLTQHEDVDGEE-IDTLGGLVFML 258

Query: 279 LDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
             R+PARGEV+    G E  ++DAD R ++R+R+R
Sbjct: 259 SGRVPARGEVIQHPEGPEFEVVDADPRRIKRLRVR 293


>gi|89053195|ref|YP_508646.1| CBS [Jannaschia sp. CCS1]
 gi|88862744|gb|ABD53621.1| CBS [Jannaschia sp. CCS1]
          Length = 312

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 140/237 (59%), Gaps = 8/237 (3%)

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
              I   R++R++D+ I R  I +V     + + + +F   G + +PVY  +LD P G+V
Sbjct: 76  LPGISNLRRMRVEDVAIPRAEITSVAADTDLPDLVQVFRDSGLTRLPVYDGALDEPIGLV 135

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           H++D+   + H +   N    +  LSES  ++ +L+VP SM +  LLT +Q  R  MALV
Sbjct: 136 HLKDI--ALRHGF---NGDGEDFILSES--LRPVLYVPPSMPIGVLLTKMQADRTHMALV 188

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDN-TFIVDARTDLEELAKIIG 256
           IDE+GG DGL++ ED++  ++ +I  EH  +++      D+  F+  AR  L+E    IG
Sbjct: 189 IDEYGGVDGLLTIEDLIEQVIGEIEDEHDVEEAQPWVREDDGAFLALARAPLDEFESEIG 248

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            +    + E++VD+LGGL+F +  R+PARGEVV    G E  ++DAD R ++R+R+R
Sbjct: 249 MELVDDEEEEEVDTLGGLVFLLTGRVPARGEVVPHPTGLEFEVIDADPRRIKRLRVR 305


>gi|110681054|ref|YP_684061.1| hemolysin-like protein, putative [Roseobacter denitrificans OCh
           114]
 gi|109457170|gb|ABG33375.1| hemolysin-like protein, putative [Roseobacter denitrificans OCh
           114]
          Length = 298

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 148/244 (60%), Gaps = 12/244 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E +  + ++  R++R++D+ I +  I A+   +T+ EA+ +F++ G + +PVY  +LD P
Sbjct: 57  ESQQTHGMMNLRRMRVEDVAIPKADITAIPATSTLDEAVAVFKESGSTRLPVYDGTLDTP 116

Query: 134 RGMVHMRDV-ISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G +H++DV ++Y  +  +K  ++          +++ +L+VP SM +  LLT +Q  R 
Sbjct: 117 IGFLHLKDVALNYGFNGGSKGFDLR--------AMLRPLLYVPPSMTIGVLLTKMQAERR 168

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEEL 251
            MALVIDE+GG DGLV+ ED++  ++ +I  EH   + +  +      ++  A+T LE+ 
Sbjct: 169 HMALVIDEYGGVDGLVTIEDLIEQVIGEIEDEHDVDEGVYFTEEKPGCYLALAKTPLEDF 228

Query: 252 AKIIGTD--CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
              IGT    +    E+++++LGGL+F +  R+PARGEVV+   G E  ++DAD R ++R
Sbjct: 229 EAEIGTSLTAHEEVDEEEIETLGGLVFMLSGRVPARGEVVVHPDGPEFEVIDADPRRIKR 288

Query: 310 VRIR 313
           +R+R
Sbjct: 289 LRVR 292


>gi|332561270|ref|ZP_08415588.1| CBS domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332275068|gb|EGJ20384.1| CBS domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 307

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 135/237 (56%), Gaps = 9/237 (3%)

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
              I   R++R+DD+ I +V I AV       + + +F ++G S +PVY+ +LD P G+V
Sbjct: 56  LPGIANLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPLGLV 115

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
            ++D+   + H +    + +L        L++ +L+ P SM +  LL  +Q  R+ MALV
Sbjct: 116 LLKDLA--LQHGFNGNGSFDLK------TLLRPLLYAPPSMPIGVLLQKMQRERVHMALV 167

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   +  + +      ++  +RT L+E    IG
Sbjct: 168 IDEYGGVDGLVTIEDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIG 227

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                 + ++++D+LGGL+F    R+P RGE+V    G E  ++DAD R ++R+R+R
Sbjct: 228 LRLRREEEDEEIDTLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVR 284


>gi|221369605|ref|YP_002520701.1| CBS domain containing protein [Rhodobacter sphaeroides KD131]
 gi|221162657|gb|ACM03628.1| CBS domain containing protein [Rhodobacter sphaeroides KD131]
          Length = 307

 Score =  148 bits (374), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 135/237 (56%), Gaps = 9/237 (3%)

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
              I   R++R+DD+ I +V I AV       + + +F ++G S +PVY+ +LD P G+V
Sbjct: 56  LPGIANLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPLGLV 115

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
            ++D+   + H +    + +L        L++ +L+ P SM +  LL  +Q  R+ MALV
Sbjct: 116 LLKDLA--LQHGFNGNGSFDLK------TLLRPLLYAPPSMPIGVLLQKMQRERVHMALV 167

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   +  + +      ++  +RT L+E    IG
Sbjct: 168 IDEYGGVDGLVTIEDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIG 227

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                 + ++++D+LGGL+F    R+P RGE+V    G E  ++DAD R ++R+R+R
Sbjct: 228 LRLRREEEDEEIDTLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVR 284


>gi|126464037|ref|YP_001045150.1| CBS domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126105848|gb|ABN78378.1| CBS domain containing protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 315

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 135/237 (56%), Gaps = 9/237 (3%)

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
              I   R++R+DD+ I +V I AV       + + +F ++G S +PVY+ +LD P G+V
Sbjct: 64  LPGIANLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPLGLV 123

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
            ++D+   + H +    + +L        L++ +L+ P SM +  LL  +Q  R+ MALV
Sbjct: 124 LLKDLA--LQHGFNGNGSFDLK------TLLRPLLYAPPSMPIGVLLQKMQRERVHMALV 175

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   +  + +      ++  +RT L+E    IG
Sbjct: 176 IDEYGGVDGLVTIEDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIG 235

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                 + ++++D+LGGL+F    R+P RGE+V    G E  ++DAD R ++R+R+R
Sbjct: 236 LRLRREEEDEEIDTLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVR 292


>gi|77465598|ref|YP_355101.1| CorC/Hlyc family protein [Rhodobacter sphaeroides 2.4.1]
 gi|77390016|gb|ABA81200.1| CorC/Hlyc family protein with CBS domains [Rhodobacter sphaeroides
           2.4.1]
          Length = 315

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 135/237 (56%), Gaps = 9/237 (3%)

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
              I   R++R+DD+ I +V I AV       + + +F ++G S +PVY+ +LD P G+V
Sbjct: 64  LPGIANLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPLGLV 123

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
            ++D+   + H +    + +L        L++ +L+ P SM +  LL  +Q  R+ MALV
Sbjct: 124 LLKDLA--LQHGFNGNGSFDLK------TLLRPLLYAPPSMPIGVLLQKMQRERVHMALV 175

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   +  + +      ++  +RT L+E    IG
Sbjct: 176 IDEYGGVDGLVTIEDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIG 235

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                 + ++++D+LGGL+F    R+P RGE+V    G E  ++DAD R ++R+R+R
Sbjct: 236 LRLRREEEDEEIDTLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVR 292


>gi|84687996|ref|ZP_01015859.1| hemolysin, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84663977|gb|EAQ10478.1| hemolysin, putative [Rhodobacterales bacterium HTCC2654]
          Length = 296

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 158/283 (55%), Gaps = 20/283 (7%)

Query: 33  AFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDI 92
            F+ R I AL  +      +H         DA   G   ++ + +   +L  R++R++D+
Sbjct: 25  GFFGRIIGALSPSDTDEAEAH---------DAPAGG--GDSARAVPLGMLNLRRMRVEDV 73

Query: 93  MISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAK 152
           MI +V + AV +  ++ + +  F + G + +PV++ +LD P G+VH++D    + H +  
Sbjct: 74  MIPKVEVVAVAEDISLSDLVEKFRESGNTRLPVFRGTLDTPIGLVHLKDF--ALKHGF-- 129

Query: 153 TNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYED 212
            N  + +  +   +L++ +++ P SM +  LL  +Q  R+ MALVIDE+GG DGLV+ ED
Sbjct: 130 -NGDSPDFDMG--DLVRPLIYAPPSMPIGVLLQKMQTDRMHMALVIDEYGGVDGLVTLED 186

Query: 213 IVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLK-GEQDVDS 270
           +V  ++ +I  EH   + ++       +++V+AR  LEE  +  G         E+++D+
Sbjct: 187 LVEQVIGEIEDEHDLEEGALWMQEPSGSWLVEARAPLEEFEEASGLSLVTEDVEEEEIDT 246

Query: 271 LGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           LGGL+F    R+PARGEV+    G E  ++DA+ R ++R+R+R
Sbjct: 247 LGGLVFLEAGRVPARGEVIEHPSGAEFEVVDAEPRRIKRLRVR 289


>gi|254475170|ref|ZP_05088556.1| CBS domain protein [Ruegeria sp. R11]
 gi|214029413|gb|EEB70248.1| CBS domain protein [Ruegeria sp. R11]
          Length = 273

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 137/240 (57%), Gaps = 14/240 (5%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVH 138
           + ++  R++R++D+ I    I AV       E + +F + G + +PVY+ +LD P G VH
Sbjct: 38  HGMINLRRLRVEDVAIPAAEIVAVSASTPKDELVQIFRESGFTRIPVYEGTLDTPIGFVH 97

Query: 139 MRDVISYISHMYAKTNNINLN-IQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           ++D        +A  +  N      S   +++ +LFVP SM +  LLT +Q  R  MALV
Sbjct: 98  LKD--------FALMHGFNCEESDFSLQGMVRPLLFVPPSMTIGVLLTKMQAERRHMALV 149

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGL++ ED++  ++ +I  EH + +  M     +  +I  AR  LEE    IG
Sbjct: 150 IDEYGGVDGLLTIEDLIEQVVGEIEDEHDAGEDQMWFREKEGCYIAQARAPLEEFETEIG 209

Query: 257 ---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
              T+ + + GE+ +DSLGGL+F +  R+P RGEV+    G E  ++DAD R ++R+R+R
Sbjct: 210 RSLTNHDDVDGEE-IDSLGGLVFMLSGRVPVRGEVIQHPDGPEFEVMDADPRRIKRLRVR 268


>gi|254459830|ref|ZP_05073246.1| CBS domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206676419|gb|EDZ40906.1| CBS domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 300

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 155/285 (54%), Gaps = 26/285 (9%)

Query: 33  AFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDI 92
            F++R I AL         S   G  +P            T +   + ++  R++RI+D+
Sbjct: 31  GFFSRVISALSP-------SQDGGAPVP-------ATIPNTPRAQPHGMINLRRMRIEDV 76

Query: 93  MISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAK 152
            I +  I  V   A+  E + +F+  G + +PVY  +LD P G  H++D    + H +  
Sbjct: 77  AIPKGDITCVPLSASKEELLEVFKDSGLTRLPVYNGTLDTPLGFAHLKDFA--LLHGF-N 133

Query: 153 TNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYED 212
           + +   ++Q     +++ +L+VP SM +  LLT +Q  R  MALVIDE+GG DGLV+ ED
Sbjct: 134 SEDTAFDLQ----AMLRPLLYVPPSMPIGILLTKMQTERRHMALVIDEYGGVDGLVTIED 189

Query: 213 IVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLEELAKIIG---TDCNCLKGEQDV 268
           ++  ++ +I  EH ++++ +  +     ++  A+  L+E    IG   T+ + +  E+ +
Sbjct: 190 LIEQVIGEIEDEHDTEEAELWTLEKSGQYLAQAKAPLDEFEDAIGLHLTEDDEIDAEE-I 248

Query: 269 DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++LGGL+F +   +PARGEVV    G+E  ++DAD R ++R+R+R
Sbjct: 249 ETLGGLVFMLAGHVPARGEVVRHPAGYEFEVIDADPRRIKRLRVR 293


>gi|254465764|ref|ZP_05079175.1| CBS domain protein [Rhodobacterales bacterium Y4I]
 gi|206686672|gb|EDZ47154.1| CBS domain protein [Rhodobacterales bacterium Y4I]
          Length = 299

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 147/294 (50%), Gaps = 25/294 (8%)

Query: 23  SPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNIL 82
           +P    T    FW R            + +   G   P   +   G+            +
Sbjct: 22  APEAPATEKTGFWARLFSVFSSE---PQAADEPGTGQPAAGSGAHGM------------I 66

Query: 83  RFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDV 142
             R++R++D+ I    I AV       + + +F + G + +PVY+ +LD P G VH++D 
Sbjct: 67  NLRRLRVEDVAIPSAEIAAVPVTIDKDDLVGIFRQSGFTRIPVYEGTLDTPLGFVHLKDF 126

Query: 143 ISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHG 202
              ++H +    +   ++Q     +++ +LFVP SM +  LLT +Q  R  MALVIDE+G
Sbjct: 127 --SLTHGF-NGGSTEFDLQ----RMLRPLLFVPPSMPIGVLLTKMQAERRHMALVIDEYG 179

Query: 203 GTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNC 261
           G DGLV+ ED++  ++ +I  EH + +          ++I  ART L E    IG     
Sbjct: 180 GVDGLVTIEDLIEQVVGEIEDEHDADELQTWYQEKPGSYIALARTPLPEFESEIGQSLTS 239

Query: 262 LKG--EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                E+++D+LGGL+F +  R+PARGEV+    G E  ++DAD R ++R+R+R
Sbjct: 240 HDAVDEEEIDTLGGLVFMLSGRVPARGEVIEHPEGAEFEVIDADPRRIKRLRVR 293


>gi|209966240|ref|YP_002299155.1| hemolysin containing CBS domain, putative [Rhodospirillum centenum
           SW]
 gi|209959706|gb|ACJ00343.1| hemolysin containing CBS domain, putative [Rhodospirillum centenum
           SW]
          Length = 315

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 142/254 (55%), Gaps = 16/254 (6%)

Query: 65  SLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMP 124
           + EG    +E+ +  NIL+ R   + D M+ R  I AV     + + +  F     S MP
Sbjct: 55  AAEGSIGASERTLLANILKLRDRTVVDAMVPRADIVAVSADIGLPDLIRRFSLEAHSRMP 114

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ +LD+  GMVH++DV++ +++                + + + +  V  SM V DLL
Sbjct: 115 VYRETLDDVIGMVHIKDVLACVANQKP----------FDMAAITREVPIVAPSMPVLDLL 164

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVD 243
            +++++R  MALV+DE GG DGLV+ ED+V  ++ +I  EH    +  + A  D + I D
Sbjct: 165 LHMRQTRQHMALVVDEFGGIDGLVTIEDLVEEIVGEIEDEHDEDIEPRVVARPDGSVIAD 224

Query: 244 ARTDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           AR  +E+    +G      + +  QDVD+LGGL+FS+  R+PARGE++    G E  I+D
Sbjct: 225 ARVPIEDFESQVG---RVFQEDELQDVDTLGGLVFSLAGRVPARGELLKHPSGLEFEIVD 281

Query: 302 ADVRCVRRVRIRRL 315
           AD R ++R+R+R L
Sbjct: 282 ADPRRIKRLRVRNL 295


>gi|126727646|ref|ZP_01743478.1| CorC/Hlyc family protein with CBS domains [Rhodobacterales
           bacterium HTCC2150]
 gi|126703062|gb|EBA02163.1| CorC/Hlyc family protein with CBS domains [Rhodobacterales
           bacterium HTCC2150]
          Length = 297

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 135/237 (56%), Gaps = 13/237 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++ ++D+ I +V I AV       + + +F + G + +PV++ +LD P G +H+
Sbjct: 64  GMVNLRRLSLEDVAIPKVEIVAVPHDIKKSKLVSVFRESGLTRLPVFEGTLDTPLGFIHL 123

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D        +A  +        S  +L++ ++F P SM +  LL  +Q  RI MALVID
Sbjct: 124 KD--------FALKHGFGTAGAFSMKDLVRPLIFAPPSMGIGVLLQKMQNERIHMALVID 175

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GG DGLV+ ED++  ++  I  EH  +  S  +  +   ++ DAR+DL E    IG  
Sbjct: 176 EYGGVDGLVTIEDLIEQVIGQIDDEHDPEDASAWTQEAPGIYLADARSDLTEFEAEIG-- 233

Query: 259 CNCLKGEQD--VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            N +K  +D  VD+LGG+IF +  RIP RGEV+    G E  I+DAD R ++R+R+R
Sbjct: 234 LNLIKDLEDDEVDTLGGIIFVLTGRIPTRGEVIPHPLGVEFEIVDADARRIKRLRVR 290


>gi|163739046|ref|ZP_02146459.1| CBS domain protein [Phaeobacter gallaeciensis BS107]
 gi|163741713|ref|ZP_02149103.1| hemolysin, putative [Phaeobacter gallaeciensis 2.10]
 gi|161384886|gb|EDQ09265.1| hemolysin, putative [Phaeobacter gallaeciensis 2.10]
 gi|161387851|gb|EDQ12207.1| conserved hypothetical protein [Phaeobacter gallaeciensis BS107]
          Length = 299

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 143/254 (56%), Gaps = 15/254 (5%)

Query: 67  EGIFSETEKEIFN---NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           EG+ +  +  + N    ++  R++R++D+ I    I A+       E + +F + G + +
Sbjct: 48  EGVTAGPDTRLPNQPHGMINLRRLRVEDVAIPAAEIVAIPVSTPKDELVQIFRESGFTRI 107

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+ +LD P G VH++D    + H +   N    +  L    +++ +LFVP SM +  L
Sbjct: 108 PVYEGTLDTPIGFVHLKDFA--LMHGF---NGTEADFGLE--GMVRPLLFVPPSMTIGVL 160

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIV 242
           LT +Q  R  MALVIDE+GG DGL++ ED++  ++ +I  EH + +           +I 
Sbjct: 161 LTKMQAERRHMALVIDEYGGVDGLLTIEDLIEQVVGEIEDEHDAGEDQTWFREKQGCYIA 220

Query: 243 DARTDLEELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
            ART L+E    IG   T+   + GE+ +DSLGGL+F +  R+PARGEV+    G E  +
Sbjct: 221 QARTPLDEFENEIGRSLTNHEDVDGEE-IDSLGGLVFMLSGRVPARGEVIQHPDGPEFEV 279

Query: 300 LDADVRCVRRVRIR 313
           +DAD R ++R+R+R
Sbjct: 280 MDADPRRIKRLRVR 293


>gi|83595102|ref|YP_428854.1| CBS domain-containing protein [Rhodospirillum rubrum ATCC 11170]
 gi|83578016|gb|ABC24567.1| CBS domain protein [Rhodospirillum rubrum ATCC 11170]
          Length = 318

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 135/238 (56%), Gaps = 19/238 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            ++ E+ +  NILR R + ++DIM+ R  + AVE    V  A+      G S +PVY+++
Sbjct: 66  MTDQERALLTNILRLRDMTVEDIMVPRADVVAVEVSTPVDVAIERIAACGHSRLPVYRDT 125

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LDN  GMVH++D +   S        +           ++ ILF   S  V DLL  ++ 
Sbjct: 126 LDNTLGMVHVKDFLRRKSGDAGSLERV-----------LREILFAAPSARVLDLLLEMRL 174

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDL 248
            RI MAL++DE+GG DGLV+ ED+V  ++ +I  E+ S  +  ++   D T +VDAR DL
Sbjct: 175 KRIHMALIVDEYGGIDGLVTIEDLVEQIVGEIEDEYDSVTEPELTVHEDGTVVVDARLDL 234

Query: 249 EELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           E+  +  G   TD    +  +++D+LGGL+F +  R+PARGE+VL   G E  ++DAD
Sbjct: 235 EDFEERCGRLFTD----EEREEIDTLGGLVFRLAGRVPARGELVLREGGPEFEVIDAD 288


>gi|260574094|ref|ZP_05842099.1| CBS domain containing protein [Rhodobacter sp. SW2]
 gi|259023560|gb|EEW26851.1| CBS domain containing protein [Rhodobacter sp. SW2]
          Length = 309

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 132/235 (56%), Gaps = 9/235 (3%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            +   RK+R+DD+ I +V I AV       + +  F K G S +PVYK +LD+P+G+V +
Sbjct: 61  GMANLRKLRVDDVAIPKVEIVAVPLDIGKDDLVEAFRKSGYSRLPVYKGTLDHPQGLVLL 120

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
                 + H +      NL        +++ IL+ P SM +  LL  +Q+ R+ MALVID
Sbjct: 121 --KDLALLHGFGAAGRFNLR------KMLRPILYAPPSMPLGVLLQKMQKDRVHMALVID 172

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GG DGLV+ ED++  ++ +I  EH  ++ ++        ++V     L+E    IG  
Sbjct: 173 EYGGVDGLVTIEDLIETVIGEIEDEHDEAEGALWKEEKPGVYVVQPTAPLQEFEAAIGVR 232

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
               + ++++D+LGGL+F    R+PARGE+V    G E  ++DAD R ++R+++R
Sbjct: 233 LRTDEDDEEIDTLGGLVFLRAGRVPARGEIVAHESGVEFEVVDADPRRLKRLKVR 287


>gi|114571575|ref|YP_758255.1| CBS domain-containing protein [Maricaulis maris MCS10]
 gi|114342037|gb|ABI67317.1| CBS domain containing protein [Maricaulis maris MCS10]
          Length = 296

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 136/229 (59%), Gaps = 1/229 (0%)

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           K+R+ D+M+ R  I  V+    + +   +F +   S +P+Y+++LD+P G+VH++DV+S+
Sbjct: 49  KLRVADVMVPRADIIGVDVATPLGQLAKIFAQAAHSRLPIYRDTLDDPVGVVHIKDVVSH 108

Query: 146 ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTD 205
           ++   +         +    ++ + +LF P SM   DLL  +Q  R+ +ALV+DE+GGTD
Sbjct: 109 LAPGSSGKRPAGWAHKQVLPSIGRPLLFAPPSMKALDLLRRMQGRRMHLALVVDEYGGTD 168

Query: 206 GLVSYEDIV-SVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           GLV+ ED++  ++          +   I +     + V+AR +++    ++G +      
Sbjct: 169 GLVTLEDLIEPIVGDIEDEHDDEETPAIRSRGPGVWDVEARAEIDAFEAVVGEEIAAEDE 228

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++DVDSLGGL+F+++ R+P RGEV+    G+E  +++AD R ++R+R+R
Sbjct: 229 DEDVDSLGGLVFTLIGRVPERGEVIRHPTGYEFEVIEADSRRIKRMRVR 277


>gi|260431174|ref|ZP_05785145.1| CBS domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415002|gb|EEX08261.1| CBS domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 294

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 136/237 (57%), Gaps = 12/237 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+ I    I +V    +  E   +F + G S +PVY+ +LD P G VH+
Sbjct: 59  GMINLRRMRVEDVAIPSADIVSVPVTISKDELAQVFRESGLSRIPVYEGTLDTPLGFVHL 118

Query: 140 RDVISYISHMYAKTNNINLNI-QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVI 198
           +D        +A T+  N +  +    ++++ +LFVP SM +  LL  +Q  R  MALVI
Sbjct: 119 KD--------FALTHGFNGDSKEFDLPSMLRPLLFVPPSMPIGVLLAKMQTERRHMALVI 170

Query: 199 DEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIGT 257
           DE+GG DGLV+ ED++  ++ +I  EH + +  M        +IV A+  LE+    IG 
Sbjct: 171 DEYGGVDGLVTIEDLIEQVVGEIEDEHDADEDQMWVKERPGCYIVQAKAPLEDFEAEIGR 230

Query: 258 DCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                +   E+++++LGGL+F +  R+PARGEVVL   G E  ++DAD R ++R+R+
Sbjct: 231 SLTSHEDVDEEEIETLGGLVFMLSGRVPARGEVVLHPDGPEFEVIDADPRRIKRLRV 287


>gi|148555306|ref|YP_001262888.1| CBS domain-containing protein [Sphingomonas wittichii RW1]
 gi|148500496|gb|ABQ68750.1| CBS domain containing protein [Sphingomonas wittichii RW1]
          Length = 322

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 139/242 (57%), Gaps = 11/242 (4%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            S  E+E+  NIL F +  + DI + R  I AV +     E +  F +   S +PVY   
Sbjct: 78  LSSAEREMLRNILHFGERTVGDIGVPRGDIVAVPEAIGFDELVARFAEAEHSRLPVYGED 137

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LD+  GM+H++DV   I+   A+   I        + LI+   +VPSSM + DLL  ++E
Sbjct: 138 LDHVTGMIHVKDVFRIIATGAARPATI--------AGLIRQPRYVPSSMRIIDLLAEMRE 189

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDL 248
           +R  +A+V++E+ GTDGLV+ ED+V  ++ DI  EH  K++ ++  + D  +  DAR +L
Sbjct: 190 TRTHLAIVLNEYSGTDGLVTIEDLVEEIVGDIEDEHDEKEADLLVPLDDAIWSADARAEL 249

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           E++A++I  D      + DV++LGGL  ++  ++P  G++V    G+ + I DAD R VR
Sbjct: 250 EDVARLI--DPRLADIDDDVETLGGLASALAGQVPQAGQIVEHPSGWRLEITDADERRVR 307

Query: 309 RV 310
           ++
Sbjct: 308 QM 309


>gi|254295426|ref|YP_003061449.1| hypothetical protein Hbal_3084 [Hirschia baltica ATCC 49814]
 gi|254043957|gb|ACT60752.1| CBS domain containing protein [Hirschia baltica ATCC 49814]
          Length = 306

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 141/233 (60%), Gaps = 3/233 (1%)

Query: 81  ILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMR 140
           +  F    + D+MI RV I AVE + TV E + +F +   S +PVY+ +LD+P G+VH++
Sbjct: 56  VAEFETATVSDVMIPRVEIKAVEVETTVEELLKIFTEESHSRLPVYREALDDPIGLVHIK 115

Query: 141 DVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDE 200
           D   +++ + +     +++ +   + + + ILFVP+SM + DLL  +Q SRI +ALV+DE
Sbjct: 116 D---FVAELASGDGVDSMSNEKLLAKIKREILFVPASMRLPDLLVKMQTSRIHLALVVDE 172

Query: 201 HGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCN 260
           +GGTDGLVS ED+V  ++ DI  EH  +++     +   +  DAR ++E+  +       
Sbjct: 173 YGGTDGLVSLEDLVEQIVGDIEDEHDEEEAHFEQRAPGVWEADARAEIEDFEEESELSLA 232

Query: 261 CLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
               E ++D+LGGL+F++  R+P RGE+V         +++AD R ++++R+R
Sbjct: 233 LADYEDEIDTLGGLVFALAGRVPHRGEIVQHPSNVAFEVIEADSRRIKKLRVR 285


>gi|99080032|ref|YP_612186.1| CBS domain-containing protein [Ruegeria sp. TM1040]
 gi|99036312|gb|ABF62924.1| CBS domain protein [Ruegeria sp. TM1040]
          Length = 300

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 140/238 (58%), Gaps = 12/238 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+ I    I+AV    +  + + +F   G + +PVY+ +LD P G VH+
Sbjct: 64  GMMNLRRLRVEDVAIPTAEIDAVPVTISREDLVRVFRDSGFTRIPVYEGTLDTPLGFVHL 123

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+   +++ +   N+ + +I    + +++ +LFVP SM +  LLT +Q  R  MALVID
Sbjct: 124 KDLA--LTYGFDCEND-DFDI----TPMLRPLLFVPPSMPIGVLLTKMQAERRHMALVID 176

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIG-- 256
           E+GG DGLV+ ED++  ++ +I  EH S +           ++  ART L +    IG  
Sbjct: 177 EYGGVDGLVTIEDLIEQVVGEIEDEHDSGEDQTWVQEKPGCYVAQARTPLVDFENEIGIP 236

Query: 257 -TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            T    + GE+ +D+LGGL+F +  R+PARGEV+    G E  ++DAD R ++R+R+R
Sbjct: 237 LTQHEDVDGEE-IDTLGGLVFMLSGRVPARGEVIEHPEGAEFEVVDADPRRIKRLRVR 293


>gi|159043563|ref|YP_001532357.1| CBS domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157911323|gb|ABV92756.1| CBS domain containing protein [Dinoroseobacter shibae DFL 12]
          Length = 302

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            I   R++R+ D+ I R  I AV    T+ E + +F   G + +PVY+N+LD P GMVH+
Sbjct: 62  GIGNLRRMRVVDVAIPRADIVAVPSDITLPELVQVFRDSGMTRLPVYRNTLDTPLGMVHL 121

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D ++        T   +L   L      + +L+ P SM +  LL  +Q+ R+ MALVID
Sbjct: 122 KD-LALQYGFNGATPKFSLKGNL------RPVLYAPPSMPIGVLLQKMQKDRMHMALVID 174

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GGTDGLV+ ED++  ++ +I  EH   +  + S      ++V A+  L+EL + +   
Sbjct: 175 EYGGTDGLVTIEDLIEQVIGEIEDEHDEPEDRLWSREKPGVYLVQAKAPLDELERELSVS 234

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
                 ++++D+LGGL+F +  R+P RGEV+    G E  ++DAD
Sbjct: 235 LISPGDDEEIDTLGGLVFKLTGRVPVRGEVIPHETGVEFEVVDAD 279


>gi|254437794|ref|ZP_05051288.1| CBS domain pair protein [Octadecabacter antarcticus 307]
 gi|198253240|gb|EDY77554.1| CBS domain pair protein [Octadecabacter antarcticus 307]
          Length = 294

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 143/238 (60%), Gaps = 12/238 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+MI +  I AV    +  + + +F   G + +PV+  +LD P G V++
Sbjct: 58  GMINLRRMRVEDVMIPKSDIVAVPVTISRNDLVQVFRDNGMTRLPVFDGTLDTPIGFVNL 117

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D  + +     K+   NL       +L + +LFVP SM +  LL  +Q  RI MALVID
Sbjct: 118 KD-FALMYGFNGKSKTFNLR------DLSRELLFVPPSMPLGVLLQKMQAERIHMALVID 170

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIG-- 256
           E+GGTDGLV+ ED++  ++ +I  EH + + ++        ++V+++T L+E    IG  
Sbjct: 171 EYGGTDGLVTIEDLIEQVVGEIEDEHDTDEDALWVEEKPGVYMVESKTPLDEFEAEIGMA 230

Query: 257 -TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            T+ + +  E+++D+LGGL+F +   +PARGEV++   G E  +++AD R ++R+R+R
Sbjct: 231 LTEHHDID-EEEIDTLGGLVFMLAGHVPARGEVIMHPEGPEFEVVEADPRRIKRLRVR 287


>gi|86136020|ref|ZP_01054599.1| hemolysin, putative [Roseobacter sp. MED193]
 gi|85826894|gb|EAQ47090.1| hemolysin, putative [Roseobacter sp. MED193]
          Length = 300

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 151/290 (52%), Gaps = 26/290 (8%)

Query: 27  SKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRK 86
           S    P FW R   +        +         P+++   EG   E +    + ++  R+
Sbjct: 26  SAAQRPGFWERIFGSFTPDTPAQQ---------PQVEP--EGPSPEVQS---HGMINLRR 71

Query: 87  IRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYI 146
           +R++D+ I    I +V       + + +F   G + +PVY+ +LD P G  H++D    +
Sbjct: 72  MRVEDVAIPSAEILSVPVSIDRDDLVQVFRDSGFTRIPVYEGTLDTPLGFAHLKDFA--L 129

Query: 147 SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDG 206
           +H +   N  N   +LS+  +++ +LFVP SM +  LL  +Q  R  MALVIDE+GG DG
Sbjct: 130 THGF---NGGNKPFELSQ--MLRPLLFVPPSMPIGVLLAKMQAERRHMALVIDEYGGVDG 184

Query: 207 LVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIG---TDCNCL 262
           LV+ ED++  ++ +I  EH   +           +I  ART L+E    IG   T    +
Sbjct: 185 LVTIEDLIEQVIGEIEDEHDPGEDQTWYQEKAGCYIALARTPLDEFETEIGRSLTRHEDV 244

Query: 263 KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            GE+ +++LGGL+F +  R+PARGEV++   G E  ++DAD R ++R+R+
Sbjct: 245 DGEE-IETLGGLVFMLSGRVPARGEVIVHPEGPEFEVMDADPRRIKRLRV 293


>gi|330994667|ref|ZP_08318590.1| Putative hemolysin C [Gluconacetobacter sp. SXCC-1]
 gi|329758308|gb|EGG74829.1| Putative hemolysin C [Gluconacetobacter sp. SXCC-1]
          Length = 314

 Score =  142 bits (357), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 129/235 (54%), Gaps = 11/235 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+MI R  I A+    ++ EA+ M  +   S MPVY+  LD+ 
Sbjct: 66  ERALLANVLRLRGITADDVMIPRADIVAMPVDISLDEALDMMRRENHSRMPVYRAQLDDI 125

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM+H++D+I+Y+    A               L++  L V   + V DLL  +++  + 
Sbjct: 126 VGMIHVKDLIAYVGTSEA----------FRMEPLLRQPLMVAPQLPVLDLLLQMRQRHVH 175

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELA 252
           +ALVIDE+GG DGLV+ ED++  ++ DI+ EH     +M+    D T  VDART +    
Sbjct: 176 LALVIDEYGGIDGLVTIEDLIETIVGDISDEHDEPTVNMMRDRPDGTLDVDARTPVAAFE 235

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + +G      + E +++++GGL+F +   +P RGEVV    G    ILD+D R +
Sbjct: 236 EKVGPVLTREEREAEIETVGGLVFRLAGHVPTRGEVVTHEGGMVFRILDSDARHI 290


>gi|326403550|ref|YP_004283632.1| hypothetical protein ACMV_14030 [Acidiphilium multivorum AIU301]
 gi|325050412|dbj|BAJ80750.1| hypothetical protein ACMV_14030 [Acidiphilium multivorum AIU301]
          Length = 284

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 126/231 (54%), Gaps = 11/231 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+MI R  I A+    T+ +A+    + G S MPV+   LD+ 
Sbjct: 47  ERALIANVLRLRGITADDVMIPRADIVAMRADVTLDQAIDQIRREGHSRMPVFGEHLDDI 106

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GMVH++DV+ Y     A           S   +++  L V   + V DLL  +++ R  
Sbjct: 107 LGMVHIKDVVGYTGRPEA----------FSLRAILRRPLMVAPQIPVLDLLLQMRQRRTH 156

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELA 252
           +ALVIDE+GG DGLV+ ED+V  ++ DI  EH   +  ++    D    ++AR  +E+  
Sbjct: 157 LALVIDEYGGVDGLVTIEDLVETIVGDIDDEHDEIEGPLMIDRDDGAVDLNARLPVEDFT 216

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
              G      + E D+D++GGL+F++  R+P RGE++    G E +ILDAD
Sbjct: 217 TRFGDFLTEEEKEADLDTVGGLVFTLAGRVPTRGEIISHPAGIEFLILDAD 267


>gi|148260359|ref|YP_001234486.1| CBS domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146402040|gb|ABQ30567.1| CBS domain containing protein [Acidiphilium cryptum JF-5]
          Length = 289

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 126/231 (54%), Gaps = 11/231 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+LR R I  DD+MI R  I A+    T+ +A+    + G S MPV+   LD+ 
Sbjct: 52  ERALIANVLRLRGITADDVMIPRADIVAMRADVTLDQAIDQIRREGHSRMPVFGEHLDDI 111

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GMVH++DV+ Y     A           S   +++  L V   + V DLL  +++ R  
Sbjct: 112 LGMVHIKDVVGYTGRPEA----------FSLRAILRRPLMVAPQIPVLDLLLQMRQRRTH 161

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELA 252
           +ALVIDE+GG DGLV+ ED+V  ++ DI  EH   +  ++    D    ++AR  +E+  
Sbjct: 162 LALVIDEYGGVDGLVTIEDLVETIVGDIDDEHDEIEGPLMIDRDDGAVDLNARLPVEDFT 221

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
              G      + E D+D++GGL+F++  R+P RGE++    G E +ILDAD
Sbjct: 222 TRFGDFLTEEEKEADLDTVGGLVFTLAGRVPTRGEIISHPAGIEFLILDAD 272


>gi|326386702|ref|ZP_08208323.1| CBS-domain containing proteih [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208755|gb|EGD59551.1| CBS-domain containing proteih [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 312

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 145/267 (54%), Gaps = 9/267 (3%)

Query: 51  LSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE 110
           +  H+G     +DA  +G     E+++  N+L F +   DD+ I R  I AV   A+  E
Sbjct: 47  IEEHEGDPAQTVDA--KGDLLPLERQMMKNLLHFSEHDADDVAIPRGEIVAVPSTASFAE 104

Query: 111 AMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKN 170
            +  F ++G S MP+Y+ SLD   GMVH++DV   ++ M  K      +     S L++ 
Sbjct: 105 LVAAFAEHGHSRMPIYRESLDEVIGMVHIKDVFPIVADMALKGRGGPTDW----SKLMRQ 160

Query: 171 ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK- 229
            LFVP +    D+L +++ SR  +A+VIDE+ GTDG+++ ED+V  ++ +I  EH     
Sbjct: 161 PLFVPQARGALDVLGDMRSSRTHLAIVIDEYSGTDGIITIEDLVEEIVGEIEDEHDDAPV 220

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            ++  +  +T+  DAR +L+E+ K +  D      ++DVD+LGGL   +   +P  G V+
Sbjct: 221 DLLRRIDADTWDADARIELDEVGKRV--DPRLAITDEDVDTLGGLAVMLAGEVPPVGRVL 278

Query: 290 LEIPGFEIVILDADVRCVRRVRIRRLV 316
               G++I + D D R + R+R+   V
Sbjct: 279 DHESGWKIEVTDGDERRLTRLRLHAPV 305


>gi|149186037|ref|ZP_01864351.1| hemolysin [Erythrobacter sp. SD-21]
 gi|148830068|gb|EDL48505.1| hemolysin [Erythrobacter sp. SD-21]
          Length = 305

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 163/307 (53%), Gaps = 16/307 (5%)

Query: 8   NSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPR-IDASL 66
           NSS    +      L P+I K        R++RA  +      +  H+G       + + 
Sbjct: 3   NSSPPAGDAESSSGLWPAIKKLFDAEGGERSLRAQLEE----AIDEHEGENGSEDTEDTG 58

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G  S  E+++  N+L F +   DD+ + R  I AV  +A+  E +  F ++G S MPVY
Sbjct: 59  KGDLSGVERQMLRNLLHFSEHDADDVAVPRGEIIAVNAEASWVEVVATFSEHGHSRMPVY 118

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  LD+  GM+H++D+  +++   A   +         + L++  L+VP +    D+L +
Sbjct: 119 RGQLDDVIGMIHIKDIFPFLAEKKAPPTDW--------TTLMRQPLYVPQTRNALDVLAD 170

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDAR 245
           ++  R+ +A+V+DE  GTDG+++ ED+V  ++ +I  EH     + I+++ +  +  DAR
Sbjct: 171 MRSQRMHLAIVLDEFSGTDGIITIEDLVEEIVGEIEDEHDDAPEIWIASIGEGMWDCDAR 230

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            +L+++A+ I  D    + E+ VD+LGGL F + +++P  G+V+    G+ I + D D  
Sbjct: 231 AELDDVAEKI--DPRLAEVEESVDTLGGLAFVLAEQVPPVGKVLEHPSGWRIEVTDGDET 288

Query: 306 CVRRVRI 312
            V R+R+
Sbjct: 289 HVTRLRL 295


>gi|126736951|ref|ZP_01752686.1| hemolysin, putative [Roseobacter sp. SK209-2-6]
 gi|126721536|gb|EBA18239.1| hemolysin, putative [Roseobacter sp. SK209-2-6]
          Length = 299

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 133/238 (55%), Gaps = 12/238 (5%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVH 138
           + ++  R++R++D+ I    I +V       + + +F   G + +PVY+ +LD P G  H
Sbjct: 63  HGMINLRRMRVEDVAIPSAEILSVPVSIERDDLVKVFRDSGYTRVPVYEGTLDTPLGFAH 122

Query: 139 MRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           ++D        +A T+  N N +  + S +++ +LFVP SM +  LL  +Q  R  MALV
Sbjct: 123 LKD--------FALTHGFNGNTKPFDLSRMLRPLLFVPPSMPIGVLLAKMQAERRHMALV 174

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFIVDARTDLEELAKIIG 256
           IDE+GG DGLV+ ED++  ++ +I  EH   +           +I  ART L+E    IG
Sbjct: 175 IDEYGGVDGLVTIEDLIEQVIGEIEDEHDPGEDQTWYQEKPGCYIALARTPLDEFETEIG 234

Query: 257 TDCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 +   E+++D+LGGL+F +  R+PARGEV+    G E  ++DAD R ++R+R+
Sbjct: 235 RSLTSHEDVDEEEIDTLGGLVFMLSGRVPARGEVIEHPDGAEFEVIDADPRRIKRLRV 292


>gi|315497217|ref|YP_004086021.1| transporter-associated region [Asticcacaulis excentricus CB 48]
 gi|315415229|gb|ADU11870.1| transporter-associated region [Asticcacaulis excentricus CB 48]
          Length = 296

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 137/246 (55%), Gaps = 4/246 (1%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
            E   ++  +   F+ +R+ D+M  RV I  +ED AT+ E + +  +   S +PVY ++L
Sbjct: 41  PEATNDLIEHARAFQNLRVSDVMTPRVDIIGIEDTATLSELVRVCVESEHSRLPVYSDNL 100

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D+P G++H++DV   ++   +    I     L    L + +++VP +M  +DLL  +Q  
Sbjct: 101 DHPVGVIHVKDVFKLLA--PSDDRRIPDWDALVTDRLKRELIYVPGAMSATDLLLKMQTE 158

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT-SEHHSKKSMISAVSDNTFIVDARTDLE 249
           R  MALVIDEHGGTDGLV+ ED++  ++ DI       +   +   ++    V  R +LE
Sbjct: 159 RSHMALVIDEHGGTDGLVTLEDLLEAVVGDIADEYDDDEVDELVETAEGQIEVSGRVELE 218

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDADVRCVR 308
            L + +G        E++VD+LGGL+  +  R+P  GE++     G +I +LDAD R ++
Sbjct: 219 TLEERLGLRLFPENSEEEVDTLGGLVAVLAGRVPQPGEIIPYAAAGIDIEVLDADQRRIK 278

Query: 309 RVRIRR 314
           R+R+ R
Sbjct: 279 RLRLHR 284


>gi|288959691|ref|YP_003450032.1| magnesium and cobalt transporter [Azospirillum sp. B510]
 gi|288911999|dbj|BAI73488.1| magnesium and cobalt transporter [Azospirillum sp. B510]
          Length = 318

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 141/251 (56%), Gaps = 6/251 (2%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLM-FEKYGRSW 122
           A  E      E+ +  NIL+ R   + D+M+ R  I AV D  T + A++    + G S 
Sbjct: 58  ADGEDSLGTGERALLTNILKLRDRTVADVMVPRADIIAV-DIDTPFPALVQRVAEEGHSR 116

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PV++ +LD+  G++H++DV++ ++        ++ N  LS   +I+    V  SM V D
Sbjct: 117 LPVFRETLDDVVGIIHIKDVMTLLAKQAVSAEGLSRNPDLS--GIIREAKIVAPSMHVLD 174

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFI 241
           LL  ++++R  MALV+DE GG DGLV+ ED+V  ++ +I  EH  ++   +    D + I
Sbjct: 175 LLVQMRQTRQHMALVVDEFGGIDGLVTIEDLVEEIVGEIEDEHDETEAPRLLERPDGSLI 234

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            DAR  +E+    +G      +  +D+D+LGGL+ S+  R+P  GE ++   G E  I+D
Sbjct: 235 ADARLPIEDFEDRVGP-VLTEEEREDIDTLGGLVVSIAGRVPGLGERLVHPSGLEFEIVD 293

Query: 302 ADVRCVRRVRI 312
           AD R ++R+R+
Sbjct: 294 ADSRRLKRLRV 304


>gi|126730910|ref|ZP_01746719.1| hemolysin, putative [Sagittula stellata E-37]
 gi|126708626|gb|EBA07683.1| hemolysin, putative [Sagittula stellata E-37]
          Length = 328

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 141/240 (58%), Gaps = 14/240 (5%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVH 138
           + ++  R++R++D+ I +  I AV +  T  + + +F + G + +PVY+ +LD P GM H
Sbjct: 73  HGMINLRRMRVEDVAIPKADIVAVPNTITRDDLVKVFRESGMTRVPVYEGTLDTPVGMAH 132

Query: 139 MRD-VISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           ++D  ++Y  +      N+          +++ +LFVP SM +  LLT +Q  R  MALV
Sbjct: 133 LKDFALAYGFNGAGARFNLK--------RMLRPLLFVPPSMPIGVLLTKMQTERRHMALV 184

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSD--NTFIVDARTDLEELAKII 255
           IDE+GG DGLV+ ED++  ++ +I  EH +     S V +    ++  A+T LEE    +
Sbjct: 185 IDEYGGVDGLVTIEDLIEQVIGEIEDEHDTDDDQ-SWVKERPGCYLALAKTPLEEFEAEL 243

Query: 256 GTDCN--CLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           G D        E+++D+LGGL+F +  R+PARGEVV    G ++ ++DAD R ++R+R+R
Sbjct: 244 GFDLTEHEDIDEEEIDTLGGLVFMLAGRVPARGEVVRHPAGLDLEVVDADPRRIKRLRVR 303


>gi|197106912|ref|YP_002132289.1| hemolysin [Phenylobacterium zucineum HLK1]
 gi|196480332|gb|ACG79860.1| hemolysin [Phenylobacterium zucineum HLK1]
          Length = 294

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 137/247 (55%), Gaps = 8/247 (3%)

Query: 64  ASLEGIFSETEK--EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           A+  G   ETE   E+ N    F+ +R++D+M  R  I A++  A+  E +  F +   S
Sbjct: 32  AAAAGPEPETESAGELVNQARAFQGLRVEDVMKPRADIVAIDRSASFSEVVARFLEAEHS 91

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            MPVYK +LD P G+VH++DV   ++    K    +  +Q     L++ +L+VP SM  +
Sbjct: 92  RMPVYKETLDEPVGVVHVKDVFRLLARKSRKPKPEDQILQ-GRYQLVRKVLYVPPSMAAA 150

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAV--SDN 238
           +LL  ++  R  MALVIDE GG DGLV+ ED++  L+ +I  EH  +  +  + +   D+
Sbjct: 151 ELLALMRSRRTHMALVIDEFGGVDGLVTLEDLLEKLVGEIADEHDEEGDVGFTPIVEDDD 210

Query: 239 TFIVDARTDLEELAKIIGTDCNCLKG--EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
            ++ D R  LEEL   IG   +      +++++++ GL+ ++  R+P + E++    GF 
Sbjct: 211 GWVADGRAPLEELEHAIGEGVDLAPDDVDEEIETVAGLVNALAGRVPQKRELIPHPDGFS 270

Query: 297 IVILDAD 303
           I +L AD
Sbjct: 271 IEVLAAD 277


>gi|83949574|ref|ZP_00958307.1| hemolysin, putative [Roseovarius nubinhibens ISM]
 gi|83837473|gb|EAP76769.1| hemolysin, putative [Roseovarius nubinhibens ISM]
          Length = 290

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/232 (36%), Positives = 134/232 (57%), Gaps = 18/232 (7%)

Query: 89  IDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISH 148
           ++D+ I +  I  V    T  E + +F   G S +PVYK +LD P+GMVH++D       
Sbjct: 59  VEDVAIPKADIVCVPTTITKDELVQVFRDSGMSRLPVYKGTLDTPQGMVHLKD------- 111

Query: 149 MYAKTNNINLNI-QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
            +A  +  N N  + S S L++ + +VP SM +  LL  +Q  R  MALVIDE+GG DGL
Sbjct: 112 -FALKHGFNGNSGRFSLSQLLRPMFYVPPSMPIGVLLAKMQSERRHMALVIDEYGGVDGL 170

Query: 208 VSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLK--G 264
           ++ ED++  ++ +I  EH   + +  S     +++  A+T LEE     G     ++   
Sbjct: 171 LTIEDLIEQVIGEIEDEHDIDEGAYWSEEKPGSYLALAKTPLEEFEAETGLRLTEMEDVD 230

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPG---FEIVILDADVRCVRRVRIR 313
           E+++D+LGGLIF +L R+P RGEV+ E P    FE+V  +AD R ++R+R+R
Sbjct: 231 EEEIDTLGGLIFMMLGRVPVRGEVI-EHPSEAVFEVV--EADPRRIKRLRVR 279


>gi|282891331|ref|ZP_06299833.1| hypothetical protein pah_c050o120 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498828|gb|EFB41145.1| hypothetical protein pah_c050o120 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 451

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 152/248 (61%), Gaps = 7/248 (2%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           +K++  ++L F++    ++M+ RV+I ++    T+ +A+ + EK G S +PVY+N++DN 
Sbjct: 205 DKKLIESVLEFKERIAREVMVPRVNIFSLPVDTTIKDAIKLLEKEGYSRIPVYRNTVDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVPSSMLVSDLLTNIQESRI 192
            G++  +D+++   +M  + NN N NI  +    I KN+L+ P +  +S LL   ++ ++
Sbjct: 265 VGVLMYKDLMA--KYMEYEQNNKNQNILDAPIETIQKNVLYSPETKKISALLQEFRKKQV 322

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            +A+++DE+GGT+G+V+ EDI+  ++ DI  E+  ++ +     D ++I+DAR  + ++ 
Sbjct: 323 HLAIIVDEYGGTEGIVTIEDILEEIVGDIADEYDDEEELFIPQPDGSWIIDARMSILDID 382

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           + +      +  E + D++GG IF     IP++G  ++    FEI IL ++ RCV +V++
Sbjct: 383 EQLDIK---IPQEGEYDTIGGYIFHCAGSIPSKG-FIIHRDNFEIEILQSNDRCVEKVKL 438

Query: 313 RRLVHFKN 320
           R + HFK+
Sbjct: 439 RPIPHFKD 446


>gi|114798310|ref|YP_758840.1| CBS/transporter associated domain-containing protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114738484|gb|ABI76609.1| CBS/transporter domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 286

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 136/224 (60%), Gaps = 7/224 (3%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            +  F ++R+DD+M+ R  I AVE    + E +  F +   S +PV++ SLD+P G VH+
Sbjct: 48  RLAEFEELRVDDVMVPRADIKAVEAGTGIQELLEFFAEVTHSRLPVFRESLDDPIGFVHI 107

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+++ ++                  +L + +L+VP SM ++DLL  +Q +RI +ALV+D
Sbjct: 108 KDLVTELAKGGTPPRR-------PLESLHREVLYVPPSMKLTDLLVKMQATRIHLALVVD 160

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGTDGL++ ED+V V++ DI  EH  +++M    S   +  DART++E+  +  G D 
Sbjct: 161 EYGGTDGLITLEDLVEVIVGDIEDEHDDEEAMFVRRSARVWEADARTEIEDFQEEAGVDL 220

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           +    + D+D+LGG+ F++  ++P RGEV+    G EI I+DAD
Sbjct: 221 SLDDLDADIDTLGGVAFALAGKVPVRGEVLRHPGGTEIEIVDAD 264


>gi|260765333|gb|ACX49727.1| CBS domain-containing protein [uncultured Chloroflexi bacterium
           1i19]
          Length = 455

 Score =  139 bits (349), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 146/246 (59%), Gaps = 12/246 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E EK++   I  F +  + +IM+ R+ I AVE  A + +A+ +    G S +PVY
Sbjct: 181 EGVIEEDEKQMIAGIFEFGETTVREIMVPRLDIVAVEVTAPLSQALDLIIGNGHSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++S+D+  G+++ +D++     +  +  + +++++     L++   FVP S  + +L   
Sbjct: 241 EDSIDHLLGVLYAKDLL-----LCLRDGSQDISVR----QLLRKAYFVPQSKKLDELFEE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  RI MAL +DE+GGT GLV+ ED++  ++ +I  E+ S++  +  ++   +I +AR 
Sbjct: 292 MQAHRIHMALAVDEYGGTAGLVTIEDLLEEIVGEIQDEYDSEEPQLKKLAPEIYIFNARY 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           D++E++++I  D +   G +++D+LGG I+S L R+P +GE + +   +   +L  D R 
Sbjct: 352 DIDEVSRLIDVDLSA--GRENIDTLGGFIYSQLGRVPEQGESI-QFKDWRFTVLSVDSRR 408

Query: 307 VRRVRI 312
           +  VR+
Sbjct: 409 IEEVRV 414


>gi|114766586|ref|ZP_01445542.1| hemolysin, putative [Pelagibaca bermudensis HTCC2601]
 gi|114541202|gb|EAU44254.1| hemolysin, putative [Roseovarius sp. HTCC2601]
          Length = 271

 Score =  139 bits (349), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 136/239 (56%), Gaps = 14/239 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+ I +  I AV D  T  E + +F   G + +PV+  +LD P GM H+
Sbjct: 5   GMMNLRRMRVEDVAIPKAEIVAVPDTITKSELVQVFRDSGMTRLPVFSGTLDTPVGMAHL 64

Query: 140 RDVISYISHMY-AKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVI 198
           +D    + H +     + +LN       +++ ++FVP SM +  LLT +Q  R  MALVI
Sbjct: 65  KDF--ALRHGFNGSEEDFDLN------KILRPLVFVPPSMPIGVLLTKMQTERRHMALVI 116

Query: 199 DEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           DE+GG DGLV+ ED++  ++ +I  EH     ++     S  +++  A T LEE     G
Sbjct: 117 DEYGGVDGLVTIEDLIEQVIGEIEDEHDIDEGRNFFREKS-GSWLALATTPLEEFEAQTG 175

Query: 257 TDCNC--LKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                     E+++D+LGGL+F +   +PARGEVV    GF++ ++DAD R ++R+RIR
Sbjct: 176 IALTADEEIDEEEIDTLGGLVFMLAGHVPARGEVVPHPGGFDLEVVDADPRRIKRLRIR 234


>gi|56550969|ref|YP_161808.1| CBS domain-containing protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761441|ref|ZP_04759529.1| CBS domain containing protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260753356|ref|YP_003226249.1| hypothetical protein Za10_1120 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542543|gb|AAV88697.1| CBS domain containing protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374348|gb|EER63845.1| CBS domain containing protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258552719|gb|ACV75665.1| CBS domain containing protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 294

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 141/251 (56%), Gaps = 11/251 (4%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA      S  E+ +   +L F +    D+   R  I AV D     + +  F   G S 
Sbjct: 44  DAPDRDDLSPIERRMLRRLLHFGRRSAGDVGTPRADIVAVPDDINGQDLIAAFANSGLSR 103

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVYK +LD+  GM+H++D+ S ++    + +N +L       +L++   +VP +M V D
Sbjct: 104 LPVYKETLDDIIGMLHVKDIFSLMAE--GQRDNFDLK------SLLRQPRYVPETMGVLD 155

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFI 241
           LL  ++ +R  MA+V+DE+ GT+GL++ ED+V  ++ DI  EH  +  +++++  D  + 
Sbjct: 156 LLAEMRATRTHMAIVLDEYSGTEGLITIEDLVEEIIGDIEDEHDEAPTALLTSRPDGIWE 215

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            + RT+LE++A+ I  D +  + E+DVD++GGL   +   +P RGE++    G+ I IL 
Sbjct: 216 AEGRTELEDIAEWI--DPHLSEVEEDVDTIGGLATVLAGHVPQRGEILEHPSGWRIEILA 273

Query: 302 ADVRCVRRVRI 312
            D R V RVR+
Sbjct: 274 GDSRHVERVRL 284


>gi|329847361|ref|ZP_08262389.1| hemolysin C [Asticcacaulis biprosthecum C19]
 gi|328842424|gb|EGF91993.1| hemolysin C [Asticcacaulis biprosthecum C19]
          Length = 291

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 140/241 (58%), Gaps = 4/241 (1%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           E+ ++   F+ + + D+M  RV I ++E  +T+ + +    +   S +P+Y+ +LD+P G
Sbjct: 40  ELVDHAREFQNLSVADVMTPRVDIVSIELSSTLADVVRTCIESEHSRLPIYRETLDDPVG 99

Query: 136 MVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMA 195
           +VH++DV+  +     KT        L    + + +L+VP SM  ++L+  +Q  RI MA
Sbjct: 100 VVHIKDVLKLLGPDIGKTGPNWAEPVLH--RVRRELLYVPLSMTTAELMLRMQAQRIHMA 157

Query: 196 LVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKI 254
           LVIDE GGTDGLV+ ED+V  ++ +I  E+  + +  I  +      VD R ++  L + 
Sbjct: 158 LVIDEFGGTDGLVTLEDLVEAVVGNIDDEYDEAGEEDIRQLPSGQIEVDGRVEVTTLQEK 217

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDADVRCVRRVRIR 313
           +G +      E+++D++ GL+  +  R+P RGE++  E  GF+I +LDAD R ++++R+ 
Sbjct: 218 LGLELFPEDTEEEIDTMAGLVAVLAGRVPQRGEIIPYEKAGFDIEVLDADARRIKKLRLH 277

Query: 314 R 314
           R
Sbjct: 278 R 278


>gi|149202103|ref|ZP_01879076.1| hemolysin, putative [Roseovarius sp. TM1035]
 gi|149144201|gb|EDM32232.1| hemolysin, putative [Roseovarius sp. TM1035]
          Length = 295

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 140/242 (57%), Gaps = 15/242 (6%)

Query: 84  FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVI 143
            R + ++D+ I +  I +V +  +  + + +F   G S +PVY+ +LD+P GM+H++D  
Sbjct: 63  LRHMAVEDVAIPKADIVSVPNSISKEDLVHVFRDSGMSRLPVYEGTLDSPIGMLHLKDFA 122

Query: 144 SYISHMY-AKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHG 202
             + H +  +T    L       ++++ +LFVP SM +  LL  +Q  R  MALVIDE+G
Sbjct: 123 --LKHGFNGETEEFKLE------DMLRPLLFVPPSMPIGVLLQKMQAERRHMALVIDEYG 174

Query: 203 GTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIG---TD 258
           G DGLV+ ED++  ++ +I  EH   +    +      ++  A+T LE+    IG   T+
Sbjct: 175 GVDGLVTIEDLIEQVVGEIEDEHDIDEDHYWTQEKPGCYVALAKTPLEDFEAEIGISLTE 234

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHF 318
            + +  E+++D+LGGL+F +L R+P RGEV+    G  I +++AD R ++RVR+ RL   
Sbjct: 235 ADEVD-EEEIDTLGGLVFMLLGRVPVRGEVIEHPAGPVIEVMEADPRRIKRVRV-RLPEA 292

Query: 319 KN 320
           KN
Sbjct: 293 KN 294


>gi|268317660|ref|YP_003291379.1| CBS domain containing protein [Rhodothermus marinus DSM 4252]
 gi|262335194|gb|ACY48991.1| CBS domain containing protein [Rhodothermus marinus DSM 4252]
          Length = 421

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 134/229 (58%), Gaps = 10/229 (4%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++ + +G+  E E+E+   IL F +  + +IM+SR+ I A+ + AT  E +      G S
Sbjct: 164 LEVAQDGMLGEDERELLAAILEFGETTVREIMVSRLDIVAIPETATFGEVLACIRTSGHS 223

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +P+Y   LDN  G+V+ +D++ Y+           L+  L+  ++ +  +FVP S  + 
Sbjct: 224 RLPLYAEHLDNILGIVYAKDLLPYL-------GRAELDQPLNWRDIARPAMFVPLSKRLD 276

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTF 240
           DLL + Q  +  MA+V+DE+GGT GLV+ ED++  ++ DI  EH  ++  +   + ++T+
Sbjct: 277 DLLRDFQRRKTHMAIVVDEYGGTAGLVTLEDVLEEIVGDIRDEHDETEPVLYEQLDEHTY 336

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            VDAR +L++LA+++G + +      D ++LGGLIF +L  IP  G+ V
Sbjct: 337 RVDARMNLDDLAELLGIELDT--ESFDFETLGGLIFHLLGVIPEPGDEV 383


>gi|220932093|ref|YP_002509001.1| putative membrane CBS domain protein [Halothermothrix orenii H 168]
 gi|219993403|gb|ACL70006.1| putative membrane CBS domain protein [Halothermothrix orenii H 168]
          Length = 420

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 146/247 (59%), Gaps = 13/247 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+ + N+I  F    + +IM+ R+ +  ++    + E + +    G S +PVY
Sbjct: 175 EGVIKTDERRMINSIFEFDDTTVKEIMVPRIDMVCIKSDTELSEVIKIAVDRGHSRIPVY 234

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           KN++D   G+V+++D++ Y++      N+  L      ++ I++  +VP S  +++LLT 
Sbjct: 235 KNTIDEIIGVVYVKDLLGYLTK---PENDARL------ADFIRSPYYVPESKKINELLTE 285

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ ++ MA+V+DE+GGT GLV+ EDI+  ++ DI  E+ ++ S I  ++D   ++DAR 
Sbjct: 286 MKKKKVHMAIVLDEYGGTSGLVTIEDILEEIVGDIQDEYDTEPSQIEFINDKELLIDARV 345

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           D+++L +I+      L GE+D +++ G I   L  +P  GE  LE+ G  I++ ++    
Sbjct: 346 DIDDLNEIL---PEPLPGEEDYETISGFILHYLGYVPKTGE-ELELDGLHILVEESSKHQ 401

Query: 307 VRRVRIR 313
           +++VR++
Sbjct: 402 IKKVRLK 408


>gi|149914112|ref|ZP_01902644.1| hemolysin, putative [Roseobacter sp. AzwK-3b]
 gi|149812396|gb|EDM72227.1| hemolysin, putative [Roseobacter sp. AzwK-3b]
          Length = 296

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 140/261 (53%), Gaps = 20/261 (7%)

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           R DAS  G            +   R + ++D+ I +  I +V    +  E + +F   G 
Sbjct: 49  RSDASAAGAMP--------GLRNLRDMAVEDVAIPKADIVSVPVAISRDELVDVFRDSGM 100

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +PVY+ +LD P GMVH++D    + H +   ++       S   +++ +LFVP SM +
Sbjct: 101 TRLPVYEGTLDTPIGMVHLKDFA--LRHGFNGQSS-----AYSLKKMLRPLLFVPPSMPI 153

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNT 239
             LL  +Q  R  MALVIDE+GG DGLV+ ED++  ++ +I  EH   +       S  +
Sbjct: 154 GVLLQKMQTDRRHMALVIDEYGGVDGLVTIEDLIEQVVGEIEDEHDVDEDQYFVRESPGS 213

Query: 240 FIVDARTDLEELAKIIG---TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFE 296
           ++  A+T L+E     G   TD   +  E+++D+LGGL+F +L R+P RGEVV    G  
Sbjct: 214 YLAVAKTPLDEFQAETGLSLTDAEEVD-EEEIDTLGGLVFMLLGRVPVRGEVVEHPSGAS 272

Query: 297 IVILDADVRCVRRVRIRRLVH 317
           I ++DAD R ++R+R+R   H
Sbjct: 273 IEVIDADPRRIKRLRVRLPDH 293


>gi|84515224|ref|ZP_01002586.1| hemolysin, putative [Loktanella vestfoldensis SKA53]
 gi|84510507|gb|EAQ06962.1| hemolysin, putative [Loktanella vestfoldensis SKA53]
          Length = 307

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 137/239 (57%), Gaps = 14/239 (5%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            +L  R+ R++D+ + +  I AV    T  + +  F   G + +PVY  +LD P G+ ++
Sbjct: 71  GMLNLRRKRVEDVAVPKTDIVAVPLTITKDDLVNTFRDSGMTRLPVYDTTLDTPVGIANL 130

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D  +        T +++L       ++++ +LFVP SM +  LL  +Q  RI MALVID
Sbjct: 131 KD-FALRYGFNGGTADLDLR------DMLRPLLFVPPSMPLGVLLQKMQAERIHMALVID 183

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHH--SKKSMISAVSDNTFIVDARTDLEELAKIIG- 256
           E+GGTDGL++ ED++  ++ +I  EH     KS I       ++  ARTDLE+    IG 
Sbjct: 184 EYGGTDGLLTIEDLIEQVVGEIEDEHDIAEAKSWIME-KPGVYLAQARTDLEDFEAEIGM 242

Query: 257 --TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
             TD + +  E+++D+LGGL+  +   +PARGEV+    G E  ++DAD R ++R+R+R
Sbjct: 243 NLTDHDDID-EEEIDTLGGLVTMLSGHLPARGEVIQHPDGPEFEVVDADPRRIKRLRVR 300


>gi|260426111|ref|ZP_05780090.1| CBS domain protein [Citreicella sp. SE45]
 gi|260420603|gb|EEX13854.1| CBS domain protein [Citreicella sp. SE45]
          Length = 269

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 133/236 (56%), Gaps = 12/236 (5%)

Query: 82  LRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRD 141
           +  R++R++D+ I +  I AV D  T  E + +F + G + +PVY  +LD P GM H++D
Sbjct: 1   MNLRRMRVEDVAIPKADIVAVPDTITKPELVQVFRESGMTRLPVYSGTLDTPVGMAHLKD 60

Query: 142 VISYISHMYAKTNNINLNIQ-LSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDE 200
                   +A  +  N + Q      +++ ++FVP SM +  LLT +Q  R  MALVIDE
Sbjct: 61  --------FALRHGFNGSGQRFDLKKMLRPLVFVPPSMPIGVLLTKMQTERRHMALVIDE 112

Query: 201 HGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           +GG DGLV+ ED++  ++ +I  EH  ++          +++  A+T LEE     G   
Sbjct: 113 YGGVDGLVTIEDLIEQVIGEIEDEHDIAEGRNFFREKSGSWLALAKTPLEEFEGETGLAL 172

Query: 260 N--CLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                  E+++D+LGGL+F +   +PARGEV+    G +  ++DAD R ++R+R+R
Sbjct: 173 TDDDEIDEEEIDTLGGLVFMLAGHVPARGEVIPHPAGIDFEVVDADPRRIKRLRVR 228


>gi|85709120|ref|ZP_01040186.1| hemolysin [Erythrobacter sp. NAP1]
 gi|85690654|gb|EAQ30657.1| hemolysin [Erythrobacter sp. NAP1]
          Length = 287

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 145/250 (58%), Gaps = 11/250 (4%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
            S  G  S  E+++  N+L F +   DD+ + R  I AV+   +  + +  F ++G S M
Sbjct: 35  GSGNGDLSPVERQMLRNLLHFSEHDADDVAVPRGEIVAVDASISWDDLVAQFSQHGHSRM 94

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+ +LD+  GM+H++DV +Y++    KT   +  +      L++  L+VP +    D+
Sbjct: 95  PVYRETLDDVIGMIHIKDVFTYLA--KGKTGPRDWTV------LMRQPLYVPQARGALDV 146

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIV 242
           L +++  R+ +A+V+DE  GTDGL++ ED+V  ++ +I  EH  + +++I  + +  +  
Sbjct: 147 LADMRARRVHLAIVLDEFSGTDGLITIEDLVEEIVGEIEDEHDETPEALIVPIGEGMWDC 206

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           DAR +LE++A+++  D    +  + VD+LGGL F + +++P  G ++    G++I +   
Sbjct: 207 DARAELEDVAELV--DPRLAEVSEAVDTLGGLAFVLAEQVPPVGTMLDHSSGWKIEVTAG 264

Query: 303 DVRCVRRVRI 312
           D   V+R+R+
Sbjct: 265 DETHVKRLRL 274


>gi|163797133|ref|ZP_02191088.1| Hemolysins and related protein containing CBS domains [alpha
           proteobacterium BAL199]
 gi|159177649|gb|EDP62202.1| Hemolysins and related protein containing CBS domains [alpha
           proteobacterium BAL199]
          Length = 290

 Score =  135 bits (341), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (54%), Gaps = 16/233 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I  N+L  R I   D+M+ R  I  +E   ++ E   +  +   S MP+Y+ SLD+ 
Sbjct: 50  EGAIIRNVLGLRDITAYDVMVPRADIMGIEQSTSLAELARLMGEAAHSRMPIYRGSLDDV 109

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GMVH++DV+ ++          N    +  ++L + +LFV  S    DLL  ++ +R  
Sbjct: 110 IGMVHIKDVVGHL----------NRGEDVPVADLAREVLFVAPSSRALDLLQEMRMTRRH 159

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELA 252
           +ALV+DE+GG DGL++ ED+V  ++ +I+ EH   +   +    D T + DAR  +EE  
Sbjct: 160 LALVVDEYGGIDGLITIEDLVEEIVGEISDEHDVDEGPKLEEKPDGTILADARATVEEFE 219

Query: 253 KIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            ++G     L GE  +++D+LGGL+FS+  R+  RGEV+    G +  ++ AD
Sbjct: 220 ALVGP---VLTGEEREEIDTLGGLVFSLAGRVATRGEVIRHPSGLDFEVVAAD 269


>gi|119386402|ref|YP_917457.1| CBS domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119376997|gb|ABL71761.1| CBS domain containing protein [Paracoccus denitrificans PD1222]
          Length = 310

 Score =  135 bits (341), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 131/225 (58%), Gaps = 7/225 (3%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R+DD+ + +  I A    AT+ E + MF ++G S +PV++ +LD+P G++H+
Sbjct: 70  GMVNLRRMRVDDVAVPKAEIVAAPVTATLPELVEMFREHGFSRIPVFRGTLDSPLGLIHL 129

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+   + + +     +   ++ +   +++ +L+VP SM +  LL  +Q+ RI MALVID
Sbjct: 130 KDL--ALKYGF----GVKAPVKFALRPMLRPLLYVPPSMPIGVLLQQMQQKRIHMALVID 183

Query: 200 EHGGTDGLVSYEDIV-SVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GG DGLV+ ED++  V+          +  ++       +++ AR  LE++    G  
Sbjct: 184 EYGGVDGLVTIEDLIEQVIGEIEDEHDEIEGGLVIQEKPGQWLIQARAALEDVEAQTGLR 243

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
               + E+++D+LGGLIF +  R+P RGEV+    G E  I+DAD
Sbjct: 244 LATDEEEEEIDTLGGLIFMLTGRVPVRGEVIPHESGAEFEIVDAD 288


>gi|296282476|ref|ZP_06860474.1| hemolysin [Citromicrobium bathyomarinum JL354]
          Length = 312

 Score =  135 bits (341), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 140/251 (55%), Gaps = 11/251 (4%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           D+  +G  S  E+E+  N+L F +   DD+ I R  I AVE  A+  E + +F ++G S 
Sbjct: 62  DSHDDGDLSREEREMLRNLLHFSEHDADDVAIPRGEIVAVEAGASWEELLEVFTEHGHSR 121

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY+  LD   GM+H++DV  Y++      +          + L++  L+VP S    D
Sbjct: 122 LPVYREQLDEVIGMIHIKDVFPYLTGGKPAPSEW--------TTLMRQPLYVPQSRGALD 173

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-SVLMRDITSEHHSKKSMISAVSDNTFI 241
           +L +++  R+ +A+V+DE  GTDG+++ ED+V  ++          ++  I+ + D  + 
Sbjct: 174 VLADMRAKRMHLAIVVDEFSGTDGIITIEDLVEEIVGEIEDEHDDEREDWITPIGDGVWE 233

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           +DAR +LE++AK I  D    + E+ VD++GGL F + +++P  G  V    G+ I +++
Sbjct: 234 IDARAELEDIAKRI--DPALAEVEESVDTMGGLTFILAEQVPQVGTSVEHPNGWTIEVIE 291

Query: 302 ADVRCVRRVRI 312
            D   V++VR+
Sbjct: 292 GDETHVKKVRL 302


>gi|332188736|ref|ZP_08390449.1| transporter associated domain protein [Sphingomonas sp. S17]
 gi|332011242|gb|EGI53334.1| transporter associated domain protein [Sphingomonas sp. S17]
          Length = 301

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 142/258 (55%), Gaps = 13/258 (5%)

Query: 60  PRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG 119
           P  DA  +G  +  E+++  N+L F +    D+ + R  I AVE++ T    + +F + G
Sbjct: 51  PGPDA--KGDLTPLERQMVRNLLHFGERDAGDVGVPRADIIAVEERTTFDHLVQIFAEAG 108

Query: 120 RSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSML 179
            S +PVY+ +LD+  GMVH++DV + ++        I          LI++ L+VP S  
Sbjct: 109 HSRLPVYRETLDSIIGMVHIKDVFNILATGAEHPATI--------VGLIRDPLYVPMSRG 160

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDN 238
             DLL ++++ R+ +A+V+DE+ GT+GLV+ ED++  ++ +I  EH  + ++M+  +   
Sbjct: 161 ALDLLADMRQKRVHLAVVLDEYSGTEGLVTIEDLIEEIVGEIEDEHDEAPQAMLVPLDGG 220

Query: 239 TFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIV 298
            +  DAR  LEE+ + +  D    + E DVD+LGGL   +  ++P  G  +    G+ I 
Sbjct: 221 AWDADARVGLEEVGRAV--DPALEEAEDDVDTLGGLTAVLAGQVPPVGTCIDHPSGWRIE 278

Query: 299 ILDADVRCVRRVRIRRLV 316
           +  AD R + R+R+   V
Sbjct: 279 VTKADERRIHRLRLHPAV 296


>gi|87199001|ref|YP_496258.1| CBS [Novosphingobium aromaticivorans DSM 12444]
 gi|87134682|gb|ABD25424.1| CBS protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 313

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 145/263 (55%), Gaps = 9/263 (3%)

Query: 51  LSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE 110
           +  H+G   P  + + +G     E+++  N+L F +   DD+ I R  I AV   AT  E
Sbjct: 48  IDEHEG--EPHHEGASKGDLVPLERQMLRNLLHFSEHDADDVAIPRGEITAVPASATFEE 105

Query: 111 AMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKN 170
            +  F ++G S +PVY  SLD   GM+H++DV   ++ M         +     ++L++ 
Sbjct: 106 LISAFAEHGHSRLPVYGESLDEIVGMIHVKDVFGIVAGMALSGKAPPKDW----TSLMRQ 161

Query: 171 ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKK 229
            LFVP +    D+L +++ SR  +A+VIDE+ GTDG+++ ED+V  ++ +I  EH  + +
Sbjct: 162 PLFVPQARGALDVLADMRASRTHLAVVIDEYSGTDGIITIEDLVEEIIGEIEDEHDDAPE 221

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            +I  +  +T+  DAR +L+++A+ +  D    + E+DVD+LGGL   +   +P  G V+
Sbjct: 222 ELIRRIDPDTWDADARAELDDVAETV--DRRLAEVEEDVDTLGGLAVVLAGEVPPVGRVL 279

Query: 290 LEIPGFEIVILDADVRCVRRVRI 312
               G+ I +   D R + R+R+
Sbjct: 280 EHASGWRIEVTGGDERRLTRLRL 302


>gi|294676668|ref|YP_003577283.1| magnesium and cobalt efflux protein CorC [Rhodobacter capsulatus SB
           1003]
 gi|294475488|gb|ADE84876.1| magnesium and cobalt efflux protein CorC [Rhodobacter capsulatus SB
           1003]
          Length = 301

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 84  FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVI 143
            RK+R+ D+ + +  I AV       E + +F   G S +PV+K++LD+P G+VH++D+ 
Sbjct: 71  LRKMRVGDVAVPKAEIVAVPVTTPRDELVEVFRTQGYSRLPVFKDTLDSPMGLVHLKDL- 129

Query: 144 SYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGG 203
             ++H +          + S   L++ +L+VP SM +  LL  +Q  RI MALVIDE+GG
Sbjct: 130 -ALAHGFGGAPG-----RFSLRKLLRPLLYVPPSMPIGVLLQKMQLQRIHMALVIDEYGG 183

Query: 204 TDGLVSYEDIV-SVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCL 262
            DGLV+ ED++  V+          +  +        ++V ART L +    IG      
Sbjct: 184 VDGLVTLEDLIEQVIGEIEDEHDEEEDGLWKLEKPGQWLVQARTPLTDFEAEIGMKLADA 243

Query: 263 KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           +   ++D+LGGL+F  +DR+P RGEV++   G E  ++DAD
Sbjct: 244 EEGAEIDTLGGLVFMQIDRVPTRGEVIVAENGVEFEVVDAD 284


>gi|103487639|ref|YP_617200.1| CBS domain-containing protein [Sphingopyxis alaskensis RB2256]
 gi|98977716|gb|ABF53867.1| CBS domain protein [Sphingopyxis alaskensis RB2256]
          Length = 314

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 139/246 (56%), Gaps = 12/246 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  S  E+++  N+L F +  +DD+ + R  I A+ + A+  + + +F   G S +PVY+
Sbjct: 62  GDLSPIERKMLRNLLHFGEQTVDDVAVPRGEIIAIPETASFEDILAIFADAGHSRLPVYR 121

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLD   GM+H++DV + ++                  +L++  L+VP SM V DLL  +
Sbjct: 122 ESLDEVIGMIHVKDVFAVLAEKRPPPPL---------LDLLRQPLYVPQSMGVLDLLAEM 172

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDART 246
           +  R  +A+VIDE+ GT+GL++ ED+V  ++ +I  EH  + + +I A     + VDAR 
Sbjct: 173 RAKRTHLAIVIDEYSGTEGLLTIEDLVEEIVGEIEDEHDDEPEPLIVAGEGGCWEVDARA 232

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           +L++L + +  D    + E+DVD+LGGL   +   +P  GE+++   G+ I + DAD R 
Sbjct: 233 ELDDLGEAV--DPRLGEVEEDVDTLGGLAAVLAGHVPEVGEILVHPSGWRIEVTDADERR 290

Query: 307 VRRVRI 312
           V  +R+
Sbjct: 291 VHHLRL 296


>gi|89069597|ref|ZP_01156936.1| hemolysin, putative [Oceanicola granulosus HTCC2516]
 gi|89044795|gb|EAR50895.1| hemolysin, putative [Oceanicola granulosus HTCC2516]
          Length = 262

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 140/254 (55%), Gaps = 10/254 (3%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA   G            +   R++R++++ I +  I AV    T  E + +F + G + 
Sbjct: 10  DAPSNGASEPAAATALLGMANLRRMRVEEVSIPQADIVAVPVTTTKDELVSVFRESGMTR 69

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PV+  +LD P G V+++D    + H +   N    +I+     +++ +L+VP SM +  
Sbjct: 70  LPVFDGTLDTPVGFVNLKDFA--LKHGF-NGNGHEFDIR----PILRPLLYVPPSMPLGV 122

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMI-SAVSDNTFI 241
           LL  +Q  RI MALVIDE+GGTDGLV+ ED++  ++ DI  EH  +++   S      ++
Sbjct: 123 LLQKMQAERIHMALVIDEYGGTDGLVTIEDLLEQVVGDIEDEHDVEEARTWSRERPGVYL 182

Query: 242 VDARTDLEELAKIIGTDC--NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
             A+T L+E    IG     +    E+++D+LGGL+F +   +PARGE+V    G E  +
Sbjct: 183 ARAKTPLDEFEAAIGIPLTDHEEIDEEEIDTLGGLVFMLAGHVPARGEIVPHPAGPEFEV 242

Query: 300 LDADVRCVRRVRIR 313
           ++AD R ++R+R+R
Sbjct: 243 IEADPRRIKRLRVR 256


>gi|254450116|ref|ZP_05063553.1| CBS domain protein [Octadecabacter antarcticus 238]
 gi|198264522|gb|EDY88792.1| CBS domain protein [Octadecabacter antarcticus 238]
          Length = 292

 Score =  132 bits (333), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 137/237 (57%), Gaps = 10/237 (4%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            ++  R++R++D+MI +  I AV    +  + + +F   G + +PV+  +LD P G V++
Sbjct: 56  GMMNLRRMRVEDVMIPKADIVAVPVTISRNDLVQVFRDNGMTRLPVFDGTLDTPIGFVNL 115

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D  + +     K+   +L       +L + +LFVP SM +  LL  +Q  RI MALVID
Sbjct: 116 KD-FALMYGFNGKSKTFDLR------DLSRELLFVPPSMPLGVLLQKMQAERIHMALVID 168

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GGTDGLV+ ED++  ++ +I  EH + + ++        ++V+A+  L+E    IG  
Sbjct: 169 EYGGTDGLVTIEDLLEQVVGEIEDEHDTDEDALWVEEKPGVYMVEAKAPLDEFEAEIGMP 228

Query: 259 CN--CLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
                   E+++D+LGGL+F +   +PARGEV+    G E  +++AD R ++R+R+R
Sbjct: 229 LTEHEEIDEEEIDTLGGLVFMLAGHVPARGEVIQHPEGPEFEVVEADPRRIKRLRVR 285


>gi|85705231|ref|ZP_01036330.1| hemolysin, putative [Roseovarius sp. 217]
 gi|85670104|gb|EAQ24966.1| hemolysin, putative [Roseovarius sp. 217]
          Length = 295

 Score =  132 bits (331), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 134/241 (55%), Gaps = 13/241 (5%)

Query: 84  FRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVI 143
            R + ++D+ I +  I +V D  T  + + +F   G S +PVY  +LD P GM+H++D  
Sbjct: 63  LRHMAVEDVAIPKADIVSVPDTITKEDLVHVFRDSGMSRLPVYDGTLDTPTGMIHLKDFA 122

Query: 144 SYISHMY-AKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHG 202
             + H +   +    LN      ++++ +LFVP SM +  LL  +Q  R  MALVIDE+G
Sbjct: 123 --LKHGFNGGSEAFVLN------DMLRPLLFVPPSMPIGVLLQKMQAERRHMALVIDEYG 174

Query: 203 GTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS-DNTFIVDARTDLEELAKIIGTDCN- 260
           G DGLV+ ED++  ++ +I  EH   +     +     ++  A+T LE+    IG     
Sbjct: 175 GVDGLVTIEDLIEQVVGEIEDEHDIDEGQYWTLERPGCYVALAKTPLEDFEAEIGQSLTE 234

Query: 261 -CLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFK 319
                E+++D+LGGL+F +L R+P RGEV+    G  I +++AD R ++RVR+ RL   K
Sbjct: 235 SDEIDEEEIDTLGGLVFMLLGRVPVRGEVIEHPAGPVIEVMEADPRRIKRVRV-RLPEAK 293

Query: 320 N 320
           N
Sbjct: 294 N 294


>gi|317133643|ref|YP_004092957.1| protein of unknown function DUF21 [Ethanoligenens harbinense
           YUAN-3]
 gi|315471622|gb|ADU28226.1| protein of unknown function DUF21 [Ethanoligenens harbinense
           YUAN-3]
          Length = 455

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 135/251 (53%), Gaps = 13/251 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   E+EKE+ NN+  F      DIM  R  I+A E  A + E M +    G S +P+Y+
Sbjct: 200 GTIGESEKEMINNVFEFDDRIAADIMTHRTDISAAEITAPLEEVMQIALAEGYSRIPIYE 259

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           + LDN  G+V+++D++ Y+     K         L+  ++++  LFVP +    +L + +
Sbjct: 260 DDLDNIVGVVYVKDLLRYVGKPLEKA--------LAPKDVMRPPLFVPETKKCRELFSAL 311

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
              +  MA+VIDE+GGT G+V+ ED+V  ++ DI  E+  ++   S + ++ F ++   +
Sbjct: 312 TARKQHMAVVIDEYGGTSGIVTMEDLVESIVGDIQDEYDHEEEEFSVIDESNFFIEGTAN 371

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVRC 306
           LEE++ ++  +      E + D++ GLI   L  IP+ GE   +EI G    + + D R 
Sbjct: 372 LEEVSDLLEVELP----EGEYDTVAGLIIDRLGHIPSPGEHPSVEINGVVFTVEEVDERR 427

Query: 307 VRRVRIRRLVH 317
           + ++R  +L H
Sbjct: 428 IEKIRAHKLPH 438


>gi|320160274|ref|YP_004173498.1| hypothetical protein ANT_08640 [Anaerolinea thermophila UNI-1]
 gi|319994127|dbj|BAJ62898.1| hypothetical membrane protein [Anaerolinea thermophila UNI-1]
          Length = 431

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 143/251 (56%), Gaps = 16/251 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG   + E+E+  +I  F +    +IM+ R+ ++AVE +  + E + +  + G S +PVY
Sbjct: 176 EGSLDQDEREMIYSIFHFGEKLCREIMVPRIDMSAVEIQTPLEEVIQILTRTGHSRLPVY 235

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++ +D++           ++         N+++   FVP +  V DLL  
Sbjct: 236 EETVDNIIGLLYAKDLLKVRPEEGQTLESLR--------NILRPAYFVPEAKHVKDLLEE 287

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
           +QE RI MA+V+DE+GG  GLV+ EDIV  ++ +I  E+  S++     +S++ ++  AR
Sbjct: 288 MQEQRIHMAIVVDEYGGVAGLVTLEDIVEEIVGEIRDEYDQSEEQPYQKISEDEYLFQAR 347

Query: 246 TDLEELAKIIGTDCNCLKGEQDV-DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
            DL++  +I+GT       E+D+ D++GGL++ ++ ++P  GE V +I G  + +     
Sbjct: 348 IDLDDFNEIMGTHI-----EKDLADTIGGLMYGLIGQVPTGGETV-QIEGVLLKVEQVTG 401

Query: 305 RCVRRVRIRRL 315
           R +R+VR  R+
Sbjct: 402 RRIRKVRATRI 412


>gi|46201367|ref|ZP_00055179.2| COG1253: Hemolysins and related proteins containing CBS domains
           [Magnetospirillum magnetotacticum MS-1]
          Length = 279

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 130/233 (55%), Gaps = 12/233 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E+++  NIL  R +   D+M+ R  I AVE K ++   + +F   G S +PVY+ SLD
Sbjct: 37  EHERQLLGNILHLRDVTAYDVMVPRADIVAVEAKISLEGLIALFIDCGHSRLPVYRRSLD 96

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  GM+H++D++  +     K  N+          L + + FV  SM V+DLL  ++  R
Sbjct: 97  DVIGMIHIKDLLEVMGE--GKAFNL--------PRLARRVQFVAPSMRVTDLLLEMRLKR 146

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEE 250
             +ALV+DE+GG DGLV+ ED+V  ++ +I  EH   ++  ++   D T   D RT + E
Sbjct: 147 SHLALVVDEYGGIDGLVTIEDLVEQIVGEIEDEHDQDEEPELTLCDDGTVEADGRTPIAE 206

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
               +G      +  ++V++LGGL+  V  R+P+RGE++    G E  +LDAD
Sbjct: 207 FEDRMGAVLTEEE-REEVETLGGLVSFVAGRVPSRGELITHSAGLEFEVLDAD 258


>gi|294101754|ref|YP_003553612.1| protein of unknown function DUF21 [Aminobacterium colombiense DSM
           12261]
 gi|293616734|gb|ADE56888.1| protein of unknown function DUF21 [Aminobacterium colombiense DSM
           12261]
          Length = 428

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 142/249 (57%), Gaps = 14/249 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+++ + I+ F + R+ +IM+ R  INA+ + A++ +++ +F++YG S +PV+ 
Sbjct: 185 GVLEAVERKMIHGIISFEETRVYEIMVPRTDINAIANDASIGDSVAIFQEYGHSRIPVFD 244

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLD+  G+++ +D I Y+          +  I    S L ++ LFVP +M + D+   +
Sbjct: 245 ESLDDIVGILYAKDAIPYL---------FSGKIDEPVSKLKRDALFVPETMKIVDVFNIM 295

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  R+ MA+V+DE+GGT GLV+ ED++  ++ +I  E+  + + +   +   ++V A   
Sbjct: 296 KNRRVHMAIVVDEYGGTAGLVTLEDLLEEIVGEIQDEYDFETAPVLKETGGNYLVQANVS 355

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LE+L++ +          +D +S+GGL+ S+    P +G  +L+   +EI +LD +   +
Sbjct: 356 LEDLSETLAYPFES----EDAESVGGLVLSLTGGFPEKG-ALLQYGKWEIEVLDVEDHRI 410

Query: 308 RRVRIRRLV 316
           + +R   ++
Sbjct: 411 KLLRFHEVL 419


>gi|302391407|ref|YP_003827227.1| hypothetical protein Acear_0620 [Acetohalobium arabaticum DSM 5501]
 gi|302203484|gb|ADL12162.1| protein of unknown function DUF21 [Acetohalobium arabaticum DSM
           5501]
          Length = 428

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 143/251 (56%), Gaps = 15/251 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+ N+I  F    + +IMI R+ +  V+ + ++ + + +    G S +PVY
Sbjct: 183 EGVIESDEKEMINSIFDFDDTLVKEIMIPRIDMVCVDIETSIDDLVELIIDLGYSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
            +++DN  G+++ +D+++++          N         +++   +VP +  V  LLT 
Sbjct: 243 NDTVDNIVGILYAKDLLTFL----------NTEEPTELRKIMRPAYYVPETKEVDTLLTE 292

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ RI MA+V+DE+GGT GL++ ED++  ++ DI  E+  ++++I  +SD+  +VDAR 
Sbjct: 293 LRKERIHMAIVLDEYGGTAGLITIEDLLEEIVGDIQDEYDEEENLIEVISDDEILVDARI 352

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           D++E+ +++    N    E+D +++GG I S L  +P  GE  LE    +++I +   R 
Sbjct: 353 DIDEVNEVL----NIHLPEEDYETVGGFILSTLGYVPETGE-ELEFENLKLIIEETIQRR 407

Query: 307 VRRVRIRRLVH 317
           +  VRI+  V 
Sbjct: 408 ISEVRIKTKVE 418


>gi|225016301|ref|ZP_03705493.1| hypothetical protein CLOSTMETH_00204 [Clostridium methylpentosum
           DSM 5476]
 gi|224950976|gb|EEG32185.1| hypothetical protein CLOSTMETH_00204 [Clostridium methylpentosum
           DSM 5476]
          Length = 307

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 138/246 (56%), Gaps = 12/246 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  +++K + NNI  F  + ++D+M  RV I AV + A + +A+      G S +PVY
Sbjct: 62  EGVIEQSQKAMINNIFEFDDMTVEDVMTHRVDIVAVAEDAQISDAVYHAINDGFSRIPVY 121

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K  +DN  G+++++D++  +     +          S    I+ +L+VP +    DL   
Sbjct: 122 KEDIDNIIGIIYVKDLLCLVGCKAIE--------DFSLQQFIREVLYVPETTKCRDLFKQ 173

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
             E ++ +A+V+DE+GGT G+V+ ED++  ++ +I  E+  ++  I+ ++D T+ ++   
Sbjct: 174 FTEKKLHIAVVVDEYGGTAGIVTMEDLIESILGNIQDEYDDEEDEITKINDTTYTMEGSA 233

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
           D +++A I+G +   ++   D D++GG +   L RIP  GE  V+++ G E  +L  + R
Sbjct: 234 DWDDVADILGLE---VEENPDYDTVGGFLIDSLGRIPHEGEHPVVKVDGVEFTVLVVEER 290

Query: 306 CVRRVR 311
            + +VR
Sbjct: 291 HIAKVR 296


>gi|83313565|ref|YP_423829.1| hemolysin-like protein [Magnetospirillum magneticum AMB-1]
 gi|82948406|dbj|BAE53270.1| Hemolysins and related protein containing CBS domains
           [Magnetospirillum magneticum AMB-1]
          Length = 321

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 129/233 (55%), Gaps = 12/233 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E+++  NIL  R +   D+M+ R  I AVE K ++   + +F   G S +PVY+ SLD
Sbjct: 79  EHERQLLGNILHLRDVTAYDVMVPRADIVAVEAKTSLEALIALFIGCGHSRLPVYRRSLD 138

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  GMVH++D++  +     K  N+          L + + FV  SM V+DLL  ++  R
Sbjct: 139 DVIGMVHIKDLLEVMGE--GKPFNL--------PRLARRVQFVAPSMRVTDLLLEMRLKR 188

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI-VDARTDLEE 250
             +ALV+DE+GG DGLV+ ED+V  ++ +I  EH   +     + D+  +  D RT + E
Sbjct: 189 SHLALVVDEYGGIDGLVTIEDLVEQIVGEIEDEHDQDEEPELTLRDDGIVEADGRTPIAE 248

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
               +G      +  ++V++LGGL+  V  R+P+RGE++    G E  +LDAD
Sbjct: 249 FEDCMGAVLTEEE-REEVETLGGLVSFVAGRVPSRGELITHSAGLEFEVLDAD 300


>gi|221632068|ref|YP_002521289.1| magnesium and cobalt efflux protein corC [Thermomicrobium roseum
           DSM 5159]
 gi|221156691|gb|ACM05818.1| magnesium and cobalt efflux protein corC [Thermomicrobium roseum
           DSM 5159]
          Length = 420

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 134/239 (56%), Gaps = 14/239 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +   +LR  ++   DIM+ R  I AV  + +V +A+ +  +   S +PVY+ ++D   G+
Sbjct: 183 LIERVLRLDRLTARDIMVPRTDIVAVPFELSVRDAIAVARQTRHSRLPVYQGTIDRIVGI 242

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           VH+RD++ +          I +       ++++   F+P S  V +LL ++Q  R+ MA+
Sbjct: 243 VHVRDLLRF---ALESAEGIKVG------DVMREAYFIPESKRVDELLRDLQHQRVHMAI 293

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           V+DE GGT G+V+ ED++  ++ +I  E+ ++  ++  +S +  IVD R  LEE+A I G
Sbjct: 294 VVDEFGGTAGIVTIEDVLEEIVGEIQDEYDAEAPLVERLSADEAIVDGRISLEEIADIFG 353

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
                   E++  ++GGL+ + L RIP  GE V  + G E+ +L+     VR++ +RR+
Sbjct: 354 VSLE----EEESSTIGGLVQAHLGRIPQPGESV-RVDGLEVTVLEVAGNRVRKLSVRRV 407


>gi|58585066|ref|YP_198639.1| hemolysin [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419382|gb|AAW71397.1| Hemolysin TlyC, contains CBS domains [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 247

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 136/237 (57%), Gaps = 20/237 (8%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           IFN +L+F    I DIM  R  I AV+ +++ +E +   +    + + +YKN+ DN  G 
Sbjct: 19  IFNGLLKFHDCNIIDIMTPRTEICAVDIESSRHEIIKKVKGTCLTKILIYKNNFDNVIGF 78

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
            +++DV      ++++  N NL       +LI+N++FVP SM  + L   ++ S+  +A+
Sbjct: 79  FYIKDV------LFSENKNFNLR------SLIQNVIFVPPSMKTTSLFIRMRSSKSYLAV 126

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART---DLEELAK 253
           V+DE+GGTDGL+S  D++  L+ +I+SE+   + +I  +S N + V AR    D+EE  K
Sbjct: 127 VLDEYGGTDGLISMTDLMEELIPNISSENEPFEHVIVKLSQNKYEVSARAPVKDIEENLK 186

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
           I   D      E+D  +LGGLI S+  R+P+  E++    G + VI DA+ R + +V
Sbjct: 187 IELRD-----PEEDYATLGGLILSIAGRVPSVDEIIEYKSGVKFVIKDANERYINKV 238


>gi|225677444|ref|ZP_03788409.1| CBS domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590522|gb|EEH11784.1| CBS domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 272

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 141/248 (56%), Gaps = 22/248 (8%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           IFN +L+FR   I DIM  R  I AV+ +++  E +   +    + +P+YKN+ DN  G 
Sbjct: 43  IFNGLLKFRDCGIMDIMTPRTEICAVDIESSEREIIKKIKNTCHTKIPIYKNNFDNVIGF 102

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
            +++DVI      + +  N NL       ++I++++FVP SM  ++L   +  S+  +A+
Sbjct: 103 FYVKDVI------FNRDKNFNL------KHIIQSVIFVPPSMKTTNLFVRMNSSKSCLAI 150

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEELA 252
           V+DE+GGTDGL+S  D+V  L+ +I SE+  + +  I+ +S N F V AR    D+EE  
Sbjct: 151 VLDEYGGTDGLISMTDLVEELIPNIDSENEINSEYTITELSQNKFEVSARALIKDIEEDL 210

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           KI   D      E+D  +LGGLI S+  ++P+  EV+    G + +I DA+ R + ++ +
Sbjct: 211 KIELRD-----PEEDYVTLGGLILSIAGKVPSVDEVIKYKNGMKFIIKDANERYINKI-V 264

Query: 313 RRLVHFKN 320
             L  +KN
Sbjct: 265 LDLSDYKN 272


>gi|160933600|ref|ZP_02080988.1| hypothetical protein CLOLEP_02454 [Clostridium leptum DSM 753]
 gi|156867477|gb|EDO60849.1| hypothetical protein CLOLEP_02454 [Clostridium leptum DSM 753]
          Length = 449

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 125/221 (56%), Gaps = 12/221 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+   + K++  NI  F    + +IM  R  + AVED +++ EA+ +  + G S +PVY
Sbjct: 202 KGVIQNSAKDMIANIFEFDDTTVTEIMTHRTDMTAVEDTSSISEAVNLSIENGYSRIPVY 261

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
              LD+  G+V+++D++ Y+     +   +        +++++   F+P +   S+L   
Sbjct: 262 HEDLDDIVGIVYVKDLLKYVCSQMPEETKL--------TDVMRGASFIPETKRCSELFAE 313

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +  S+ +MA+++DE+GGT+GLV+ ED+V  ++ +I  E+ +++  I  V+DNTF VD   
Sbjct: 314 MTASKTQMAIIVDEYGGTEGLVTMEDLVEAIVGNIQDEYDNEEEEIHKVNDNTFTVDGTA 373

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            ++E++ ++G        E D D++ GL+   L  IP  GE
Sbjct: 374 SIDEISDLLGITF----PEGDYDTVSGLVIEYLGHIPKPGE 410


>gi|206900981|ref|YP_002251039.1| GldE [Dictyoglomus thermophilum H-6-12]
 gi|206740084|gb|ACI19142.1| GldE [Dictyoglomus thermophilum H-6-12]
          Length = 377

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 142/239 (59%), Gaps = 15/239 (6%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           + +N+L F    + +IM+ R+ +  V   + + E      + G S +PVY+ S+DN  G+
Sbjct: 138 LISNVLEFTDTEVHEIMVPRIDMVCVSVDSPLKEVWKKIIEEGHSRIPVYEGSIDNIVGI 197

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           VH +DV+  ++    K  N+ +       ++++++++VP +M +++L   +++ +  +A+
Sbjct: 198 VHAKDVLKALAE---KDPNVKI------KDILRDVIYVPENMKINELFNEMRKKKAHLAI 248

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           V+DE+GGT GLV+ ED++  L+ +I  E+  +++  + + +NT IVDA+ ++ EL  I+ 
Sbjct: 249 VVDEYGGTAGLVTLEDVLEELVGEIEDEYDKEENKFNFLDENTLIVDAKMNIYELNDILE 308

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
                   E + D+LGGLI  +L+R+P+RGE   +I   +++I+   +  VRR RI ++
Sbjct: 309 ETWGITLPETEYDTLGGLILDLLNRVPSRGE---QIDLGDLIIV---IESVRRQRIEKV 361


>gi|95113899|gb|ABF55496.1| OrpB [Wolbachia endosymbiont of Drosophila yakuba]
 gi|95113902|gb|ABF55498.1| OrpB [Wolbachia endosymbiont of Drosophila teissieri]
 gi|95113905|gb|ABF55500.1| OrpB [Wolbachia endosymbiont of Drosophila santomea]
          Length = 272

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 141/248 (56%), Gaps = 22/248 (8%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           IFN +L+FR   I DIM  R  I AV+ +++  E +   +    + +P+YKN+ DN  G 
Sbjct: 43  IFNGLLKFRDCGIMDIMTPRTEICAVDIESSEREIIKKIKNTCHTKIPIYKNNFDNVIGF 102

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
            +++DVI      + +  N NL       ++I++++FVP SM  ++L   +  S+  +A+
Sbjct: 103 FYVKDVI------FNRDKNFNL------KHIIQSVIFVPPSMKTTNLFVRMNSSKSCLAI 150

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEELA 252
           V+DE+GGTDGL+S  D++  L+ +I SE+  + +  I+ +S N F V AR    D+EE  
Sbjct: 151 VLDEYGGTDGLISMTDLIEELIPNIDSENEINSEYTITELSQNKFEVSARALIKDIEEDL 210

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           KI   D      E+D  +LGGLI S+  ++P+  EV+    G + +I DA+ R + ++ +
Sbjct: 211 KIELRD-----PEEDYVTLGGLILSIAGKVPSVDEVIKYKNGMKFIIKDANERYINKI-V 264

Query: 313 RRLVHFKN 320
             L  +KN
Sbjct: 265 LDLSDYKN 272


>gi|42520837|ref|NP_966752.1| CBS domain-containing protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58698980|ref|ZP_00373833.1| CBS domain protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|99035009|ref|ZP_01314808.1| hypothetical protein Wendoof_01000368 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225630690|ref|YP_002727481.1| CBS domain protein [Wolbachia sp. wRi]
 gi|42410577|gb|AAS14686.1| CBS domain protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58534497|gb|EAL58643.1| CBS domain protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|95113890|gb|ABF55490.1| OrpB [Wolbachia endosymbiont of Drosophila simulans]
 gi|95113893|gb|ABF55492.1| OrpB [Wolbachia endosymbiont of Drosophila simulans]
 gi|95113896|gb|ABF55494.1| OrpB [Wolbachia endosymbiont of Drosophila simulans]
 gi|95113908|gb|ABF55502.1| OrpB [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|95113911|gb|ABF55504.1| OrpB [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|225592671|gb|ACN95690.1| CBS domain protein [Wolbachia sp. wRi]
          Length = 272

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 141/248 (56%), Gaps = 22/248 (8%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           IFN +L+FR   I DIM  R  I AV+ +++  E +   +    + +P+YKN+ DN  G 
Sbjct: 43  IFNGLLKFRDCGIMDIMTPRTEICAVDIESSEREIIKKIKNTCHTKIPIYKNNFDNVIGF 102

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
            +++DVI      + +  N NL       ++I++++FVP SM  ++L   +  S+  +A+
Sbjct: 103 FYVKDVI------FNRDKNFNL------KHIIQSVIFVPPSMKTTNLFVRMNSSKSCLAI 150

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEELA 252
           V+DE+GGTDGL+S  D++  L+ +I SE+  + +  I+ +S N F V AR    D+EE  
Sbjct: 151 VLDEYGGTDGLISMTDLIEELIPNIDSENEINSEYTITELSQNKFEVSARALIKDIEEDL 210

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           KI   D      E+D  +LGGLI S+  ++P+  EV+    G + +I DA+ R + ++ +
Sbjct: 211 KIELRD-----PEEDYVTLGGLILSIAGKVPSVDEVIKYKNGMKFIIKDANERYINKI-V 264

Query: 313 RRLVHFKN 320
             L  +KN
Sbjct: 265 LDLSDYKN 272


>gi|58697354|ref|ZP_00372693.1| CBS domain protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536260|gb|EAL59789.1| CBS domain protein [Wolbachia endosymbiont of Drosophila simulans]
          Length = 247

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 141/248 (56%), Gaps = 22/248 (8%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           IFN +L+FR   I DIM  R  I AV+ +++  E +   +    + +P+YKN+ DN  G 
Sbjct: 18  IFNGLLKFRDCGIMDIMTPRTEICAVDIESSEREIIKKIKNTCHTKIPIYKNNFDNVIGF 77

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
            +++DVI      + +  N NL       ++I++++FVP SM  ++L   +  S+  +A+
Sbjct: 78  FYVKDVI------FNRDKNFNL------KHIIQSVIFVPPSMKTTNLFVRMNSSKSCLAI 125

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEELA 252
           V+DE+GGTDGL+S  D++  L+ +I SE+  + +  I+ +S N F V AR    D+EE  
Sbjct: 126 VLDEYGGTDGLISMTDLIEELIPNIDSENEINSEYTITELSQNKFEVSARALIKDIEEDL 185

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           KI   D      E+D  +LGGLI S+  ++P+  EV+    G + +I DA+ R + ++ +
Sbjct: 186 KIELRD-----PEEDYVTLGGLILSIAGKVPSVDEVIKYKNGMKFIIKDANERYINKI-V 239

Query: 313 RRLVHFKN 320
             L  +KN
Sbjct: 240 LDLSDYKN 247


>gi|269925137|ref|YP_003321760.1| CBS domain containing protein [Thermobaculum terrenum ATCC BAA-798]
 gi|269788797|gb|ACZ40938.1| CBS domain containing protein [Thermobaculum terrenum ATCC BAA-798]
          Length = 434

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 142/241 (58%), Gaps = 15/241 (6%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++   ILRF  I   ++M+ R  I AV+    +  A+ +  + G S +PVY+ SLDN  
Sbjct: 194 RDMIAGILRFGDIAAHEVMVPRPDIVAVDVNTDLRTALDLALEKGHSRLPVYEESLDNVV 253

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+V+++D    ++     ++N++L       +L +  +F+P S  + +LL   Q S++ M
Sbjct: 254 GIVYLKD----LARAIVSSSNVSLR------DLARPAVFIPESKRLGELLQEFQSSKVHM 303

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+V+DE+GGT GL++ EDI+  ++ +I  E+  +   I  +S++ +I+ A+ DL+++ ++
Sbjct: 304 AIVVDEYGGTAGLITIEDILEEIVGEIQDEYDVELPDIEKISEDEWIIRAKIDLDDVNEL 363

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
           +G         ++ D+LGG I + L+R+P  G+ V E+ G  + +LD + R V RV ++R
Sbjct: 364 LGIHLPA----EEYDTLGGFITAQLERLPVPGDEV-EVEGVLMKVLDIEKRRVGRVLVKR 418

Query: 315 L 315
           L
Sbjct: 419 L 419


>gi|313680089|ref|YP_004057828.1| hypothetical protein Ocepr_1198 [Oceanithermus profundus DSM 14977]
 gi|313152804|gb|ADR36655.1| protein of unknown function DUF21 [Oceanithermus profundus DSM
           14977]
          Length = 456

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 149/274 (54%), Gaps = 13/274 (4%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           +RAL    +   L     ++L    A   G   E E+++  N+L   + ++ +IM+ RV 
Sbjct: 182 LRALGLEPRQQPLVTEDELKLILSGAEASGAIEEAEEDMIQNVLELEETQVREIMVPRVD 241

Query: 99  INAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL 158
           I A+E  A++ E + +  ++  S +PVY+ S+D   G+ + +D+++Y+          +L
Sbjct: 242 IVAIEHTASLREFVRLEREHRYSRIPVYQESIDQIVGIAYAKDLLNYL-------ETPDL 294

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM 218
             QL+  +L ++  FVP SM V +LL  I+  ++ MA+V+DE GGT GLV+ EDI+  ++
Sbjct: 295 LDQLTVMSLAQDPFFVPESMPVWNLLLEIRRRKVHMAIVVDEFGGTAGLVTLEDIIEEIV 354

Query: 219 RDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
            +I  E    ++  I   +D +F++DA+T L+++++ +G     +  E + ++L G ++ 
Sbjct: 355 GEIYDETDVEEEQPIQVQADGSFLIDAQTPLDDVSEALG----VVLPEGEYETLSGYLYE 410

Query: 278 VLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
               IP  GE      G+  ++  AD R + RVR
Sbjct: 411 TFGYIPKVGE-EHTYDGYRFIVEAADERKIERVR 443


>gi|88607215|ref|YP_504658.1| putative hemolysin [Anaplasma phagocytophilum HZ]
 gi|88598278|gb|ABD43748.1| putative hemolysin [Anaplasma phagocytophilum HZ]
          Length = 289

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 134/246 (54%), Gaps = 17/246 (6%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVE-DKATVYEAMLMFEKYGRSWMPVYK 127
           IF      I  N++ F    + +IM+ R  I A   D + +  ++L   K   + +PVYK
Sbjct: 48  IFGFNCFNIMGNLVSFDDCSLQEIMVQRSEIRAFAIDDSDLVNSVL---KSQHTRVPVYK 104

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++LDN  G +H+RD++             + N++    ++I+++++VP SM    L   +
Sbjct: 105 DNLDNIVGFIHIRDIL--------MKGGSDFNVK----DVIRDVIYVPHSMKAVSLFVKM 152

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           Q SR+ MA+V+DE+G TDGLV+ EDI+  ++ DI  E+  +    I  +SDNT  V+AR 
Sbjct: 153 QSSRVHMAIVLDEYGSTDGLVTMEDIIEPIVGDIEYENDETAIPDIVNISDNTIEVNARV 212

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +  L + +G        E+D D++GGLIF+++ R+P   EV     G    I +AD RC
Sbjct: 213 LVRTLERTLGVVLRDSSAEEDYDTVGGLIFAMVGRVPVVDEVFQHKSGAVFTIKEADNRC 272

Query: 307 VRRVRI 312
           + RV I
Sbjct: 273 IYRVII 278


>gi|309388933|gb|ADO76813.1| protein of unknown function DUF21 [Halanaerobium praevalens DSM
           2228]
          Length = 419

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 126/221 (57%), Gaps = 12/221 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  ETE+E+  ++  F    + +IMI R+ I  +E  A++ E + +  + G S +PV+
Sbjct: 175 EGVIKETEQEMIQSVFEFDDTLVKEIMIPRIDIICIEKNASLTELIKLGVEKGHSRIPVF 234

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S+DN  G+++++D++  +     K   I           +K I F+P    ++ LL+ 
Sbjct: 235 EESIDNIIGLIYIKDLLELLLAE-EKVVTI--------EEFVKPIYFIPEGKPINQLLSE 285

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++E +  MA+V+DE+GGT GL++ ED++  ++ DI  E   +KS I  + DN  ++D R 
Sbjct: 286 MKERKEHMAIVVDEYGGTSGLITIEDLLEEIVGDIQDEFDLEKSYIEVIDDNKLLIDGRV 345

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +++EL K + T    L    D +++ GLI   L+R+P +GE
Sbjct: 346 NIDELNKYLPT---SLVESDDYETVSGLILYYLNRLPVQGE 383


>gi|217967708|ref|YP_002353214.1| protein of unknown function DUF21 [Dictyoglomus turgidum DSM 6724]
 gi|217336807|gb|ACK42600.1| protein of unknown function DUF21 [Dictyoglomus turgidum DSM 6724]
          Length = 425

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 127/211 (60%), Gaps = 9/211 (4%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           + NN+L F    + +IM+ R+ +  V   + + E      + G S +PVY+ S+DN  G+
Sbjct: 186 LINNVLEFTDTEVHEIMVPRIDMVCVSVDSPLKEVWRKIIEEGHSRIPVYEGSIDNIVGI 245

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           VH +DV+  ++    K  NI +       ++++++++VP +M +++L   +++ +  +A+
Sbjct: 246 VHAKDVLKALAE---KDPNIKV------RDILRDVIYVPENMKINELFNEMRKKKAHLAI 296

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           V+DE+GGT GLV+ ED++  L+ +I  E+  +++  + + +NT +VDA+ ++ EL  I+ 
Sbjct: 297 VVDEYGGTAGLVTLEDVLEELVGEIEDEYDKEENKFNFIDENTLVVDAKINIYELNDILE 356

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
                   + + D+LGGLI  +L+R+P+RGE
Sbjct: 357 EAWGMTLPKTEYDTLGGLILDLLNRVPSRGE 387


>gi|302342488|ref|YP_003807017.1| CBS domain containing protein [Desulfarculus baarsii DSM 2075]
 gi|301639101|gb|ADK84423.1| CBS domain containing protein [Desulfarculus baarsii DSM 2075]
          Length = 290

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 133/244 (54%), Gaps = 10/244 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G  S  E E+   +L   +     IM+ R+ I  V + A+V EA+ +  + G S +P++
Sbjct: 42  QGFISADEGEMIEAVLDLAETTAGQIMVPRIDIATVAESASVEEAIRVIIESGHSRIPLH 101

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
              LD+  G+VH +D++ +       +  +NL        + +   FVP SM V+ L+  
Sbjct: 102 GADLDHIHGIVHAKDLLPFWGR---PSEEVNL------LRICRKPFFVPLSMSVNRLMAE 152

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ R  +A+V+DE+GGT G+V+ ED++  ++ +I  E+  ++ M+    D   ++DAR 
Sbjct: 153 FRKRRAHLAVVVDEYGGTAGIVTMEDVLEEIVGEIVDEYDQEQPMLEEQPDGALLLDARL 212

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           ++E+LA  +G +      E   +++GGLI + L R+P  GE ++  P   +VI +AD R 
Sbjct: 213 EVEDLADHLGVELPTELPEGRFETMGGLITTALGRVPKVGEEIVVGP-LRMVIKEADERR 271

Query: 307 VRRV 310
           V ++
Sbjct: 272 VTKI 275


>gi|288574807|ref|ZP_06393164.1| protein of unknown function DUF21 [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570548|gb|EFC92105.1| protein of unknown function DUF21 [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 425

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 137/248 (55%), Gaps = 14/248 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   E+E+ + + I+ F   ++ ++M+ R+ ++ V+   T+ E +   E++G S +P+Y+
Sbjct: 182 GALEESERRMIHGIISFEDTKVSEVMVPRIDMDVVDSDITIEELIPHLEEHGHSRIPIYE 241

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +SLD+  G+++++D+I     +Y+    + L      ++L ++ LFVP +M V DL   +
Sbjct: 242 DSLDDIIGILYVKDLIGL---LYSGKTEVKL------ASLKRDALFVPETMKVPDLFNIM 292

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  RI MA+V+DE+GGT G+++ ED++  ++ +I  E+  +   I  V +  + V    D
Sbjct: 293 KSRRIHMAVVVDEYGGTAGIITLEDLLEEIVGEIQDEYDHELPAIEEVEEGVYQVQGNMD 352

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LE+L+  +G         +DV+S+GGLI  +    P  G  V   P +E  +L      V
Sbjct: 353 LEDLSDFLGYPFES----EDVESVGGLITDLSGDFPGTGSSVTYGP-WEFTVLSLADHRV 407

Query: 308 RRVRIRRL 315
             V +R++
Sbjct: 408 MEVELRKI 415


>gi|328953265|ref|YP_004370599.1| CBS domain containing protein [Desulfobacca acetoxidans DSM 11109]
 gi|328453589|gb|AEB09418.1| CBS domain containing protein [Desulfobacca acetoxidans DSM 11109]
          Length = 291

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 137/248 (55%), Gaps = 14/248 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  +  E E+  +I  F+     +IM+ RV I  +     +++ + +  K G S +PVY+
Sbjct: 46  GFITRQEGEMIESIFEFKDTLAREIMVPRVDITCISQDDPIHQIIAVILKRGHSRLPVYQ 105

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           N++DN +G++  +D++ +        N    +I+L+   +++   F+P +  + DL  + 
Sbjct: 106 NNIDNIKGILLAKDLLVF-------WNKPESDIELT--TVLRPAFFIPEAKKIIDLFRDF 156

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            E +I++A+VIDE+GGT GL++ EDI+  ++ +I  E+ +++  +    D + IVDAR D
Sbjct: 157 VEKKIQIAIVIDEYGGTSGLITIEDILEEIVGEIYDEYDTQEPRLLPQDDQSVIVDARLD 216

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +E L +  G +      E + +S+GGL+   L ++P   + V+     E   + AD R V
Sbjct: 217 IEHLTEHFGVEVP----EGEFESVGGLMIHHLGKVPQVNDTVV-TQDLEFTAIAADERRV 271

Query: 308 RRVRIRRL 315
           +++R+R L
Sbjct: 272 KKIRVRAL 279


>gi|258593367|emb|CBE69706.1| CBS domain protein [NC10 bacterium 'Dutch sediment']
          Length = 440

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 133/246 (54%), Gaps = 14/246 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +GIF +TE+E+ +++  F +  + ++MI R  I A+E    + E +    + G S  P+Y
Sbjct: 202 QGIFDQTEQELIHSVFEFTETSVKEVMIPRPQIEAIELDTPLAEVLKFVVETGYSRYPIY 261

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             SLD+  G++H +D++     +  +   I+L        +     FVP +M VS LL  
Sbjct: 262 HKSLDDICGILHYKDLL----RLQLEDREISLK------TITHPAYFVPETMQVSQLLKE 311

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  R+ MA+V+DEHGG DGLV+ ED++  ++ +I  E+ + +  +  + D + I+DA  
Sbjct: 312 LQRRRLSMAIVVDEHGGVDGLVAMEDLLEEIVGEIHDEYEATEKPVEHLRDGSLIIDASL 371

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           ++++L    G            ++L G + + L RIP  G+++    G ++ I+D + R 
Sbjct: 372 NIKDLHDEYGLP---FPESPTYETLAGFMLTQLQRIPKGGDII-TYQGKKLTIVDMEGRR 427

Query: 307 VRRVRI 312
           + R+++
Sbjct: 428 IARIKV 433


>gi|46446689|ref|YP_008054.1| hypothetical protein pc1055 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46400330|emb|CAF23779.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 457

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 149/248 (60%), Gaps = 17/248 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           +K++   ++ F+     ++M+ RV I ++    T+ +A ++    G S +PV+K++LDN 
Sbjct: 209 DKKLIEGVMDFKDRIAREVMVPRVDIFSLAHDTTIEQAAVLIYNEGYSRIPVFKHTLDNI 268

Query: 134 RGMVHMRDVISYISHM-YAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G++  +DV++   +M +++T +  + +Q   S L+KN+L+ P +  +S LL   ++ ++
Sbjct: 269 IGVLMYKDVLA--KYMEFSRTQDTKI-LQAPISGLVKNVLYTPETKKISHLLQEFRKKQV 325

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART---DL 248
            +A+++DE+GGT+G+V+ EDI+  ++ DI  E+  S++S+  A+ +  +++DAR    D+
Sbjct: 326 HLAIIVDEYGGTEGIVTIEDILEEIVGDIADEYDESEESLFVALPEGGWLIDARMTIFDI 385

Query: 249 EELAKI-IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           EE   I I  D        D D++GG IF     IP++G  VL  P FE+ ++ ++ R V
Sbjct: 386 EEQFDIEIAQDG-------DYDTIGGYIFHETGNIPSKG-FVLTKPNFELKVIRSNDRRV 437

Query: 308 RRVRIRRL 315
            +++IR +
Sbjct: 438 EKLKIRSI 445


>gi|282858167|ref|ZP_06267362.1| CBS/transporter domain protein [Pyramidobacter piscolens W5455]
 gi|282584089|gb|EFB89462.1| CBS/transporter domain protein [Pyramidobacter piscolens W5455]
          Length = 421

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 133/247 (53%), Gaps = 14/247 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   E+E+++ + ++ F +IR+ +IMI R  ++ +E + TV +A+   EK G S +PV+ 
Sbjct: 182 GAIEESERQMIDGVISFDEIRVSEIMIPRTRMHMIESERTVDDALQFIEKMGDSRVPVFT 241

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++ D   G+V ++D+++ +  M  + N          +  ++  LFVP +M V  L   +
Sbjct: 242 DTPDRIEGIVLVKDLLTAL--MKGQKNA-------PVTKFMRTPLFVPETMYVPKLFRIM 292

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  R+ MA+V+DE+GGT GL++ ED++  ++ +I  E+  ++  ++ +SD T+   A   
Sbjct: 293 QNVRMHMAVVVDEYGGTAGLITLEDLLEEIVGEIQDEYDKEEQTVTPLSDGTYRAKASIP 352

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LEEL  ++ +   C     DVD+LGG +       P  G+  L   G+   I   D   +
Sbjct: 353 LEELNDVLNSHFVC----DDVDTLGGFLLDRFGNFPHEGD-TLASDGWLFEIASMDGHRI 407

Query: 308 RRVRIRR 314
             V IRR
Sbjct: 408 NDVMIRR 414


>gi|325278962|ref|YP_004251504.1| gliding motility-associated protein GldE [Odoribacter splanchnicus
           DSM 20712]
 gi|324310771|gb|ADY31324.1| gliding motility-associated protein GldE [Odoribacter splanchnicus
           DSM 20712]
          Length = 431

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 140/244 (57%), Gaps = 16/244 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINA--VEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           EK+I   I+RF  I   DI+  R++I A  +ED   V + +++  ++G S +PVY+ +LD
Sbjct: 200 EKDILEGIVRFSNIAAIDIIRPRINIIALDIEDSFEVVKNVVI--EHGYSRLPVYRENLD 257

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
              G+++++D+++   H+    N        +  +LI+   FVP +  ++DLL   Q  +
Sbjct: 258 TIEGILYVKDLLA---HLKEPQN-------FAWQSLIRPAYFVPETKKINDLLEEFQVKK 307

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
           + MA+++DE+GGT G+V+ EDI+  ++ +I  E+  K+   + +S+NT+I +A T L + 
Sbjct: 308 VHMAIIVDEYGGTSGIVTMEDILEEIVGEINDEYDEKEETYTKLSNNTYIFEACTLLNDF 367

Query: 252 AKIIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
            KI+  D +  K  E + D+L GLI  +   +P + +V+      +  IL+ D R ++++
Sbjct: 368 IKIVDADPDSFKDIEGEADTLAGLILEIKGELPGKNDVI-TYQSHKFTILEVDNRRIKKI 426

Query: 311 RIRR 314
           +  +
Sbjct: 427 KYEK 430


>gi|188996331|ref|YP_001930582.1| protein of unknown function DUF21 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931398|gb|ACD66028.1| protein of unknown function DUF21 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 434

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 129/247 (52%), Gaps = 14/247 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           I SE E E+  N     +I I +IM+ R  I AVE   +V E   + E    S +PVY++
Sbjct: 191 ILSEEETELIFNTFELSEISITEIMVPRRDIFAVEKGISVKELAKILEGKDYSKIPVYED 250

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           +LDN  G+++++D++  I     K   I+        + IK ILF+P    V D +    
Sbjct: 251 NLDNVVGVIYLKDILFLIYE--GKEEKID--------SFIKAILFLPEFTTVLDAMKKFN 300

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
           ES+  +A+V+DEHG T GL++Y+D++  ++ DI  E+  +++ I  +SDN +IV  + D+
Sbjct: 301 ESKQNIAIVVDEHGTTVGLITYKDLIETIVGDIPEEYEPEEATIKQISDNVWIVSGKEDV 360

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
             L   +G     L  + D D++ G I   L R P   E  + +  ++  +++     + 
Sbjct: 361 AFLTDELGI---VLPEDYDYDTIAGFILDYLKRFPEENEEFI-VQDYKFKVIEMSSNRIE 416

Query: 309 RVRIRRL 315
           +V I RL
Sbjct: 417 KVMIERL 423


>gi|325105651|ref|YP_004275305.1| protein of unknown function DUF21 [Pedobacter saltans DSM 12145]
 gi|324974499|gb|ADY53483.1| protein of unknown function DUF21 [Pedobacter saltans DSM 12145]
          Length = 446

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 136/249 (54%), Gaps = 14/249 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E E+  N+  F +  + +IM+ R  I A+E  AT  E + +  + G S +PVY 
Sbjct: 203 GALDNAEHELIQNVFEFNERVVKNIMVPRTKIVAIEQSATQEELLNLIVEEGYSRIPVYA 262

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            S+D   G+VH +D++S ++   +KTN I         N+I+   FVP S  +++LLT +
Sbjct: 263 ESIDQIVGIVHAKDILSLLA---SKTNFIL-------ENIIRKPFFVPESKKINNLLTEL 312

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  ++++A+V+DE GGT G+V+ EDIV  L+ +I  E+  +K ++  VS + +IV A   
Sbjct: 313 KLKKMQIAIVLDEFGGTAGMVTLEDIVEELVGEIQDEYDEEKPIVEKVSSSEYIVSASAT 372

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + +  + +  D   L  ++D D++ GL+  +  +IP  GE  +   G+   IL    + +
Sbjct: 373 VYDANEFLPHD---LPEDEDYDTIAGLVSEIFGKIPDVGETQI-FNGYNFTILKKVGQNI 428

Query: 308 RRVRIRRLV 316
             V++  ++
Sbjct: 429 ETVKLELVI 437


>gi|73666644|ref|YP_302660.1| CBS/transport-associated domain-containing protein [Ehrlichia canis
           str. Jake]
 gi|72393785|gb|AAZ68062.1| CBS domain:Transporter associated domain [Ehrlichia canis str.
           Jake]
          Length = 295

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 133/247 (53%), Gaps = 24/247 (9%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW---MPVYKNS 129
           T   +F+N+++F    + D+MI R  I A+ D   V  +  + +K  R     +P Y+++
Sbjct: 52  TNSRMFHNLIKFNDCLVRDVMIPRTEIYAI-DITDVPNSKDLIDKVIRGQYTRIPAYESN 110

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           LDN  G +H++D+IS            N + + +  N+I+ ++++P SM   +L   +Q 
Sbjct: 111 LDNIIGFIHIKDIIS------------NFHNEFNARNIIREVMYIPPSMKAVNLFIKMQS 158

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR--- 245
           S I +A+VIDE+GGT+GLV+  D++  ++ DI  EH +     I  +SDN   V+AR   
Sbjct: 159 SHIHVAIVIDEYGGTEGLVTMADLIEEVVGDIGDEHDAPTVPSIVNLSDNKVEVNARILV 218

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            DLEE   I   DC     E D  ++GGLI S++ R+P   E+     G    I +AD R
Sbjct: 219 KDLEETFNIDLRDCK----EDDYVTIGGLILSMIGRVPVANEIFEHKSGVIFSIKEADDR 274

Query: 306 CVRRVRI 312
           C+ ++ I
Sbjct: 275 CIYKIII 281


>gi|331084075|ref|ZP_08333182.1| hypothetical protein HMPREF0992_02106 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330402437|gb|EGG82007.1| hypothetical protein HMPREF0992_02106 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 463

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 141/254 (55%), Gaps = 10/254 (3%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA  +G+  E E E+  NI+ F +    DIM  R +++A+E+   + +A+        S 
Sbjct: 201 DAHEQGVIEENEAEMIQNIMEFSETEAQDIMTHRKNLHAIEENTLLKDALSYMLDNSNSR 260

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY+  +DN  G++H++DV+  I+    +  N+ +    S  NL++  ++VP +  ++D
Sbjct: 261 YPVYREDIDNIIGILHLKDVMRQIT--LPECENLPIG---SIPNLVREAVYVPETRSIND 315

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           L   +Q  +I + +V+DE+G T G+V+ EDI+  ++ +I  E+   ++ I   +D + ++
Sbjct: 316 LFKRMQAKKIHLVVVVDEYGQTSGIVTMEDILEEIVGNILDEYDEDENFIQLQNDQSLVM 375

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILD 301
           +  T LE++  ++ +D +    E++ D+L G + S+L  +P   E   ++  G+   IL 
Sbjct: 376 NGLTPLEQVDDVLNSDFD----EEEFDTLNGYLTSLLGHVPNMAEDKEIKAKGYLFTILA 431

Query: 302 ADVRCVRRVRIRRL 315
            +   +++VR+ +L
Sbjct: 432 VENNTIQKVRVEKL 445


>gi|260587635|ref|ZP_05853548.1| hemolysin-related protein [Blautia hansenii DSM 20583]
 gi|260541900|gb|EEX22469.1| hemolysin-related protein [Blautia hansenii DSM 20583]
          Length = 463

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 141/254 (55%), Gaps = 10/254 (3%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA  +G+  E E E+  NI+ F +    DIM  R +++A+E+   + +A+        S 
Sbjct: 201 DAHEQGVIEENEAEMIQNIMEFSETEAQDIMTHRKNLHAIEENTLLKDALSYMLDNSNSR 260

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY+  +DN  G++H++DV+  I+    +  N+ +    S  NL++  ++VP +  ++D
Sbjct: 261 YPVYREDIDNIIGILHLKDVMRQIT--LPECENLPIG---SIPNLVREAVYVPETRSIND 315

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           L   +Q  +I + +V+DE+G T G+V+ EDI+  ++ +I  E+   ++ I   +D + ++
Sbjct: 316 LFKRMQAKKIHLVVVVDEYGQTSGIVTMEDILEEIVGNILDEYDEDENFIQLQNDQSLVM 375

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILD 301
           +  T LE++  ++ +D +    E++ D+L G + S+L  +P   E   ++  G+   IL 
Sbjct: 376 NGLTPLEQVDDVLNSDFD----EEEFDTLNGYLTSLLGHVPNMAEDKEIKAKGYLFTILA 431

Query: 302 ADVRCVRRVRIRRL 315
            +   +++VR+ +L
Sbjct: 432 VENNTIQKVRVEKL 445


>gi|118580452|ref|YP_901702.1| CBS domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118503162|gb|ABK99644.1| CBS domain containing protein [Pelobacter propionicus DSM 2379]
          Length = 296

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 136/248 (54%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ +E E E+  +I   R   + ++M+ R+ +  +   ATV E +      G S +PV+
Sbjct: 54  EGVVNEEESEMIRSIFSLRSTVVREVMVPRIDMACISVDATVREILETILACGHSRIPVF 113

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +NS+DN  G+++ +D++ Y    +  + ++     +   ++++   F+P +  +  LL  
Sbjct: 114 ENSVDNVIGLLYAKDMLKY----WGLSEDL-----IRVRSIMRPPYFIPETKNLEQLLQE 164

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            +   + +A+VIDE+GGT GL++ ED++  ++ DI  EH  ++++ +   D +   DAR 
Sbjct: 165 FKNKHVHLAIVIDEYGGTSGLITIEDLLEQIVGDIQDEHDREEALFTTNDDGSLTADARL 224

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +EEL ++   +    K     D++GGLIF +  +I A G+ V E     I +LD+D R 
Sbjct: 225 PIEELEQLFDMEIEHDK----FDTVGGLIFHLTGKISAPGDTV-ENEQLVIAVLDSDERK 279

Query: 307 VRRVRIRR 314
           ++RV I R
Sbjct: 280 IKRVCITR 287


>gi|328950642|ref|YP_004367977.1| protein of unknown function DUF21 [Marinithermus hydrothermalis DSM
           14884]
 gi|328450966|gb|AEB11867.1| protein of unknown function DUF21 [Marinithermus hydrothermalis DSM
           14884]
          Length = 462

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 138/259 (53%), Gaps = 9/259 (3%)

Query: 50  KLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVY 109
            L   + ++L    A   G   E E+++  ++L   + ++ +IM+ RV + AV   AT+ 
Sbjct: 193 PLVTEQELKLILAGAEASGAIEEAEEDMIQSVLELEETQVREIMVPRVEMVAVHASATLR 252

Query: 110 EAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK 169
           E + +  ++  S +PVY+ S+DN  G+ + +D+++Y++        +N    L+ S++  
Sbjct: 253 EFLQIEREHHYSRIPVYQESIDNIVGIAYAKDLLNYVN---GNGEAVNFLDTLTVSSITH 309

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
              FVP SM V +LL  ++     MA+V+DE GGT GLV+ EDIV  ++ +I  E   ++
Sbjct: 310 PAYFVPESMSVWNLLLEMRRRHTHMAIVVDEFGGTAGLVTMEDIVEEIVGEIYDETDEEE 369

Query: 230 SM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
            + I  + D  F++DA+T L+E+++ +G        E + ++L G ++     IP  GE 
Sbjct: 370 GLAIQLLPDGNFLIDAQTPLDEVSEALGVKLP----EGEYETLSGFLYETFGYIPKVGEA 425

Query: 289 VLEIPGFEIVILDADVRCV 307
           V   P F  VI   D R +
Sbjct: 426 VPYGP-FRFVIERGDDRKI 443


>gi|312144002|ref|YP_003995448.1| protein of unknown function DUF21 [Halanaerobium sp. 'sapolanicus']
 gi|311904653|gb|ADQ15094.1| protein of unknown function DUF21 [Halanaerobium sp. 'sapolanicus']
          Length = 419

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 142/247 (57%), Gaps = 16/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  ETE+E+  ++  F    + + M+ R+ I  VE   ++ E + +  + G S +PVY
Sbjct: 175 EGVIKETEQEMIQSVFEFDDTLVKENMVPRIDIVCVEKNDSLKELIRLGVEKGHSRIPVY 234

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S+DN  G+V+++D++  +     KT            + IK I F+P    ++ LL+ 
Sbjct: 235 EESIDNIIGLVYIKDLLELLLEKDKKTEI---------EDFIKPIYFIPEGKPINQLLSE 285

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++E +  MA+++DE+GGT GL++ ED++  ++ DI  E   +KS I  + +N  ++D RT
Sbjct: 286 MKERKEHMAIIVDEYGGTSGLITIEDLLEEIVGDIQDEFDLEKSYIEVIDNNKLLLDGRT 345

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIV---ILDAD 303
           D+EEL K +    + L+   D +++ GLI + L+R+P +GE + ++ G  ++   I+D  
Sbjct: 346 DIEELNKFLK---DPLEENDDFETVSGLILNNLNRLPIQGEKI-KLKGLTLIVENIIDNR 401

Query: 304 VRCVRRV 310
           +R V+ +
Sbjct: 402 IRKVKLI 408


>gi|95113914|gb|ABF55506.1| OrpB [Wolbachia endosymbiont of Drosophila simulans]
 gi|95113917|gb|ABF55508.1| OrpB [Wolbachia endosymbiont of Drosophila mauritiana]
 gi|95113920|gb|ABF55510.1| OrpB [Wolbachia endosymbiont of Drosophila simulans]
          Length = 272

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 136/239 (56%), Gaps = 21/239 (8%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           +I N++L+FR   I DIM  R  I AV+ +++  E +   +    + +P YKN+ DN  G
Sbjct: 42  DILNSLLKFRDCSIMDIMTPRKEICAVDIESSKDEVIKKVKNTYHAKIPTYKNNFDNVIG 101

Query: 136 MVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMA 195
             +++D+I      + K  + NL       N+I+N++FVP+SM  ++L   ++ S+  +A
Sbjct: 102 FFYVKDII------FNKNKDFNL------KNIIQNVIFVPASMKATNLFVRMKSSKSYLA 149

Query: 196 LVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEEL 251
           +V+DE+GGTDGL+S  D++  L+ +I +E+  + +  I+ +S N F + AR    D+EE 
Sbjct: 150 IVLDEYGGTDGLISINDLIEELIPNIDNENEVNSEHTITELSQNKFEISARALIKDIEEN 209

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
            KI   D      E+   +L GL+ S+  ++P+  EV+    G + +I DA+ R + ++
Sbjct: 210 LKIELCD-----SEEHYATLSGLVLSIAGKVPSVDEVIRYKNGIKFIIKDANERYINKI 263


>gi|317055147|ref|YP_004103614.1| CBS domain-containing protein [Ruminococcus albus 7]
 gi|315447416|gb|ADU20980.1| CBS domain containing protein [Ruminococcus albus 7]
          Length = 438

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 125/220 (56%), Gaps = 11/220 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   E++ E+ +NI  F  I ID++M  R  + A+++ A + EA+ +  + G S +PVYK
Sbjct: 201 GGIGESQAEMISNIFEFDDIGIDEVMTHRTEVAAIDESAPIREAVELAIESGFSRIPVYK 260

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +S+D+ +G+++ +D+++ + H  A+   +         + ++ ++FVP S    +L   +
Sbjct: 261 DSIDDIQGVIYAKDLLTLVFHESAEDRTVK--------DFMREVIFVPESRKCGELFKEL 312

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
              +++MA+ +DE+GGT G+V+ ED++  ++ DI  E+  +   I+ +SD  F ++    
Sbjct: 313 TAKKVQMAVAVDEYGGTAGVVTLEDLIETIVGDIVDEYDDESEEITKISDGVFEIEGNAG 372

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            E++ + +G + +    +   +++G ++  +L  IP  GE
Sbjct: 373 YEDVMEALGKEPD---EDSPFETIGAMVIELLGHIPDDGE 409


>gi|150021383|ref|YP_001306737.1| hypothetical protein Tmel_1507 [Thermosipho melanesiensis BI429]
 gi|149793904|gb|ABR31352.1| protein of unknown function DUF21 [Thermosipho melanesiensis BI429]
          Length = 430

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 138/248 (55%), Gaps = 11/248 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG     E  +    L   +  + +IMI RV I A+E+  T+ E M + ++   S +PVY
Sbjct: 187 EGTLKHEESFMLKRTLEMEESMVKEIMIPRVDIVAIEESETLDEIMKIIKEEEYSRIPVY 246

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+ + +DV+ ++S    + + I+  +++ E  +++  LFVP +M VS+LL  
Sbjct: 247 RETIDNIVGICYAKDVLVFVSE---RGSEISSKVKVKE--IMREPLFVPETMKVSELLKI 301

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDAR 245
            +E +I MA+V+DE+GGT GLV+ EDI+  +  +I  E+   +++ I  + +  +IVDA 
Sbjct: 302 FKEQKIHMAIVVDEYGGTAGLVTMEDILEEIFGEIMDEYDQNENIGIKRLENGAYIVDAT 361

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             + +L +  G +      E D ++L G I   L RIP  GE +L + GF   I+ A   
Sbjct: 362 VPINDLEREFGIEFP----ETDYETLAGYILEHLQRIPKVGEEIL-LDGFSFKIIAASKN 416

Query: 306 CVRRVRIR 313
            + +V ++
Sbjct: 417 RIEKVLVK 424


>gi|190571244|ref|YP_001975602.1| CBS domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018642|ref|ZP_03334450.1| CBS domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357516|emb|CAQ54952.1| CBS domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995593|gb|EEB56233.1| CBS domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 272

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 141/249 (56%), Gaps = 22/249 (8%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           +I N++L+FR   I DIM  R  I A++ +++  E +   +    + +P YKN+ DN  G
Sbjct: 42  DILNSLLKFRDCSIMDIMTPRKEICAIDIESSKDEVIKKVKNTYHAKIPTYKNNFDNVIG 101

Query: 136 MVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMA 195
             +++D+I      + K  + NL       N+I+N++FVP+SM  ++L   ++ S+  +A
Sbjct: 102 FFYVKDII------FNKNKDFNL------RNIIQNVIFVPASMKATNLFVRMKSSKSYLA 149

Query: 196 LVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDART---DLEEL 251
           +V+DE+GGTDGL+S  D++  L+ +I +E+  + +  I+ +S N F + AR    D+EE 
Sbjct: 150 IVLDEYGGTDGLISINDLIEELIPNIDNENEVNSEHTITELSQNKFEISARALIKDIEEN 209

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            KI   D      E+   +L GL+ S+  ++P+  EV+    G + +I DA+ R + ++ 
Sbjct: 210 LKIELCD-----SEEHYATLSGLVLSIAGKVPSVDEVIRYKNGIKFIIKDANERYINKI- 263

Query: 312 IRRLVHFKN 320
           I  L  +KN
Sbjct: 264 ILDLSDYKN 272


>gi|289523169|ref|ZP_06440023.1| hemolysin protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503712|gb|EFD24876.1| hemolysin protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 419

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 134/248 (54%), Gaps = 14/248 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   + E+ +   I+ F   R   +M+ R+ + A+ D  TV  ++  F +YG S +PVY+
Sbjct: 168 GAIEDDERRMIKGIISFEDTRAYQVMVPRMDMVAIPDMTTVGGSIETFRQYGHSRVPVYE 227

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             +D+ +G+++++D+I  +          N N   +  N I+  LFVP S+ +SDL   +
Sbjct: 228 GDIDHIKGILYVKDIIMPLY---------NGNYDDAVINYIREALFVPESIKISDLFDIM 278

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  R+ MA+++DE+GGT GL++ ED++  ++ +I  E+ ++   I   S+  +IVD   +
Sbjct: 279 RSKRVHMAILVDEYGGTAGLITMEDLLEEIVGEIQDEYDTEVPPIYKESEGIYIVDGLVN 338

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           LE+L++ +     C    +D DS+ G + S   R P   E  +    + I +++ D   V
Sbjct: 339 LEDLSEYLDYPFEC----EDADSVAGFVLSHFGRFPVPRESFI-YGEWNIEVMEVDQHRV 393

Query: 308 RRVRIRRL 315
           +R+R  ++
Sbjct: 394 KRLRFSKV 401


>gi|313676679|ref|YP_004054675.1| gliding motility-associated protein glde [Marivirga tractuosa DSM
           4126]
 gi|312943377|gb|ADR22567.1| gliding motility-associated protein GldE [Marivirga tractuosa DSM
           4126]
          Length = 440

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 134/246 (54%), Gaps = 17/246 (6%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           +E EK I   I+ F  + +  +M SR+ I A + +   +  M    K G S +PVY++++
Sbjct: 204 TEEEKGILKGIVNFGTLSVRQVMKSRLDITAFDIEDDYHMLMDQINKNGFSRIPVYRDTI 263

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D   G+++++D++ YI     K +N          +L++   FVP S  V  LL + QE 
Sbjct: 264 DKIEGVLYVKDLLPYIE----KEDNFEWQ------SLLRPGFFVPESKKVDSLLKDFQEK 313

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLE 249
           R+ MA+V+DE+GGT GL++ ED++  ++ +I  E      +  + + + T+I + RT L 
Sbjct: 314 RVHMAIVVDEYGGTSGLITLEDVIEEIVGEINDEFDEDMDVAYNKLDEYTYIFEGRTSLN 373

Query: 250 ELAKIIGTDCNC---LKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           +  KII  + +    +KGE   +SLGGLI  +  ++P  GE + +   F   ++  D + 
Sbjct: 374 DFCKIINEESSTFDEIKGES--ESLGGLILEINSKLPRTGEKI-KFKNFTFTVVAVDQKR 430

Query: 307 VRRVRI 312
           ++RVR+
Sbjct: 431 IKRVRV 436


>gi|85057846|ref|YP_456762.1| hymolysin-related protein [Aster yellows witches'-broom phytoplasma
           AYWB]
 gi|84789951|gb|ABC65683.1| hymolysin-related protein [Aster yellows witches'-broom phytoplasma
           AYWB]
          Length = 423

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 145/263 (55%), Gaps = 17/263 (6%)

Query: 57  IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LM 114
           +RL  I +  +GI  + E ++  NI  F    I ++M  R  + A++ + T  E +  + 
Sbjct: 170 LRLMLISSYQKGIIDKDENKMIQNIFEFDHTNIFEVMRHRTEVVAIDVEITKKELIKTIQ 229

Query: 115 FEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFV 174
            EKY R   PVY+NS+DN  G++H++D+ +Y+  M + TN I           I+    V
Sbjct: 230 NEKYTR--FPVYENSIDNIIGILHIKDIFNYL--MSSNTNKI-----FDLKKFIRKPYLV 280

Query: 175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISA 234
             +    ++   +++++  MA+VIDE+GGT G++++ED++  ++ +I+ E+ +++ MI  
Sbjct: 281 QDAQNTREIFREMKKNKTHMAIVIDEYGGTAGIITFEDLIEEILGEISDEYDNEELMIKE 340

Query: 235 VSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEI-- 292
           V+ N +IV+   DLEE+A+ I  + N     +D D+L G +   L R P + +   EI  
Sbjct: 341 VAKNEYIVNGFADLEEVAETIKLEFNT----EDYDTLSGFLIGKLGRCPNQNDKNTEIIY 396

Query: 293 PGFEIVILDADVRCVRRVRIRRL 315
             F+  IL  + + + +++I ++
Sbjct: 397 KNFKFKILKHNDKVISQIKISKI 419


>gi|253701855|ref|YP_003023044.1| hypothetical protein GM21_3260 [Geobacter sp. M21]
 gi|251776705|gb|ACT19286.1| CBS domain containing protein [Geobacter sp. M21]
          Length = 287

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 140/248 (56%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ ++ E  +  +IL      + +IM+ R+ ++ V  +  V E +      G S +PVY
Sbjct: 41  EGVINQEENAMIRSILSLGDSMVREIMLPRMEMSCVSIEDEVSEVLKSIIASGHSRLPVY 100

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++ +D++ Y    + + ++    I+L    LI+   F+P +  + +LL +
Sbjct: 101 EGTIDNVIGLIYAKDLLRY----WGEPDH---AIELR--KLIRPPFFIPETKNLEELLHD 151

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ R+ MA+VIDE+GGT GLV+ ED++  ++ DI  E+  +   +S  +DN+ + D R 
Sbjct: 152 FKKRRVHMAVVIDEYGGTAGLVTIEDLLEQIVGDIQDEYDLETERLSVQADNSIVADGRL 211

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +EEL +      + +  +   +++GGLIF +  RIPA GEV+ E     + +L+AD R 
Sbjct: 212 PIEELQE----HFDVVVEKDKFETVGGLIFHLTGRIPAAGEVI-ESDDLVLTVLEADERR 266

Query: 307 VRRVRIRR 314
           + +V I R
Sbjct: 267 IAKVHIAR 274


>gi|238917302|ref|YP_002930819.1| putative hemolysin [Eubacterium eligens ATCC 27750]
 gi|238872662|gb|ACR72372.1| putative hemolysin [Eubacterium eligens ATCC 27750]
          Length = 293

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 139/255 (54%), Gaps = 21/255 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMP 124
           +G+  E E E+  NI  F + +  D+M  R +I A+++  TV EA   +M E Y R   P
Sbjct: 44  QGVLEENEAEMIGNIFEFGEKQASDVMTHRNNIVALDNDITVKEAFDRVMEENYSR--YP 101

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILF----VPSSMLV 180
           VY   +DN  G++H+RD++     +Y + +N +  +      + K ILF    +P +  +
Sbjct: 102 VYDGDIDNITGVLHIRDLLK----IYVEESNQSRKL----GEVGKEILFQPYCIPETRNI 153

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           S L   +Q  +I MA+V+DE+G T G+++ EDI+  ++ +I  E+  ++  I   +D ++
Sbjct: 154 SPLFRQMQSDKIHMAIVVDEYGQTAGIITMEDILEEIVGNILDEYDDEEEQIVTDADGSY 213

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVI 299
           I++ + DLE++   +G +  C    +D+D+L G +   L +IP  GE   +E  G+    
Sbjct: 214 IIEGQADLEDVEARLGIEFEC----EDIDTLSGFMIYKLGKIPDDGESFEVEYNGYIFKT 269

Query: 300 LDADVRCVRRVRIRR 314
           L+   R + +V++ +
Sbjct: 270 LEVRNRMILKVKVEK 284


>gi|319952646|ref|YP_004163913.1| gliding motility protein glde [Cellulophaga algicola DSM 14237]
 gi|319421306|gb|ADV48415.1| protein involved in gliding motility GldE [Cellulophaga algicola
           DSM 14237]
          Length = 442

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 136/248 (54%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG  ++ E++I   I+ F       +M  R+ I A+  +    E +   +K G S +PV+
Sbjct: 201 EGDTTKEEQKILEGIVSFGNTDTKQVMRPRIDIFALNAEMKFLEVIEEIKKRGYSRVPVF 260

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++DN +G+++++D++ YI     KT N          +LI++  FVP +  + DLL  
Sbjct: 261 AENVDNVKGVLYVKDLLPYIDR---KTFNW--------MSLIRDPYFVPENKKLDDLLLE 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            QE +  +A+V+DE+GGT G+V+ EDI+  ++ DI+ E   +  + S + DN ++ D +T
Sbjct: 310 FQEKKNHLAVVVDEYGGTSGIVTLEDIIEEIVGDISDEFDDEDLIFSKLDDNKYLFDGKT 369

Query: 247 DLEELAKIIGTD--CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
            L++  ++I  D   N  + + + +++ G I  +    P RGEVV E  G+  VI   D 
Sbjct: 370 ALKDFYRVIKIDDETNFEERKGESETIAGFILEIAGSFPERGEVV-EFDGYTFVIESLDK 428

Query: 305 RCVRRVRI 312
           + ++++++
Sbjct: 429 KRLKQIKV 436


>gi|320334943|ref|YP_004171654.1| hypothetical protein Deima_2351 [Deinococcus maricopensis DSM
           21211]
 gi|319756232|gb|ADV67989.1| protein of unknown function DUF21 [Deinococcus maricopensis DSM
           21211]
          Length = 445

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 142/271 (52%), Gaps = 20/271 (7%)

Query: 52  SHHKG-----IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
            HH       IR+    +S EG+  + EKE+  N+       +  +M  RV +  V+  A
Sbjct: 175 GHHTAHSEEEIRMIVSASSQEGVLEDDEKELLYNVFDLSDTTVRSVMTPRVDMVVVDASA 234

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESN 166
            +   + + E++G S +PVY+++ DN  G+ H  DV+ ++  +    ++I +      + 
Sbjct: 235 PLRRLLELNEEHGYSRVPVYQDTSDNVVGVAHTNDVLKHLEAL----DHITV------AE 284

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-H 225
           +++   FVP +M VSDLL  +Q  +  + +V+DE GGT G+V+ ED++  ++ +I  E  
Sbjct: 285 VMRPTFFVPENMRVSDLLKQMQGRKSHLTIVVDEFGGTAGMVTLEDVLEEIVGEIYDETD 344

Query: 226 HSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPA 284
             ++ +I  V+D  +++DA   ++E+ + +  D    +G E + D+L G + +    IP 
Sbjct: 345 EEEERLIEMVADGVYLIDAAATVDEVEERL--DLTLDEGDEGEFDTLAGFVTNHFGYIPE 402

Query: 285 RGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
            GE      G+E  + DAD R V RVR  R+
Sbjct: 403 SGE-AFTFEGYEFYVEDADQRRVCRVRATRI 432


>gi|282858166|ref|ZP_06267361.1| putative transporter [Pyramidobacter piscolens W5455]
 gi|282584088|gb|EFB89461.1| putative transporter [Pyramidobacter piscolens W5455]
          Length = 430

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 126/221 (57%), Gaps = 13/221 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G    +E+ + + ++ F + R+ +IM+ RVS++A+E   T+     + + +  S +PV++
Sbjct: 182 GAIEASERRMIDGVIAFDETRVSEIMVPRVSMDALEVNETIAGVASLMQNWEHSRIPVFR 241

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            + D+  G+V+++D+I Y+     +   ++  +    S  ++  LFVP +M V+DL   +
Sbjct: 242 ETPDDIVGVVYLKDMIPYL-----RAGKMDTPL----SAFMRRALFVPETMKVADLFGMM 292

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +   +  A+V+DE+GGT G+V+ ED++  ++ DI  E+  + + I  +++N++ V     
Sbjct: 293 RGKHVHFAVVVDEYGGTAGIVTLEDLLEEIVGDIRDEYDEESAPIVQLNENSYRVKCTES 352

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
           LE+L  ++G D +C     DVDS+GG +       P +G++
Sbjct: 353 LEDLGAVVGYDFDC----NDVDSVGGYVLDKFMGFPEKGDI 389


>gi|197117390|ref|YP_002137817.1| CBS domain pair-containing protein [Geobacter bemidjiensis Bem]
 gi|197086750|gb|ACH38021.1| CBS domain pair-containing protein [Geobacter bemidjiensis Bem]
          Length = 287

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 140/248 (56%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ ++ E  +  +IL      + +IM+ R+ ++ V  +  V E +      G S +PVY
Sbjct: 41  EGVINQEENAMIRSILGLGDSMVREIMLPRMEMSCVSIEDEVSEVLKSIIASGHSRLPVY 100

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++ +D++ Y    + + ++    I+L    LI+   F+P +  + +LL +
Sbjct: 101 EGTIDNVIGLIYAKDLLRY----WGEPDH---AIELR--KLIRPPFFIPETKNLEELLHD 151

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ R+ MA+VIDE+GGT GLV+ ED++  ++ DI  E+  +   +S  +DN+ + D R 
Sbjct: 152 FKKRRVHMAVVIDEYGGTAGLVTIEDLLEQIVGDIQDEYDLETERLSVQADNSIVADGRL 211

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +EEL +      + +  +   +++GGLIF +  RIPA GEV+ E     + +L+AD R 
Sbjct: 212 PIEELQE----HFDVVVEKDKFETVGGLIFHLTGRIPAAGEVI-ESDDLVLTVLEADDRR 266

Query: 307 VRRVRIRR 314
           + +V I R
Sbjct: 267 IAKVHIAR 274


>gi|78223571|ref|YP_385318.1| CBS:transporter-associated region [Geobacter metallireducens GS-15]
 gi|78194826|gb|ABB32593.1| CBS:Transporter-associated region [Geobacter metallireducens GS-15]
          Length = 284

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 135/254 (53%), Gaps = 15/254 (5%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           IDAS E G+ +  E E+  +I   R   + +IM+ R  +  V    +V E +      G 
Sbjct: 35  IDASEEEGLINPEENEMIRSIFELRDTVVREIMVPRTDMACVSADTSVGEVLRTIITCGH 94

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S +PVY  ++DN  G+++ +D++ Y         + ++NI+     +++   F+P S  +
Sbjct: 95  SRIPVYDGTVDNIIGLIYAKDLLKYWG-----MGDSSINIR----RIMRTPYFIPESKNL 145

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
            +LL   +  R+ +A+VIDE+GGT GLV+ ED++  ++ DI  E+  ++  I    D + 
Sbjct: 146 EELLQEFKRKRVHIAIVIDEYGGTSGLVTIEDLLEQIVGDIQDEYDLEEDWIVEEPDGSV 205

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           +VDAR  +E+L +  G +    K     D++ GLIF +  RIP  GE + E     + +L
Sbjct: 206 LVDARLPIEDLEERFGIEIEREK----FDTVAGLIFHLTGRIPKVGEEI-ENDALRMTVL 260

Query: 301 DADVRCVRRVRIRR 314
           +   R +R+VR+ R
Sbjct: 261 EGGERNIRKVRVAR 274


>gi|124007397|ref|ZP_01692104.1| GldE [Microscilla marina ATCC 23134]
 gi|123987230|gb|EAY26970.1| GldE [Microscilla marina ATCC 23134]
          Length = 446

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 139/257 (54%), Gaps = 22/257 (8%)

Query: 65  SLEGIFSET-----EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG 119
            LEG+   T     ++EI   I+ F  I    +M SR+++ A +      E +   ++ G
Sbjct: 192 GLEGVIDRTDTTHKQREILKGIVNFGTITAKQVMTSRLAVTAFDINTDFSELLEKIQECG 251

Query: 120 RSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSML 179
            S +P+Y +++DN +G+++++D++ ++          N N     S L++   F+P +  
Sbjct: 252 YSRIPIYSDTIDNIKGVLYVKDLLPFL----------NANESFKWSKLLRKTYFIPPNKK 301

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDN 238
           +  LL + QE R+ +A+V+DE+GGT GLV+ ED++  ++ ++  E    ++ + + + +N
Sbjct: 302 IDKLLRDFQEKRVHLAIVVDEYGGTAGLVTMEDVIEEIVGEVNDEFDGDREKLYTKIDEN 361

Query: 239 TFIVDARTDLEELAKIIGTDCNCL---KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
           +++ +++  L +  KI+G + N     KGE   +SLGGL+     R+P   E ++    F
Sbjct: 362 SYLFESKISLHDFCKILGINNNFFDEVKGES--ESLGGLLLERFARLPKLNENIV-YDKF 418

Query: 296 EIVILDADVRCVRRVRI 312
           E  ++   VR ++ V++
Sbjct: 419 EFTVVAMGVRKIKIVKV 435


>gi|88658322|ref|YP_506864.1| hemolysin [Ehrlichia chaffeensis str. Arkansas]
 gi|88599779|gb|ABD45248.1| hemolysin [Ehrlichia chaffeensis str. Arkansas]
          Length = 295

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 140/269 (52%), Gaps = 33/269 (12%)

Query: 58  RLPRIDASLEGIFSE-----TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM 112
           R+P++   +E    +     T   +F N+ +F    + D+MI R  I A+ D   V ++ 
Sbjct: 32  RMPKLKRVVENNLIDDNECFTNSRMFYNLRKFNDCLVRDVMIPRTEIYAI-DITDVPDSK 90

Query: 113 LMFEK-----YGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNL 167
            + +K     Y R  +P Y+N+LDN  G +H++D+IS            N +   +  N+
Sbjct: 91  NLIDKVVSGQYTR--IPAYENNLDNIIGFIHIKDIIS------------NFHNDFNVRNI 136

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS 227
           I+ ++++P SM   +L   +Q S I +A+V+DE+GGT+GLV+  D++  ++ DI  EH  
Sbjct: 137 IREVMYIPPSMKAVNLFIKMQSSHIHVAVVVDEYGGTEGLVTMADLIEEIVGDIDDEHDV 196

Query: 228 KK-SMISAVSDNTFIVDART---DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIP 283
                I  +SDN   V+AR    +LEE+  I   DC     E D  ++GGLI S++ R+P
Sbjct: 197 PTVPSIVNISDNKIEVNARVLVKNLEEIFNIDFRDCK----EDDYVTIGGLILSMIGRVP 252

Query: 284 ARGEVVLEIPGFEIVILDADVRCVRRVRI 312
              EV     G    I +AD RC+ ++ I
Sbjct: 253 MTNEVFKHKSGAVFSIKEADDRCIYKIVI 281


>gi|95929410|ref|ZP_01312153.1| CBS domain protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134526|gb|EAT16182.1| CBS domain protein [Desulfuromonas acetoxidans DSM 684]
          Length = 282

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 151/277 (54%), Gaps = 19/277 (6%)

Query: 44  KTW--KLMKLSHH---KGIRLPRIDASLEG-IFSETEKEIFNNILRFRKIRIDDIMISRV 97
           ++W  +L+ ++HH   +      I AS EG I +  E E+F++I  F +  + ++MI R 
Sbjct: 9   RSWLQRLLGITHHVTSEEHLQELIHASEEGGIINAEEGEMFSSIFEFGETIVREVMIPRT 68

Query: 98  SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNIN 157
            + +    A++   + M  K+G S +PVY+ ++D   G+V+ +D++ +       ++ I+
Sbjct: 69  EMRSCPVDASLDTFIEMVLKFGHSRIPVYEETIDRIVGLVYAKDLLKFWGQ---PSHEIS 125

Query: 158 LNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVL 217
           L       +L++   FVP +  + +LL   +  R+ +A+ IDE+GGT GL++ ED++  +
Sbjct: 126 LR------DLMRKPYFVPETKRIEELLQEFRTQRMHIAIAIDEYGGTSGLITLEDLIEEI 179

Query: 218 MRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
           + DI  E+    + +   +  T +VDAR  L+EL      D    + +Q  DS+GGL+  
Sbjct: 180 IGDIKDEYDFDDNQLIEETPGTIVVDARLSLDELED--HYDLPEFERDQ-FDSVGGLLLH 236

Query: 278 VLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            L  +P  GE V+  P  ++V+L +D R + R+R+ R
Sbjct: 237 RLGYVPKPGEEVVVEP-LKMVVLQSDERMIHRIRVIR 272


>gi|116748168|ref|YP_844855.1| CBS domain-containing protein [Syntrophobacter fumaroxidans MPOB]
 gi|116697232|gb|ABK16420.1| CBS domain containing protein [Syntrophobacter fumaroxidans MPOB]
          Length = 276

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 138/248 (55%), Gaps = 16/248 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+ SE E E+   I  FR     +IM+ R        + T  + + +  + G S +P+Y+
Sbjct: 30  GLISEDEGEMIQGIFSFRDTIAREIMVPRTDAVYARAETTTADVIQLIIQSGHSRIPIYQ 89

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +S+DN  G +H +D++ Y       +++++L        +I++  F+P S  +S++L ++
Sbjct: 90  DSIDNIIGTLHAKDLLKYWG-----SDDVDLR------AIIRSPYFIPESKKISEVLEDL 138

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           ++++  MA+V+DE+GGT G+++ EDI+  ++ D+  E+ +   +I    D +  V AR D
Sbjct: 139 RDNKSHMAIVVDEYGGTAGILTLEDIIEEIIGDVMDEYDADVKLIVEHDDGSITVHARLD 198

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +EEL   +  D    +G+   +S+GG + S++ R+P   E ++     E+VI  A  R +
Sbjct: 199 VEELEDFL--DVKLPEGK--FESVGGFVISLVGRVPGVNERIV-FENMEMVIEAASNRKI 253

Query: 308 RRVRIRRL 315
            ++RIRR+
Sbjct: 254 EKIRIRRV 261


>gi|239826153|ref|YP_002948777.1| hypothetical protein GWCH70_0616 [Geobacillus sp. WCH70]
 gi|239806446|gb|ACS23511.1| protein of unknown function DUF21 [Geobacillus sp. WCH70]
          Length = 422

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 133/253 (52%), Gaps = 26/253 (10%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM---LMFEKYGRSWM 123
           EGI    EKE+ +  L F +I + +I   R  + AVE    + EA+    + EKY R  +
Sbjct: 181 EGIIDNKEKELIHRSLDFDEILVGEIFTPRSDMVAVEVNQPI-EAIRDVFLEEKYSR--I 237

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+  +DN  G++  RD  S +     +  +IN+        L++  LFV  SM +SDL
Sbjct: 238 PVYEEDIDNVIGILSERDFFSEL----VQQKDINIR------ALLRKPLFVVESMKISDL 287

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+SR+ MA+VIDE GGT GL++ EDI+  ++ +I  EH      I  + +N++  +
Sbjct: 288 LPELQKSRVHMAIVIDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKNIQQIDENSYEFN 347

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           A   L+E  +I+  D      E    +LGG IF + +R+P  GE +   P      L   
Sbjct: 348 AELPLDEFCEIMKIDA----PESSSHTLGGWIFEMFERVPNVGETLHYGP------LTLT 397

Query: 304 VRCVRRVRIRRLV 316
           VR V   RIR+++
Sbjct: 398 VRQVENRRIRKVL 410


>gi|269792676|ref|YP_003317580.1| hypothetical protein Taci_1066 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100311|gb|ACZ19298.1| protein of unknown function DUF21 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 426

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 146/283 (51%), Gaps = 28/283 (9%)

Query: 46  WKLMKLSHHKGIRL--------PRID-----ASLEGIFSETEKEIFNNILRFRKIRIDDI 92
           W L  L    GIRL          ID      S  G   E E+++ + I+ F + R+ +I
Sbjct: 149 WILTFLGRTMGIRLDTASLVTREEIDHMVKEGSASGALEEEERKMIHGIISFEETRVSEI 208

Query: 93  MISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAK 152
           M+ R  + AV   +TV +A+ +F   G S MP+Y+  +D+  G+++++D++  ++     
Sbjct: 209 MVPRTDVVAVVAGSTVRDAVRIFMDSGHSRMPIYEGDMDHVVGILYVKDLLRNLTQ---- 264

Query: 153 TNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYED 212
             +++  ++    +  ++ LFVP +M + +L   ++++R+ MA+V+DE+GGT GLV+ ED
Sbjct: 265 -GDMDRPVE----DCKRDCLFVPETMRIGELFDRMKKARVHMAVVVDEYGGTAGLVTLED 319

Query: 213 IVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLG 272
           ++  ++ +I  E+  +   I       F+V     LE+L++ +G         +DVD++ 
Sbjct: 320 LLEEIVGEIQDEYDEEIPPIQE-EGGVFVVQGHVHLEDLSEALGHQFQA----EDVDTVA 374

Query: 273 GLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
           G + S+L   P  G+ +L    + I +       +  VR RRL
Sbjct: 375 GFVLSILGAFPEEGQGIL-YDDWSIEVTKVQGHRIMEVRFRRL 416


>gi|55980703|ref|YP_144000.1| hemolysin-like protein [Thermus thermophilus HB8]
 gi|55772116|dbj|BAD70557.1| hemolysin-related protein [Thermus thermophilus HB8]
          Length = 445

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 134/239 (56%), Gaps = 14/239 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E+E+ ++IL   +  + +IM  RV + A+ED+AT+ + + ++ ++  S +PVY+
Sbjct: 202 GAIEPQEEEMIHSILELEETPVREIMTPRVEMVAIEDEATLEDLLALYREHRYSRVPVYR 261

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            S+D+  G+ +++D+++Y      K   +        +++     FVP +M    LL  +
Sbjct: 262 ESVDHIVGVAYVQDLLTYYCEEDLKAFKV--------ASIAHPPYFVPENMDAWSLLKEL 313

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  ++ MA+V+DE GGT GLV+ ED++  ++ +I  E    ++  I  + D  + + A+T
Sbjct: 314 RRRKVHMAIVVDEFGGTAGLVTLEDVIEEIVGEIYDESDEPEEHPIRLLPDGAYSIQAQT 373

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            ++E+++ +G +      E + D+L G ++++  RIP+ GE  LE  GF  V+  AD R
Sbjct: 374 PIDEVSEALGVELP----EGEYDTLSGFLYALFGRIPSVGE-SLEWQGFRFVVESADQR 427


>gi|196250686|ref|ZP_03149374.1| protein of unknown function DUF21 [Geobacillus sp. G11MC16]
 gi|196209765|gb|EDY04536.1| protein of unknown function DUF21 [Geobacillus sp. G11MC16]
          Length = 423

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 133/252 (52%), Gaps = 24/252 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+    EKE+    L F +I +++I   R  + AVE    + E   +F  E+Y R  +P
Sbjct: 180 EGVIDNKEKELIQRSLDFDEILVEEIFTPRADMVAVEVNQPIEEIRDVFLEERYSR--IP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D  S +          N ++++ E  L++  LFV  SM VSDLL
Sbjct: 238 VYEGDIDNVIGILSESDFFSELVQ--------NHDVRIRE--LLRQPLFVVESMKVSDLL 287

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH      +  + +++F   A
Sbjct: 288 PELQKSKVHMAIVVDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKTVRQIDEHSFEFSA 347

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E  +++  D      E +  +LGG IF + +RIPA GE +   P      L   V
Sbjct: 348 ELPLDEFCEVMKIDVP----ESESRTLGGWIFEMFERIPAVGETLQYGP------LTLTV 397

Query: 305 RCVRRVRIRRLV 316
           R V   RIR+++
Sbjct: 398 RQVDNRRIRKVL 409


>gi|322420982|ref|YP_004200205.1| CBS domain-containing protein [Geobacter sp. M18]
 gi|320127369|gb|ADW14929.1| CBS domain containing protein [Geobacter sp. M18]
          Length = 285

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 139/248 (56%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ ++ E E+  +IL      + +IM+ R+ +  V  +  V E +      G S +PVY
Sbjct: 41  EGVINQEENEMIRSILTLGDSMVREIMLPRMEMACVSIEDEVSEVLKSIIASGHSRLPVY 100

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++ +D++ Y    + + ++    I+L    LI+   F+P +  + +LL +
Sbjct: 101 EGTIDNVIGLIYAKDLLRY----WGEPDD---AIELR--KLIRPPFFIPETKNLEELLHD 151

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ R+ MA+VIDE+GGT GLV+ ED++  ++ DI  E+  +   +S   D + +VD R 
Sbjct: 152 FKKRRVHMAVVIDEYGGTAGLVTIEDLLEQIVGDIQDEYDLETERLSVQGDGSVVVDGRL 211

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            ++EL +    D    K  ++ +++GGLIF +  RIP  GEV+ E     + +L+AD R 
Sbjct: 212 TVQELEEHF--DVEIAK--ENFETVGGLIFHLTGRIPLAGEVI-ESGTLVLTVLEADERR 266

Query: 307 VRRVRIRR 314
           + +V I R
Sbjct: 267 IAKVHIAR 274


>gi|138894214|ref|YP_001124667.1| hemolysin-like protein [Geobacillus thermodenitrificans NG80-2]
 gi|134265727|gb|ABO65922.1| Hemolysin-related protein [Geobacillus thermodenitrificans NG80-2]
          Length = 416

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 133/252 (52%), Gaps = 24/252 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+    EKE+    L F +I +++I   R  + AVE    + E   +F  E+Y R  +P
Sbjct: 173 EGVIDNKEKELIQRSLDFDEILVEEIFTPRADMVAVEVNQPIEEIRDVFLEERYSR--IP 230

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D  S +          N ++++ E  L++  LFV  SM VSDLL
Sbjct: 231 VYEGDIDNVIGILSESDFFSELVQ--------NHDVRIRE--LLRQPLFVVESMKVSDLL 280

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH      +  + +++F   A
Sbjct: 281 PELQKSKVHMAIVVDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKTVRQIDEHSFEFSA 340

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E  +++  D      E +  +LGG IF + +RIPA GE +   P      L   V
Sbjct: 341 ELPLDEFCEVMKIDVP----ESESRTLGGWIFEMFERIPAVGETLQYGP------LTLTV 390

Query: 305 RCVRRVRIRRLV 316
           R V   RIR+++
Sbjct: 391 RQVDNRRIRKVL 402


>gi|39938639|ref|NP_950405.1| hemolysin [Onion yellows phytoplasma OY-M]
 gi|39721748|dbj|BAD04238.1| hemolysin [Onion yellows phytoplasma OY-M]
          Length = 430

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 142/263 (53%), Gaps = 17/263 (6%)

Query: 57  IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LM 114
           +RL    +  +GI  + E ++  NI  F    I ++M  R  + A++ +    E +  + 
Sbjct: 174 LRLMLTSSYQKGIIDKDENKMIQNIFEFDHTNISEVMRHRTEVVAIDVEINKKELIKTIQ 233

Query: 115 FEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFV 174
            EKY R   PVY+NS+DN  G++H++D+ +Y+  M +  N I           I+    V
Sbjct: 234 NEKYTR--FPVYENSIDNIIGILHVKDIFNYL--MSSNPNKI-----FDLKKFIRKPYLV 284

Query: 175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISA 234
           P +   ++    +++++  MA+VIDE+GGT G++++ED++  ++ +I+ E+ +++ MI  
Sbjct: 285 PDTKNTNEFFREMKKTKTHMAIVIDEYGGTAGIITFEDLIEEILGEISDEYDNEELMIKE 344

Query: 235 VSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEI-- 292
           V+ N +IV+   DLEE+A+ I  + +     +D D+L G +   L R P   +   EI  
Sbjct: 345 VAKNEYIVNGFADLEEVAEAIKLEFST----EDYDTLSGFLIGQLGRFPKPNDKNTEIIY 400

Query: 293 PGFEIVILDADVRCVRRVRIRRL 315
             F+  IL  + + + +++I ++
Sbjct: 401 KNFKFTILKHNDKVISQIKITKI 423


>gi|297621265|ref|YP_003709402.1| hypothetical protein wcw_1037 [Waddlia chondrophila WSU 86-1044]
 gi|297376566|gb|ADI38396.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
          Length = 432

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 141/241 (58%), Gaps = 5/241 (2%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
           +EK +  + L+F+     ++M+ RV + ++    T+ EA  + ++ G S +P+Y+N++D 
Sbjct: 190 SEKMLIQSTLKFKDRIAREVMVPRVDVFSLPADTTIREAARLSKEEGYSRIPLYRNNVDQ 249

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
             G++  +D++        K N+  +  Q  ES + KN+L+ P +  +S LL   ++ ++
Sbjct: 250 IVGVLMYKDILHTFMEYADKENSAAILEQPVES-IQKNVLYTPETKKISHLLHEFKKKQV 308

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            +A+V+DE+GGT+G+V+ EDI+  ++ +I  E+  ++ MI   +D ++IVDAR  + +  
Sbjct: 309 HLAIVVDEYGGTEGIVTIEDILEEIVGEIEDEYDEEEEMIFPQADGSWIVDARMSILDFK 368

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +  G +   +  + + D+LGG IF     IP++G  ++    FE+ IL +D R V RVRI
Sbjct: 369 QESGIE---IPQDGEYDTLGGYIFHCAGSIPSKG-FLIHHENFEMEILRSDERKVERVRI 424

Query: 313 R 313
           R
Sbjct: 425 R 425


>gi|57238749|ref|YP_179885.1| hypothetical protein Erum0190 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160828|emb|CAH57726.1| putative magnesium and cobalt efflux protein [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 288

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 140/267 (52%), Gaps = 29/267 (10%)

Query: 58  RLPRIDASLEGIF-----SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM 112
           ++PR+   +E          +   +F+N+++F    + DIMI R  I AV D A + ++ 
Sbjct: 30  KMPRLKKEVESTLIADSQCFSNSRMFHNLVKFNDCLVRDIMIPRTEIYAV-DIADIPDSK 88

Query: 113 LMFEKYGRSW---MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK 169
            + +K  +     +P Y+N+LDN  G +H++D+IS    ++        N++    N+I+
Sbjct: 89  SLTDKLIKGQYTRIPAYENNLDNIIGFIHIKDIISNFDKIF--------NVK----NIIR 136

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            I+ +P SM   +L   +Q S   +A+VIDE+GGT+GLV+  D++  ++ +I  EH +  
Sbjct: 137 TIICIPPSMKAVNLFIKMQSSHTHVAIVIDEYGGTEGLVTMADLIEEIVGNIDDEHDTPT 196

Query: 230 -SMISAVSDNTFIVDART---DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPAR 285
              I  +SDN   V+AR     LEE   I   DC     E D  ++GGLI S++ R+P  
Sbjct: 197 VPSIVNISDNKIEVNARVLVKTLEETFNIDFRDCK----EDDYVTIGGLILSMIGRVPII 252

Query: 286 GEVVLEIPGFEIVILDADVRCVRRVRI 312
            EV     G    I +AD RC+ ++ I
Sbjct: 253 NEVFEHKSGAVFYIKEADDRCIYKIVI 279


>gi|114778656|ref|ZP_01453472.1| CBS:Transporter-associated region [Mariprofundus ferrooxydans PV-1]
 gi|114551121|gb|EAU53682.1| CBS:Transporter-associated region [Mariprofundus ferrooxydans PV-1]
          Length = 276

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 134/248 (54%), Gaps = 15/248 (6%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           + SE ++ +   I+ F   R+ ++M+ R  I AV     + E      + G S MPV   
Sbjct: 39  VQSEGQRNMLEAIVHFHDTRVREVMVPRSDIEAVAADTPLAEVQRSMIELGVSRMPVIDG 98

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
            +D+  GMVH++D+      M A  N  +  +    + L++  L V     VS LL+ ++
Sbjct: 99  DIDHVLGMVHVQDI------MQAGLNGKSPVL----AELLRPCLKVLELEQVSGLLSEMR 148

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
           E   R+A+V+DE GGT GLV+  D+V  ++ ++  +   ++    A+ D +F V AR  +
Sbjct: 149 EHACRIAIVLDEFGGTAGLVTLSDLVREIIGEVGEDGQDEEQECKALPDGSFQVLARMHI 208

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           EELA+ +G+       E D D++ G + + L RIP  GE V ++ GF I I++AD R + 
Sbjct: 209 EELAEAVGSPLP----EGDYDTVAGWLITRLGRIPHVGESV-KLDGFRIHIVEADPRRIS 263

Query: 309 RVRIRRLV 316
           +VR++RL+
Sbjct: 264 KVRMQRLM 271


>gi|284040816|ref|YP_003390746.1| gliding motility-associated protein GldE [Spirosoma linguale DSM
           74]
 gi|283820109|gb|ADB41947.1| gliding motility-associated protein GldE [Spirosoma linguale DSM
           74]
          Length = 453

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 19/273 (6%)

Query: 44  KTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVE 103
           K +KL      + + L   +A++E      EKEI   I+ F  +    +M +R+ I+AVE
Sbjct: 184 KGYKLSVEELSQAVELTGTNATVE------EKEILKGIVNFSNLTARQVMRARLDISAVE 237

Query: 104 DKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLS 163
           D  T  E M      G S +PVYK SLD   G+++++D++++I            +    
Sbjct: 238 DDLTFSELMEQINLSGYSRVPVYKESLDQIEGILYIKDLLTHIHE----------DDSFQ 287

Query: 164 ESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITS 223
             +L++   F+P +  V DLL + Q+ R+ MA+V+DE+GGT GLV+ EDI+  +  DI  
Sbjct: 288 WLSLLRPAFFIPENKKVDDLLQDFQKKRVHMAIVVDEYGGTRGLVTLEDIIEEIFGDIND 347

Query: 224 EHHSKKSMISAVSD-NTFIVDARTDLEELAKIIGTDCNCLKGEQ-DVDSLGGLIFSVLDR 281
           E   +  +     D NT + + +  + ++ +I+  D    +  Q D +SLGGL+  + +R
Sbjct: 348 EFDDETPLGYRREDENTVVFEGKMPITDVCRILNVDATTFEAVQGDSESLGGLLLELFNR 407

Query: 282 IPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
           +P  GE V+    F   I+ AD + +  VR+R+
Sbjct: 408 LPKSGEEVV-YANFTFQIISADDKRINEVRVRK 439


>gi|58578670|ref|YP_196882.1| hypothetical protein ERWE_CDS_00060 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58616733|ref|YP_195932.1| hypothetical protein ERGA_CDS_00060 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416345|emb|CAI27458.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
 gi|58417296|emb|CAI26500.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 290

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 138/267 (51%), Gaps = 29/267 (10%)

Query: 58  RLPRIDASLEGIF-----SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM 112
           ++PR+   +E          +   +F+N+++F    + DIMI R  I AV D A + ++ 
Sbjct: 32  KMPRLKKEVESTLIADSQCFSNSRMFHNLVKFNDCLVRDIMIPRTEIYAV-DIADIPDSK 90

Query: 113 LMFEKYGRSW---MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK 169
            + +K  +     +P Y+N+LDN  G +H++D+IS            N +   +  N+I+
Sbjct: 91  SLTDKLIKGQYTRIPAYENNLDNIIGFIHIKDIIS------------NFDKIFNVKNIIR 138

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
            I+ +P SM   +L   +Q S   +A+VIDE+GGT+GLV+  D++  ++ +I  EH +  
Sbjct: 139 TIICIPPSMKAVNLFIKMQSSHTHVAIVIDEYGGTEGLVTMADLIEEIVGNIDDEHDTPT 198

Query: 230 -SMISAVSDNTFIVDART---DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPAR 285
              I  +SDN   V+AR     LEE   I   DC     E D  ++GGLI S++ R+P  
Sbjct: 199 VPSIVNISDNKIEVNARVLVKTLEETFNIDFRDCK----EDDYVTIGGLILSMIGRVPII 254

Query: 286 GEVVLEIPGFEIVILDADVRCVRRVRI 312
            EV     G    I +AD RC+ ++ I
Sbjct: 255 NEVFEHKSGAVFYIKEADDRCIYKIVI 281


>gi|239618085|ref|YP_002941407.1| protein of unknown function DUF21 [Kosmotoga olearia TBF 19.5.1]
 gi|239506916|gb|ACR80403.1| protein of unknown function DUF21 [Kosmotoga olearia TBF 19.5.1]
          Length = 459

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 137/249 (55%), Gaps = 12/249 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  + E+++    L  + I + +IM  RV +  +E+  ++ + M + E  G S +PVY
Sbjct: 196 EGVLQDQERQMMKRSLELKDISVREIMTPRVEMVCMEENESLMDLMKVVEDEGYSRIPVY 255

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSDLLT 185
           + ++D   G+ + +D+  YI      TN+    ++ +    +++   FVP +  V DL+ 
Sbjct: 256 RENIDRIVGVCYAKDLFRYI----IDTNDEKETLEKTPVKEMMRQPYFVPETKKVDDLMK 311

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNTFIVD 243
             +E +I +A+V+DE+GGT GLV+ EDI+  L  +I  E+   +++  I  V DN +IVD
Sbjct: 312 EFKEQKIHLAIVVDEYGGTAGLVTMEDILEELTGEILDEYDIEAEEITIKKVGDNVYIVD 371

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           A T + +L +    + +    E + +++GG +  +L+R P  GE ++ +  F   IL A 
Sbjct: 372 AMTPINDLER----ELDVKFPETEYETIGGYLLEILERFPEIGERIV-VGDFIFEILAAG 426

Query: 304 VRCVRRVRI 312
            + + ++R+
Sbjct: 427 KKKIEKIRL 435


>gi|301062891|ref|ZP_07203474.1| CBS domain protein [delta proteobacterium NaphS2]
 gi|300443008|gb|EFK07190.1| CBS domain protein [delta proteobacterium NaphS2]
          Length = 294

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 134/250 (53%), Gaps = 14/250 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +   +G+ S  E  +   +L  ++ +   IMI R  I++     T+ E + +  + G + 
Sbjct: 39  EGQAKGLISNEESHMVYGVLDLKETQAHSIMIPRTEISSASVDCTLGEMISLVTQCGHTR 98

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +P++K+ +D+  G++H +D++  +        + +  I      + +   FVP +  +S+
Sbjct: 99  IPIHKDDIDHVVGVLHAKDLLRLLG------GDPDSKIPF---EIFRKPFFVPGNRAISE 149

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL ++QE R  +A+V DE+GGT G+++ EDI+  ++ +I  EH  ++ ++S + D +F+V
Sbjct: 150 LLKDLQERRTHLAIVTDEYGGTAGIITTEDILEEIVGEILDEHDQEEPLLSILDDGSFLV 209

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           DAR ++E+L + +         E D +S+GG I  +L +IP  GE       F+I I   
Sbjct: 210 DARLEIEKLEEHL----KIAFPEGDFESVGGFIIHLLGKIPKVGEKT-SYANFDITIQKG 264

Query: 303 DVRCVRRVRI 312
           D R + +V I
Sbjct: 265 DQRKIDKVLI 274


>gi|126735012|ref|ZP_01750758.1| hemolysin, putative [Roseobacter sp. CCS2]
 gi|126715567|gb|EBA12432.1| hemolysin, putative [Roseobacter sp. CCS2]
          Length = 295

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 126/229 (55%), Gaps = 14/229 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            +L  R++R++D+ + +  I AV    T  E + +F   G + +PVY  +LD P G+ ++
Sbjct: 59  GMLNLRRMRVEDVSVPKPDIVAVPVTITKDELVEVFRDSGLTRLPVYDGTLDTPIGIANL 118

Query: 140 RDVISYISHMY-AKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVI 198
           +D    + H +  K+ +++L        + + +++VP SM +  LL  +Q  RI MALVI
Sbjct: 119 KDF--ALRHGFNGKSPSMDLRA------MARPLIYVPPSMPLGVLLQKMQAERIHMALVI 170

Query: 199 DEHGGTDGLVSYEDIVS--VLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           DE+GGTDGLV+ ED++   V   +   +    KS +       ++  ARTDL +    IG
Sbjct: 171 DEYGGTDGLVTIEDLIEQVVGEIEDEHDIEEAKSWVME-KPGCYLAQARTDLHDFEAEIG 229

Query: 257 TDCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
                 +   E+++D+LGGL+  +   +PARGEV++   G E  ++DAD
Sbjct: 230 MTLTHPEEVDEEEIDTLGGLVTMLAGHLPARGEVIVHPEGPEFEVVDAD 278


>gi|320120487|gb|EFE28662.2| CBS domain protein [Filifactor alocis ATCC 35896]
          Length = 410

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 122/227 (53%), Gaps = 14/227 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           +S EG+    EKEI +NI  +  +R+ DIMI R+ I AV+  AT  E +  F +   S +
Sbjct: 173 SSQEGVLESDEKEIIDNIFEYSDMRVKDIMIQRMDIVAVDVSATYEEVVEAFGEKQFSRI 232

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY++++DN  G+++ +D+       +     I    Q      ++   +    + +SD 
Sbjct: 233 PVYEDTIDNIVGVLYAKDL------FFIPVEKIK---QFDIKKYMREPFYTYEFIKISDF 283

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIV 242
              +Q  RI +A+V+DE+GG  G+++ EDI+  ++ DI  E+  + +  I  + +  ++V
Sbjct: 284 FRRMQGDRIHIAIVLDEYGGVAGIITMEDIIESILGDINDEYDPQDEEDIVCIKEGEYLV 343

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           +    LE+L + IGT        +D +S+GG I  +L RIP  GE++
Sbjct: 344 NGSVRLEDLNEEIGTHFES----EDFESIGGFILGILGRIPRTGEII 386


>gi|212640132|ref|YP_002316652.1| CBS domain-containing hemolysin-like protein [Anoxybacillus
           flavithermus WK1]
 gi|212561612|gb|ACJ34667.1| Hemolysin related protein containing CBS domains [Anoxybacillus
           flavithermus WK1]
          Length = 421

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 128/252 (50%), Gaps = 24/252 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+    EKE+ +  L F  I + +I   R+ + AVE    V E   +F  E+Y R  +P
Sbjct: 181 EGVIDNKEKELVHRSLDFNDILVGEIFTPRIDMVAVEVNQPVEEIRDIFLRERYSR--VP 238

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D  S +  +  K  N+          L++  LFV  SM +S LL
Sbjct: 239 VYEGDIDNVIGILSESDFFSQL--VQGKEVNVR--------ELLRTPLFVVESMRISTLL 288

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+VIDE GGT GL++ EDI+  ++ +I  EH         ++D  +  +A
Sbjct: 289 PELQKSKVHMAIVIDEFGGTSGLITLEDILEQIVGEIWDEHDEAVKTFQKINDYEYEFNA 348

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E   I+G D    + E    +LGG +F + +RIP  GE       FE   L   V
Sbjct: 349 ELPLDEFCHILGID----ELESSSHTLGGWVFEMFERIPTVGE------SFEYETLTVTV 398

Query: 305 RCVRRVRIRRLV 316
           R V   RIR+++
Sbjct: 399 RQVENRRIRKVL 410


>gi|222525615|ref|YP_002570086.1| CBS domain-containing protein [Chloroflexus sp. Y-400-fl]
 gi|222449494|gb|ACM53760.1| CBS domain containing protein [Chloroflexus sp. Y-400-fl]
          Length = 447

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 124/223 (55%), Gaps = 13/223 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E+E+   ++ F    + +IMI RV + A+E  + +  A+ +    G S +PVY+
Sbjct: 184 GWIEHEEREMIEGVMDFGDTLVREIMIPRVDVVALEVNSPLKRALDVAITRGHSRIPVYE 243

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+++++D+I  +      T            +L++   FVP +M V+ LL ++
Sbjct: 244 ETIDNVVGILYVKDLIPVLRDGKHDT---------PLRDLLRPAYFVPVTMKVAALLEDL 294

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  R+ MA+V+DE+GGT G+V+ ED++  ++ +I  E+ +++  I  V  N  IVDAR  
Sbjct: 295 QRRRVHMAIVVDEYGGTAGIVTLEDLIEQIVGEIRDEYDTEEPAIVEVGPNELIVDARVP 354

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
           ++++A ++  +      E   D +GGL++  L RIP  G+ V+
Sbjct: 355 IDDVAGLLEVEFP----ETTADRIGGLVYEQLGRIPREGDQVV 393


>gi|46198690|ref|YP_004357.1| hemolysin-like protein [Thermus thermophilus HB27]
 gi|46196313|gb|AAS80730.1| probable hemolysin-related protein/CBS domain containing protein
           [Thermus thermophilus HB27]
          Length = 446

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 133/237 (56%), Gaps = 14/237 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E+E+ ++IL   +  + +IM  RV + A+ED+AT+ + + ++ ++  S +PVY+
Sbjct: 203 GAIEPQEEEMIHSILELEETPVREIMTPRVEMVAIEDEATLEDLLALYREHRYSRVPVYR 262

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            S+D+  G+ +++D+++Y      K   +        +++     FVP +M    LL  +
Sbjct: 263 ESVDHIVGVAYVQDLLTYYCEEDLKAFKV--------ASIAHPPYFVPENMDAWSLLKEL 314

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  ++ MA+V+DE GGT GLV+ ED++  ++ +I  E    ++  I  + D  + + A+T
Sbjct: 315 RRRKVHMAIVVDEFGGTAGLVTLEDVMEEIVGEIYDESDEPEEHPIRLLPDGAYSIQAQT 374

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            ++E+++ +G +      E + D+L G ++++  RIP+ GE  LE  GF  V+  AD
Sbjct: 375 PIDEVSEALGVELP----EGEYDTLSGFLYALFGRIPSVGE-SLEWQGFRFVVESAD 426


>gi|163847750|ref|YP_001635794.1| CBS domain-containing protein [Chloroflexus aurantiacus J-10-fl]
 gi|163669039|gb|ABY35405.1| CBS domain containing protein [Chloroflexus aurantiacus J-10-fl]
          Length = 450

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 124/223 (55%), Gaps = 13/223 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E+E+   ++ F    + +IMI RV + A+E  + +  A+ +    G S +PVY+
Sbjct: 187 GWIEHEEREMIEGVMDFGDTLVREIMIPRVDVVALEVNSPLKRALDVAITRGHSRIPVYE 246

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+++++D+I  +      T            +L++   FVP +M V+ LL ++
Sbjct: 247 ETIDNVVGILYVKDLIPVLRDGKHDT---------PLRDLLRPAYFVPVTMKVAALLEDL 297

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  R+ MA+V+DE+GGT G+V+ ED++  ++ +I  E+ +++  I  V  N  IVDAR  
Sbjct: 298 QRRRVHMAIVVDEYGGTAGIVTLEDLIEQIVGEIRDEYDTEEPAIVEVGPNELIVDARVP 357

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
           ++++A ++  +      E   D +GGL++  L RIP  G+ V+
Sbjct: 358 IDDVAGLLEVEFP----ETTADRIGGLVYEQLGRIPREGDQVV 396


>gi|332653840|ref|ZP_08419584.1| putative transporter [Ruminococcaceae bacterium D16]
 gi|332516926|gb|EGJ46531.1| putative transporter [Ruminococcaceae bacterium D16]
          Length = 437

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 132/252 (52%), Gaps = 17/252 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  EG   + E ++  N + F  + + +I+  RV + AVED AT+ EA  +F + G S +
Sbjct: 177 AENEGGLDQHESDLIRNAIEFNDLEVSEILTPRVDLVAVEDDATMEEAASLFVESGYSRL 236

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           P+Y +S+DN  G++H +D   Y +    +T+  NL            +L+   +  +S+L
Sbjct: 237 PIYHDSIDNIIGVIHEKDF--YAARYRGETDLTNLK---------APVLYTTGNTKISEL 285

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+++  MA+V+DE+GGT+G+ + EDIV  L+ +I  EH          +D ++++ 
Sbjct: 286 LRILQKNKAHMAVVVDEYGGTEGIATLEDIVEELVGEIWDEHDEVIETFQKQADGSYLIA 345

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
              DL+++      D   +KG  D  ++ G +   + R+P  G+   +  G ++ +   +
Sbjct: 346 CSADLDDM-----YDLFQVKGSCDAATVSGWVMEQVGRVPEVGD-HFQAEGLDVTVTQVE 399

Query: 304 VRCVRRVRIRRL 315
            R V  +++R L
Sbjct: 400 HRRVLEIQVRVL 411


>gi|219848376|ref|YP_002462809.1| CBS domain-containing protein [Chloroflexus aggregans DSM 9485]
 gi|219542635|gb|ACL24373.1| CBS domain containing protein [Chloroflexus aggregans DSM 9485]
          Length = 447

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 135/246 (54%), Gaps = 16/246 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E+E+   ++ F    + +IMI RV + A+E  +++  A+ +    G S +PVY+
Sbjct: 184 GWIEHEEREMIEGVMDFGDTLVREIMIPRVDVVALEVNSSLDRALDVAITRGHSRIPVYE 243

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+++ +D+I  +      T            +LI+   FVP +M V+ LL ++
Sbjct: 244 ETIDNVVGILYAKDLIPVLRDGRRDT---------PLRDLIRPAYFVPMTMKVTALLEDL 294

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  R+ MA+V+DE+GGT G+V+ ED++  ++ +I  E+ +++  I  V  + FIVDAR  
Sbjct: 295 QRRRVHMAIVVDEYGGTAGIVTLEDLLEQIVGEIRDEYDTEEPAIVEVGPHEFIVDARVP 354

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           ++++A+++  +          D +GGL++  L RIP  G+   E+   ++ I    ++ +
Sbjct: 355 IDDIAELLEVEFPATTA----DRIGGLVYEQLGRIPRVGD---EVTCGDVTITVLSIKGI 407

Query: 308 RRVRIR 313
           R  R+R
Sbjct: 408 RAERLR 413


>gi|303327866|ref|ZP_07358306.1| magnesium and cobalt efflux protein CorC [Desulfovibrio sp.
           3_1_syn3]
 gi|302862227|gb|EFL85161.1| magnesium and cobalt efflux protein CorC [Desulfovibrio sp.
           3_1_syn3]
          Length = 292

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 131/252 (51%), Gaps = 15/252 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  +G     E+ +   ILRF  +++ D MI R  I+ V D   + E   +    G S
Sbjct: 36  LEARADGEVEPDEESMLLGILRFNDLQVQDTMIPRTDIDCVPDDMPLPEVARVIVDSGHS 95

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +PVYK++ DN  G++H +D++  +     K   +        + +++   FVP +  + 
Sbjct: 96  RIPVYKDTRDNMVGILHAKDLLRCLIEPAGKHPPV--------AQVMREPFFVPETKPIR 147

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTF 240
            LL   +  +  +A+ +DE+GGT GL++ ED++  ++ DI  EH + ++  I  + DN +
Sbjct: 148 ALLQEFRARKQHIAIALDEYGGTSGLITIEDVLEEIVGDIEDEHDTPRQEDIRPLGDNVY 207

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
            +  R  LE+L + +G D        +VD++GG +      +P  GE V  + G+   +L
Sbjct: 208 ELTGRALLEDLEE-LGVDLVS----DEVDTIGGYLSMEAGHVPGPGE-VFNLHGWAFTVL 261

Query: 301 DADVRCVRRVRI 312
           DAD + +RR+R+
Sbjct: 262 DADKKLIRRLRM 273


>gi|317503246|ref|ZP_07961303.1| CBS domain protein [Prevotella salivae DSM 15606]
 gi|315665634|gb|EFV05244.1| CBS domain protein [Prevotella salivae DSM 15606]
          Length = 423

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 128/254 (50%), Gaps = 18/254 (7%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ID +  G   + E +IF N L F + ++ D MI R  INAVE + TV E M  F + G S
Sbjct: 188 IDNAKSGDEIDDEVKIFQNALEFSETKVRDCMIPRTEINAVEYQCTVEELMQKFVESGNS 247

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            + VYK+ +D+  G +H  ++       + K+              I+ + FVP +M   
Sbjct: 248 KIIVYKDDIDHIEGYIHSSEMFKSAGKDWHKS--------------IRTMPFVPETMAAQ 293

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
            L+    +S+  + +V+DE GGT G+VS EDIV  +  DI  EH S K +   ++DN ++
Sbjct: 294 KLMKTFLQSKKSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDSNKYVAKKINDNEYL 353

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           + AR +++++  +   D   L  + D  ++GG I +     P   EV+ +I  F   I+ 
Sbjct: 354 LSARLEIDKVNDMFNLD---LPEDDDYKTIGGYILNFYQSFPKLNEVI-KIDHFSFKIIK 409

Query: 302 ADVRCVRRVRIRRL 315
           + +  +  V++  L
Sbjct: 410 STMTKIELVKLTIL 423


>gi|217077830|ref|YP_002335548.1| integral membrane protein with CBS domains [Thermosipho africanus
           TCF52B]
 gi|217037685|gb|ACJ76207.1| integral membrane protein with CBS domains [Thermosipho africanus
           TCF52B]
          Length = 430

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 139/248 (56%), Gaps = 11/248 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG     E  +    L   +  + +IMI RV I A+E+  T+ + M + ++   S +PVY
Sbjct: 187 EGTIKHEESFMLKRTLEMEESVVREIMIPRVDIVAIEESETLDKVMEIIKEEEYSRIPVY 246

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K ++DN  G+ + +DV+++IS    + + I   +++ E  L++  LFVP +M VS+LL  
Sbjct: 247 KETIDNVVGICYAKDVLAFISD---RGSEICEKVKVKE--LMREPLFVPETMKVSELLKI 301

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDAR 245
            +E ++ MA+V+DE+GGT GLV+ EDI+  +  +I  E+   +++ I  + + ++IVDA 
Sbjct: 302 FKEQKMHMAIVVDEYGGTAGLVTMEDILEEIFGEIMDEYDQNENLGIKKLENGSYIVDAT 361

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             + ++ + +  +      E D ++L G I   L RIP  GE ++ I  F+  I+ A   
Sbjct: 362 VPINDIERELKIEF----PETDYETLAGYILEHLQRIPKVGEEII-IDKFKFKIIAASKN 416

Query: 306 CVRRVRIR 313
            + +V ++
Sbjct: 417 RIEKVLVK 424


>gi|189425789|ref|YP_001952966.1| hypothetical protein Glov_2733 [Geobacter lovleyi SZ]
 gi|189422048|gb|ACD96446.1| CBS domain containing protein [Geobacter lovleyi SZ]
          Length = 284

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 133/249 (53%), Gaps = 14/249 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E E+E+ + IL      + +IM+ R  + A+  +A+V E +      G S MPVY
Sbjct: 41  EGIVDEQEREMISAILELDSTVVREIMVPRTEMAAISVEASVRETIDAIIACGHSRMPVY 100

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++DN  G+++ +D++             +  IQL   +LI+   F P +  +  LL  
Sbjct: 101 DGTMDNIIGLLYAKDLLK-------SWGMADSQIQLR--DLIRQPFFTPETKTLELLLQE 151

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ ++ +A+V+DE+GGT GLV+ ED++  ++ DI  E+  ++ +     D +   DAR 
Sbjct: 152 FKKKKVHLAIVVDEYGGTSGLVTIEDLLEQIVGDIQDEYDMEEDLYVRNPDGSLTTDARL 211

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +EEL +    +    K     D++GGL+  + D IP  G VV+     EI IL+AD R 
Sbjct: 212 PIEELEEQFQLEIERDK----FDTVGGLVVHLADGIPVAGTVVIG-EDLEIEILEADPRK 266

Query: 307 VRRVRIRRL 315
           V+RV+I RL
Sbjct: 267 VKRVKISRL 275


>gi|37520354|ref|NP_923731.1| hypothetical protein glr0785 [Gloeobacter violaceus PCC 7421]
 gi|35211347|dbj|BAC88726.1| glr0785 [Gloeobacter violaceus PCC 7421]
          Length = 477

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 123/239 (51%), Gaps = 11/239 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+  N+  F      D+M+ R SI+A+   AT+ E +    + G S  P+Y++SLD  
Sbjct: 224 EQELLENVFEFGDAVAIDVMVPRTSIDALPFTATIQEVLFEVSRTGHSRYPLYEDSLDTI 283

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G V ++DVI+ ++    +  +       +   L + ILFVP +  +S+LLT +Q  R  
Sbjct: 284 KGQVSIKDVITPLAKGEVQPTD-------TVGGLARPILFVPENKRISELLTQMQRERQA 336

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE GGT GL++ E+++  L+ +IT E       I  + + T I+ A+ +LEEL  
Sbjct: 337 MVIVVDEFGGTAGLLTMENLLEELVGNITDESDQATPDIVKLDERTAIIQAQINLEELND 396

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            +           +  +LGG +   L ++P  GE        E  +L+ +   + RVR+
Sbjct: 397 FLDLQLPI---SDEYKTLGGFVMYQLHKVPEAGEQFF-YNELEFTVLEMEGPRLERVRL 451


>gi|308274750|emb|CBX31349.1| hypothetical protein N47_E48610 [uncultured Desulfobacterium sp.]
          Length = 408

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 122/217 (56%), Gaps = 16/217 (7%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EK++   +    +  + D+M+  V++ A+  KATV +A+    + G S +PVYK+ +DN 
Sbjct: 173 EKKLIKRVFHLFESNVSDVMVPLVNVTAISSKATVGKAINAINETGYSRLPVYKSRIDNL 232

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G++H  D+I +I  + A  N             I+ + +VP S    DLLT +Q +R  
Sbjct: 233 IGIIHPIDLI-HIKDIDAAINP-----------FIREVPYVPESTKAHDLLTLLQRTRNS 280

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT G+++ EDI+  ++ +I  E+   K       +N F+V+AR ++E   +
Sbjct: 281 IAIVLDEYGGTVGIITIEDILEEVVGEINDEYDDDKKQFIRFEENKFLVNARMEIENANE 340

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
           I+  D      ++D +++GG +  ++ +IP +GE V+
Sbjct: 341 IMNIDI----PKEDYETIGGFLLKLMGKIPKKGETVI 373


>gi|220927710|ref|YP_002504619.1| hypothetical protein Ccel_0252 [Clostridium cellulolyticum H10]
 gi|219998038|gb|ACL74639.1| protein of unknown function DUF21 [Clostridium cellulolyticum H10]
          Length = 434

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 122/221 (55%), Gaps = 15/221 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  +TEKE+ +NI  F    + +IM  R +I  +   + +   + +  +   + +P+Y 
Sbjct: 196 GVIQDTEKEMIDNIFEFDNKSVSEIMTHRTNIVGIPVDSDINYVLYIMNRDKYTRVPIYN 255

Query: 128 NSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +++DN  G++H++D++ Y  SH          N   S   +I++  FVP S    +L   
Sbjct: 256 DNIDNIVGILHVKDLLEYTQSH----------NKDFSLKKIIRSAYFVPESKRTDELFKE 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q++++ +A+VIDE+GGT G+V+ ED++  ++ +I  E+  ++  I  + +NT+I D   
Sbjct: 306 MQKNKVHLAVVIDEYGGTAGIVTIEDLLEEIVGNIFDEYDIEQKDIEYLENNTYIFDGAI 365

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           DL+++ +++  D        D D+LGG I  +L RIP   E
Sbjct: 366 DLDKVEEVLDEDLPV----DDFDTLGGFILKLLGRIPKVDE 402


>gi|157364140|ref|YP_001470907.1| hypothetical protein Tlet_1285 [Thermotoga lettingae TMO]
 gi|157314744|gb|ABV33843.1| protein of unknown function DUF21 [Thermotoga lettingae TMO]
          Length = 429

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 135/244 (55%), Gaps = 11/244 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E  I     +  +  I +IM  RV + A+E+ A++++ M + ++ G S +PVY+
Sbjct: 183 GTIDHQEGLIVERTFQMSETTIREIMTPRVDVVAIEENASLFDLMELVDEEGYSRIPVYR 242

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             +DN  G+ + +D++ YI      T+ ++   +     +I+  LFVP +M VS LL   
Sbjct: 243 EDIDNIIGVCYAKDIVGYIQQ--HGTDELS---KKKVKEIIREPLFVPETMNVSTLLKIF 297

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +E +I +A+V+DE GGT G+V+ EDI+  L+ +I  E+ H + S I  +S+NT++++A T
Sbjct: 298 KEKKIHIAIVVDEFGGTAGIVTLEDILEELIGEIMDEYDHDEVSGIKKISENTYLINATT 357

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            + ++ + +  D      E + ++L G +  +  RIP+ GE V ++  F   I+ A    
Sbjct: 358 PINDIERELDVDFE----ETEHETLSGYLLEIFRRIPSVGEEV-DVDLFHFKIVAATKNR 412

Query: 307 VRRV 310
           + RV
Sbjct: 413 IERV 416


>gi|156740748|ref|YP_001430877.1| CBS domain-containing protein [Roseiflexus castenholzii DSM 13941]
 gi|156232076|gb|ABU56859.1| CBS domain containing protein [Roseiflexus castenholzii DSM 13941]
          Length = 435

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 134/239 (56%), Gaps = 13/239 (5%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +E+   I  F    + ++MI RV I A+E+ A++ EA+ +    G S +PVY+ ++D+  
Sbjct: 189 REMIEGIFSFGDTTVREVMIPRVDIVALEETASIDEALNIIITTGHSRIPVYRETIDHIV 248

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+++ +D++     ++ ++   + +I      L++   FVP +M V  LL ++Q  +I +
Sbjct: 249 GILYAKDLL-----LWLRSGQRDASI----GALLRTAHFVPDTMKVDALLKDLQARKIHL 299

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+V+DE+GGT GL++ ED++  ++ +I  E+   +  I  ++     VDAR  ++++  +
Sbjct: 300 AIVVDEYGGTAGLITIEDVIEEIVGEIQDEYDVDEQPIRVLAPGDMEVDARVPIDDINDL 359

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            G         ++ D +GG++F  L R+P  G+ V    G  +V+L  D   +R++R++
Sbjct: 360 TGLRL----ASEESDRIGGMVFERLGRVPKVGDTVQIADGVTVVVLSMDGLRLRKLRLQ 414


>gi|256544476|ref|ZP_05471849.1| transporter [Anaerococcus vaginalis ATCC 51170]
 gi|256399801|gb|EEU13405.1| transporter [Anaerococcus vaginalis ATCC 51170]
          Length = 406

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 118/223 (52%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E EI NN+  F      DIM  R ++ A+   +T  E      +   S +PVY
Sbjct: 170 QGVINNEESEIINNVFDFAGSFASDIMTPRTNMEAIAIDSTKEELDKFLIESKHSRIPVY 229

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G++HM+D++++++             +    ++++   +   +M + DL  +
Sbjct: 230 GESIDNIVGVLHMKDIVTFVAE----------GREPRLKDMLRQTYYAYENMNIIDLFKS 279

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++  + +A+V+DE+GGT+GLVS EDI+  L+ DI  E+      +  VSDN FIVDA  
Sbjct: 280 MKKMNVSLAIVVDEYGGTEGLVSIEDIIEELVGDIYDEYDPDDEKVYKVSDNEFIVDASM 339

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            + +       D   +K     DS+GGL+   L+R+P  G++V
Sbjct: 340 HINDFNDYFNRDIKEVKN----DSVGGLVIDYLNRLPKTGDIV 378


>gi|148658473|ref|YP_001278678.1| hypothetical protein RoseRS_4395 [Roseiflexus sp. RS-1]
 gi|148570583|gb|ABQ92728.1| protein of unknown function DUF21 [Roseiflexus sp. RS-1]
          Length = 439

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 125/223 (56%), Gaps = 13/223 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+E+   I  F    + ++MI RV I A+E+ A++ EA+ +    G S +PVY
Sbjct: 181 EGLIEPDEREMIEGIFSFGDTTVREVMIPRVDIVALEETASIDEALNVIIAKGHSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++D+  G+++ +D++     ++ ++     +I     +L++   FVP +M V  LL +
Sbjct: 241 RETIDHIVGILYAKDLL-----LWLRSGQREASI----GSLLRTAHFVPDTMKVDALLKD 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  ++ +A+V+DE+GGT GLV+ ED++  ++ +I  E+   +  I+ +      VDAR 
Sbjct: 292 LQARKVHLAIVVDEYGGTAGLVTIEDVIEEIVGEIQDEYDVDEQPITELGAGDLEVDARV 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            ++++  + G         ++ D +GG++F  L R+P  G+ V
Sbjct: 352 PIDDINDLTGLRLTS----EESDRIGGIVFERLGRVPKVGDTV 390


>gi|307297707|ref|ZP_07577513.1| protein of unknown function DUF21 [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916967|gb|EFN47349.1| protein of unknown function DUF21 [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 455

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 137/248 (55%), Gaps = 11/248 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+ I    L  + I + +IM  RV I A+E++  + + M + +  G S  P+Y
Sbjct: 195 EGVLQSEERMIMKRTLELKDISVKEIMTPRVEIVALEEEQPLIDLMELVQSEGYSRYPIY 254

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++D   G+ + +D++++I  +  K N++   I++ E  +++   FVP +  V DLL  
Sbjct: 255 RENIDRIVGVCYAKDLLNFI--LDRKDNDVLQTIRVEE--IMRYPYFVPETKKVDDLLRE 310

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNTFIVDA 244
            +E +  +A+VIDE+GGT G+++ ED++  L  +I  E+   S++ MI  + +  +IVD 
Sbjct: 311 FKEKKNHLAVVIDEYGGTAGIITMEDVIEELTGEILDEYDEESEEIMIERLGEREYIVDG 370

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
            T + ++ +    +      E + +++GG +  VL+R P  GE ++ + GF   +L A  
Sbjct: 371 MTPINDIER----ELEQPFPETEFETIGGYLLEVLERFPEVGEKII-VDGFTFEVLAAGK 425

Query: 305 RCVRRVRI 312
             V ++R+
Sbjct: 426 NKVEKIRL 433


>gi|56417277|ref|YP_154351.1| hypothetical protein AM1303 [Anaplasma marginale str. St. Maries]
 gi|56388509|gb|AAV87096.1| hypothetical protein AM1303 [Anaplasma marginale str. St. Maries]
          Length = 293

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 145/275 (52%), Gaps = 18/275 (6%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           +R+   ++ L KL   K     RI   +E +       I NN++R  +  + DIM+ R  
Sbjct: 27  MRSFFYSFILEKLPGFKDFVKNRI--MVENVLHFGSSHIMNNLVRLDECSVKDIMVQRSE 84

Query: 99  INAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL 158
           I A+    +   A ++  ++ R  +PVYK+++DN  G +H++D+ S           ++ 
Sbjct: 85  ILALGIDDSDLLAKVLRSQHTR--VPVYKDNIDNIVGFIHIKDITS--------KEGLDF 134

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM 218
           N++    ++I N+++VP SM   +L   +Q SR+ MA+V+DE+G TDGLV+  DI+  ++
Sbjct: 135 NVK----SIIHNVMYVPHSMKAVNLFVKMQSSRVHMAIVLDEYGSTDGLVTMADIIEEIV 190

Query: 219 RDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
            DI  EH       I  +S++   V+AR  +  L + +G      + E+ V ++GGLI +
Sbjct: 191 GDIEDEHDVPSIPDIVNISNDKIEVNARVLVRTLEQSLGISLKDSEEEEYV-TVGGLILA 249

Query: 278 VLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           ++ R+P   EV     G   +I + D RC+ RV I
Sbjct: 250 MVGRVPVVDEVFNHKSGASFLIKEVDNRCIYRVVI 284


>gi|291287435|ref|YP_003504251.1| hypothetical protein Dacet_1526 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884595|gb|ADD68295.1| protein of unknown function DUF21 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 434

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 138/251 (54%), Gaps = 16/251 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAV--EDKATVYEAMLMFEKYGRSWMP 124
           EGI    +  +  NI    +I + ++M+ R  + A+  ED    Y   +   ++ R  +P
Sbjct: 181 EGIIENGKSRMLQNIFDISEIYVKEVMVPRTDMVAIDIEDPVESYIDKIHASEFSR--IP 238

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ ++D   G+++++D++ +++           + Q     +++   F+P +  +  +L
Sbjct: 239 VYEETIDKIIGILYVKDLLRFVNED---------STQFDLRKVLRKPYFIPETKKIDSML 289

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
           +  Q +R  MA+VIDE+GG DGLV+ EDI+  ++ +I  E+ +++  ++ +S+NTFIVD 
Sbjct: 290 SEFQRNRNHMAIVIDEYGGVDGLVTLEDILEEIVGEIWDEYDTEEQEVTEISENTFIVDV 349

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           R D+++  +  G +      E   +++GGL+F + ++IP  GE  +    ++  IL+   
Sbjct: 350 RMDIDDFCEKFGLEKTHEMDE--YETVGGLVFDIAEKIPEVGEQYV-YENYQFKILNKHE 406

Query: 305 RCVRRVRIRRL 315
           R + +V +RR+
Sbjct: 407 RRLDKVELRRI 417


>gi|227500221|ref|ZP_03930290.1| HCC HlyC/CorC family transporter [Anaerococcus tetradius ATCC
           35098]
 gi|227217743|gb|EEI83047.1| HCC HlyC/CorC family transporter [Anaerococcus tetradius ATCC
           35098]
          Length = 375

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 132/249 (53%), Gaps = 15/249 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E E+ NN+  F    + DIM +R ++ A+     + E     +    S +PVY
Sbjct: 142 QGVINNEESEMINNVFEFGNSDVSDIMTARTNMEAISVDMPLEELKNFLKISNHSRIPVY 201

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++DN  G++HM+D++S+++       + +LNI    +++I+   +V  +M + DL T 
Sbjct: 202 GKNIDNILGILHMKDLVSHLAQ------DKDLNI----ADVIRPAFYVYDNMHIFDLFTT 251

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++   + +A+VIDE+GGT GLV+ EDIV  L+ +I  E+ S    I  ++D  ++V+   
Sbjct: 252 MRGENLSLAIVIDEYGGTSGLVTIEDIVEELVGEIDDEYDSAYETIYKINDKEYLVNPSI 311

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L +      TD   +K     DS+GG +   L RIP +G+ V  +    I++L  D   
Sbjct: 312 HLNDFNDYFDTDLEEIKN----DSIGGFVIDKLSRIPKQGDSV-RVGNINIMVLQVDRYK 366

Query: 307 VRRVRIRRL 315
           +  +++  L
Sbjct: 367 IEMLKVNFL 375


>gi|210612601|ref|ZP_03289392.1| hypothetical protein CLONEX_01594 [Clostridium nexile DSM 1787]
 gi|210151526|gb|EEA82533.1| hypothetical protein CLONEX_01594 [Clostridium nexile DSM 1787]
          Length = 282

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 137/251 (54%), Gaps = 10/251 (3%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+F  +E ++  NI  + +     IM  R  + A++ + T+  A+    +  +S  PVY
Sbjct: 39  QGVFLSSEAQMIRNIFAYGEKDAKSIMTHRKHMVALDGEETLENALTFILEQNKSRFPVY 98

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +D+  G +H+RD +    +   +  +I +  QL E   I+ + F+P +  +  LL  
Sbjct: 99  EEDIDSIIGTIHLRDAMK--CYFNEQLRHIPIK-QLEE--YIRPVSFIPETRSIDKLLKK 153

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +QE +  MA+VIDE+G T GLV+ EDI+  ++ +I  E+  ++ +I   +D +++ D  T
Sbjct: 154 MQEGKYHMAIVIDEYGQTAGLVTMEDIIEEIVGNIQDEYDEEEELIRQEADGSYLADGMT 213

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
           ++E+L +++G        E+D ++L G +   L+RIP   E  V+   G++  +L  +  
Sbjct: 214 EVEDLEELLGIQFE----EEDYETLNGFLIFHLERIPTEEENCVVSYGGYDFQVLSMENN 269

Query: 306 CVRRVRIRRLV 316
            ++ V+I++ V
Sbjct: 270 IIKTVQIKKRV 280


>gi|261418860|ref|YP_003252542.1| hypothetical protein GYMC61_1419 [Geobacillus sp. Y412MC61]
 gi|297531176|ref|YP_003672451.1| hypothetical protein GC56T3_2933 [Geobacillus sp. C56-T3]
 gi|319765678|ref|YP_004131179.1| hypothetical protein GYMC52_0541 [Geobacillus sp. Y412MC52]
 gi|261375317|gb|ACX78060.1| protein of unknown function DUF21 [Geobacillus sp. Y412MC61]
 gi|297254428|gb|ADI27874.1| protein of unknown function DUF21 [Geobacillus sp. C56-T3]
 gi|317110544|gb|ADU93036.1| protein of unknown function DUF21 [Geobacillus sp. Y412MC52]
          Length = 423

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 24/252 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+    EKE+    L F +I + +I   R  + AVE    + E   +F  EKY R  +P
Sbjct: 180 EGVIDNKEKELIQRSLDFDEILVGEIFTPRADMVAVEVNQPIEEIRDVFLEEKYSR--IP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D   + S +  K        ++   +L++  LFV  SM VSDLL
Sbjct: 238 VYEGDIDNVIGILSESD---FFSELVQKR-------EVRIRDLLRQPLFVVESMKVSDLL 287

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH      +  + +++F   A
Sbjct: 288 PELQKSKVHMAIVVDEFGGTAGLITLEDILEQIVGEIWDEHDEAVKTVRQIDEHSFEFSA 347

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E  +++  D      + +  +LGG IF + +RIPA GE +   P      L   V
Sbjct: 348 ELPLDEFCEVMNIDVP----KSESHTLGGWIFEMFERIPAVGETLQYGP------LTFTV 397

Query: 305 RCVRRVRIRRLV 316
           R V   RIR+++
Sbjct: 398 RQVDNRRIRKVL 409


>gi|310815237|ref|YP_003963201.1| CBS domain protein [Ketogulonicigenium vulgare Y25]
 gi|308753972|gb|ADO41901.1| CBS domain protein [Ketogulonicigenium vulgare Y25]
          Length = 239

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 124/236 (52%), Gaps = 10/236 (4%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
            I   R++ ++D+   +  I A+   ++    +  F + G S +PVY+ +LD P GMV++
Sbjct: 3   GIGNLRRLEVEDVATPKAEIVALPVDSSFDFLVETFRETGMSRIPVYEGTLDTPLGMVNL 62

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D ++      A     +L        +++ +L+VP SM +  LL  +Q  RI MALVID
Sbjct: 63  KD-LALKFGFGADVTGFDLR------GILRPVLYVPPSMPLGALLAKMQAERIHMALVID 115

Query: 200 EHGGTDGLVSYEDIV-SVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTD 258
           E+GGTDGL++ ED++ +V+          +   ++  S   +  DA   L+  A   G D
Sbjct: 116 EYGGTDGLLTIEDLIETVVGEIEDEHDIEELDDLTQESPLVWEADATVSLQNFAAQSGFD 175

Query: 259 CNCLKG--EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                G  E++V++LGGL F +   +P  GE++    G    +LDAD R ++R+RI
Sbjct: 176 LTADDGIDEEEVETLGGLAFMLSGDVPETGEIIAHPAGASFEVLDADNRRIKRLRI 231


>gi|88855035|ref|ZP_01129700.1| hemolysin containing CBS domains [marine actinobacterium PHSC20C1]
 gi|88815563|gb|EAR25420.1| hemolysin containing CBS domains [marine actinobacterium PHSC20C1]
          Length = 436

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 129/252 (51%), Gaps = 14/252 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  + ++++ ++I  F    +  +MI R  +  VE   T   AM +F   G S +PV  +
Sbjct: 179 VLDQDDRDLIHSIFEFNNTVVRGVMIPRTDMVTVEAGVTASAAMGLFLSRGVSRVPVIGD 238

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
            +D   G++++RDV   +     + +      +L+   L +  LFVP S     LL  +Q
Sbjct: 239 DIDQVMGVLYLRDVARVVYEQPIEAD------KLTTEQLARPALFVPESQRADSLLRQMQ 292

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
                +A+V+DE+GG  GLVS ED++  L+ DI+ E+  + +    ++D TF V AR  +
Sbjct: 293 LESNHLAMVVDEYGGIAGLVSLEDLIEELVGDISDEYDREVAEFEELADGTFRVSARLPI 352

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           +EL  + G + +    + +VDS+GGLI   L R+P  G V      +  ++L A+    R
Sbjct: 353 DELGDLFGLELD----DDEVDSVGGLIMKTLGRLPESGAVA----HYSGLVLTAERTEGR 404

Query: 309 RVRIRRLVHFKN 320
           R RI  ++  K+
Sbjct: 405 RKRISTVLVAKD 416


>gi|225849006|ref|YP_002729170.1| hemolysin homolog protein [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643303|gb|ACN98353.1| putative hemolysin homolog protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 428

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 130/253 (51%), Gaps = 14/253 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +AS   I +  EKE+ +N     +  + ++M+ R  I AVE   ++ E   + E    S 
Sbjct: 177 NASDLKIITTEEKELIDNTFELEEKTVIEVMVPRRDIFAVEKGISIRELTKLLEDKDYSR 236

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY   LDN  G++H++D+I  I  + AK   I+        + IK  LF+P    + +
Sbjct: 237 IPVYDGDLDNIVGILHLKDIIFLI--LEAKEEKID--------SFIKPALFLPEFTTLLE 286

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
            +    E++  +A+V++EHG T GL+SY+DI+  ++ DI  E    +  I  +++NT+IV
Sbjct: 287 AMKKFNETQQHLAIVVNEHGTTVGLLSYKDIIESIVGDIPEEFEPVEPAIRQINENTWIV 346

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
             +TD++ L + +G D   L  + D D++ G +     R P  GE   +   +   +L  
Sbjct: 347 LGKTDVDFLKEELGID---LPEDYDYDTVAGFLLDQFKRFPHEGE-YFDYKNYRFTVLQM 402

Query: 303 DVRCVRRVRIRRL 315
               V +V+I +L
Sbjct: 403 SFNRVEKVQIEKL 415


>gi|325681162|ref|ZP_08160692.1| CBS domain protein [Ruminococcus albus 8]
 gi|324107084|gb|EGC01370.1| CBS domain protein [Ruminococcus albus 8]
          Length = 438

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 122/220 (55%), Gaps = 11/220 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   E++ E+ +NI  F  I I ++M  R  + A+E+ A + EA+ +  + G S +PVYK
Sbjct: 201 GAIEESQAEMISNIFEFDDIEIGEVMTHRTEVAAIEESAPIREAVELAIESGFSRIPVYK 260

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +S+D+ +G+++ +D+++ + +  A+   +         + ++ ++F P S    +L   +
Sbjct: 261 DSIDDIQGVIYAKDLLTLVFNESAEDRTVR--------DFMREVVFAPESQKCGELFKEL 312

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
              +I+MA+ +DE+GGT G+V+ ED++  ++  I  E+  +   I+ +S+  F ++   D
Sbjct: 313 TAQKIQMAVAVDEYGGTAGVVTLEDLIETIVGKIEDEYDDEPEEITKISEGIFEIEGNAD 372

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            EE+ K +G + +        +++G ++  +L  IP  GE
Sbjct: 373 YEEVMKALGKEPD---DNSPFETIGAMVIELLGHIPEDGE 409


>gi|254995444|ref|ZP_05277634.1| hypothetical protein AmarM_05963 [Anaplasma marginale str.
           Mississippi]
 gi|255003634|ref|ZP_05278598.1| hypothetical protein AmarPR_05423 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004760|ref|ZP_05279561.1| hypothetical protein AmarV_05813 [Anaplasma marginale str.
           Virginia]
          Length = 286

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 145/276 (52%), Gaps = 20/276 (7%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           +R+   ++ L KL   K     RI A  E +       I NN++R  +  + DIM+ R  
Sbjct: 20  MRSFFYSFILEKLPGFKDFVKNRIMA--ENVLHFGSSHIMNNLVRLDECSVKDIMVQRSE 77

Query: 99  INAVE-DKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNIN 157
           I A+  D + +   +L   +   + +PVYK+++DN  G +H++D+ S           ++
Sbjct: 78  ILALGIDDSDLLTKVL---RSQHTRVPVYKDNIDNIVGFIHIKDITS--------KEGLD 126

Query: 158 LNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVL 217
            N++    ++I N+++VP SM   +L   +Q SR+ MA+V+DE+G TDGLV+  DI+  +
Sbjct: 127 FNVK----SIIHNVMYVPHSMKAVNLFVKMQSSRVHMAIVLDEYGSTDGLVTMADIIEEI 182

Query: 218 MRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIF 276
           + DI  EH       I  +S++   V+AR  +  L + +G      + E+ V ++GGLI 
Sbjct: 183 VGDIEDEHDVPSIPDIVNISNDKIEVNARVLVRTLEQSLGISLKDSEEEEYV-TVGGLIL 241

Query: 277 SVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +++ R+P   EV     G   +I + D RC+ RV I
Sbjct: 242 AMVGRVPVVDEVFNHKSGASFLIKEVDNRCIYRVVI 277


>gi|222475641|ref|YP_002564058.1| hypothetical protein AMF_984 [Anaplasma marginale str. Florida]
 gi|222419779|gb|ACM49802.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 293

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 145/276 (52%), Gaps = 20/276 (7%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           +R+   ++ L KL   K     RI A  E +       I NN++R  +  + DIM+ R  
Sbjct: 27  MRSFFYSFILEKLPGFKDFVKNRIMA--ENVLHFGSSHIMNNLVRLDECSVKDIMVQRSE 84

Query: 99  INAVE-DKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNIN 157
           I A+  D + +   +L   +   + +PVYK+++DN  G +H++D+ S           ++
Sbjct: 85  ILALGIDDSDLLTKVL---RSQHTRVPVYKDNIDNIVGFIHIKDITS--------KEGLD 133

Query: 158 LNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVL 217
            N++    ++I N+++VP SM   +L   +Q SR+ MA+V+DE+G TDGLV+  DI+  +
Sbjct: 134 FNVK----SIIHNVMYVPHSMKAVNLFVKMQSSRVHMAIVLDEYGSTDGLVTMADIIEEI 189

Query: 218 MRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIF 276
           + DI  EH       I  +S++   V+AR  +  L + +G      + E+ V ++GGLI 
Sbjct: 190 VGDIEDEHDVPSIPDIVNISNDKIEVNARVLVRTLEQSLGISLKDSEEEEYV-TVGGLIL 248

Query: 277 SVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +++ R+P   EV     G   +I + D RC+ RV I
Sbjct: 249 AMVGRVPVVDEVFNHKSGASFLIKEVDNRCIYRVVI 284


>gi|222056177|ref|YP_002538539.1| hypothetical protein [Geobacter sp. FRC-32]
 gi|221565466|gb|ACM21438.1| CBS domain containing protein [Geobacter sp. FRC-32]
          Length = 284

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 128/239 (53%), Gaps = 14/239 (5%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           ++  +I       + +IM+ R  +  V   A V E +      G S +PVY+ ++DN  G
Sbjct: 50  QMIRSIFALGDTVVREIMVPRTDMACVSSDAGVKEVLAAIIACGHSRIPVYEGTIDNIIG 109

Query: 136 MVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMA 195
           +++ +D++ Y      + + I L        ++++  F+P +  + +LL   ++ R+ +A
Sbjct: 110 LIYAKDLLKYWG---MEASAIVLK------KIVRSPYFIPETKNLEELLHEFKKKRVHIA 160

Query: 196 LVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKII 255
           +VIDE+GGT GLV+ ED++  ++ DI  E+  ++  +    D +  VDAR  +EEL +  
Sbjct: 161 IVIDEYGGTSGLVTIEDLLEQIVGDIQDEYDLEEDWLVEEGDGSVTVDARLPIEELEEHF 220

Query: 256 GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             D       +  D++GGLIF +L RIPA GE V +     + +L+AD R + +VRI R
Sbjct: 221 QIDIE----REKFDTVGGLIFHLLGRIPASGEEV-DNHHIHMTVLEADERRISKVRIAR 274


>gi|56419163|ref|YP_146481.1| hypothetical protein GK0628 [Geobacillus kaustophilus HTA426]
 gi|56379005|dbj|BAD74913.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 423

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 128/248 (51%), Gaps = 19/248 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+    EKE+    L F +I + +I   R  + AVE    + E   +F  EKY R  +P
Sbjct: 180 EGVIDNKEKELIQRSLDFDEILVGEIFTPRADMVAVEVNQPIEEIRDVFLEEKYSR--IP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D   + S +  K        ++   +L++  LFV  SM VSDLL
Sbjct: 238 VYEGDIDNVIGILSESD---FFSELVQKR-------EVRIRDLLRQPLFVVESMKVSDLL 287

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH      +  + +++F   A
Sbjct: 288 PELQKSKVHMAIVVDEFGGTAGLITLEDILEQIVGEIWDEHDEAVKTVRQIDEHSFEFSA 347

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E  +++  D        +  +LGG IF + +RIPA GE  L+       +   D 
Sbjct: 348 ELPLDEFCEVMNIDVP----RSESHTLGGWIFEMFERIPAVGE-TLQYGSLTFTVRQVDN 402

Query: 305 RCVRRVRI 312
           R +R+V +
Sbjct: 403 RRIRKVLV 410


>gi|220905198|ref|YP_002480510.1| CBS domain containing protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869497|gb|ACL49832.1| CBS domain containing protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 371

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 130/252 (51%), Gaps = 15/252 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  EG     E+ +   ILRF  +++ D MI R  I+ V     + E   +  + G S
Sbjct: 32  LEARAEGEVEPDEESMLLGILRFNDLQVQDTMIPRTDIDCVPHDMPMAEVAAIIVRSGHS 91

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +PVYK + DN  G++H +D++  +     K +++        + LI+   FVP +  + 
Sbjct: 92  RIPVYKETRDNIVGILHAKDLLRSMLDGEGKVSSL--------AGLIREPFFVPETKSIR 143

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTF 240
            LL   +  +  +A+ +DE+GGT GL++ ED++  ++ DI  EH + +   I  V DN +
Sbjct: 144 TLLQEFRARKQHIAIALDEYGGTSGLITIEDVLEEIVGDIEDEHDTPREEDIRPVGDNIY 203

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
            +  R  LE+L   +G D +      +VD++GG +      +PA GE    + G+   +L
Sbjct: 204 ELTGRALLEDLED-MGVDLDS----DEVDTIGGYLSMEAGHVPAPGE-SFTLRGWTFTVL 257

Query: 301 DADVRCVRRVRI 312
           +AD + + R+R+
Sbjct: 258 EADRKLILRLRM 269


>gi|257065908|ref|YP_003152164.1| hypothetical protein Apre_0394 [Anaerococcus prevotii DSM 20548]
 gi|256797788|gb|ACV28443.1| protein of unknown function DUF21 [Anaerococcus prevotii DSM 20548]
          Length = 414

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 128/247 (51%), Gaps = 15/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E E+ NN+  F    + DIM +R ++ A+     + E     +    S +PVY
Sbjct: 181 QGVINNEESEMINNVFEFGNSDVSDIMTARTNMEAIPVDLPIDELKAFLKSSNHSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++DN  G++HM+D++S   HM  + N+I L       + I+   +V  +M + DL T 
Sbjct: 241 GRNIDNVLGILHMKDLVS---HM-VQENDIKL------IDCIRPAYYVYDNMHIFDLFTT 290

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++   + +A+VIDE+GGT GLV+ EDIV  L+ +I  E+ S    I  ++D  ++V+   
Sbjct: 291 MRGENLSLAIVIDEYGGTSGLVTIEDIVEELVGEIDDEYDSAYETIYKINDKEYLVNPSI 350

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L +      TD   +K     DS+GG +   L RIP +G+ + +I    I +L  D   
Sbjct: 351 HLNDFNDYFDTDLEEIKN----DSIGGFVIDKLSRIPNKGDSI-KINNMTITVLQVDRYK 405

Query: 307 VRRVRIR 313
           +  +++ 
Sbjct: 406 IEMLKVN 412


>gi|225572060|ref|ZP_03780924.1| hypothetical protein RUMHYD_00354 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040495|gb|EEG50741.1| hypothetical protein RUMHYD_00354 [Blautia hydrogenotrophica DSM
           10507]
          Length = 460

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 142/253 (56%), Gaps = 8/253 (3%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  +G+  E+E E+  N++ F +    DIM  R++I A++ + T+ +A+ +  + G S 
Sbjct: 204 EAHEQGVIEESEAEMIQNLISFSEKEAKDIMTPRMNITALDAQMTLNDAIEIMLEEGYSR 263

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY   LDN  G+++ RDV+  I+    K+             LI++++F+P +  ++ 
Sbjct: 264 YPVYVEDLDNILGVLNFRDVVPIIT----KSERAGERPLRELPGLIRSVVFIPETRGINQ 319

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           +L  +Q  +  M +V+DE+G T+GLV+ EDI+  ++ +I  E+  +++ I    D + I+
Sbjct: 320 ILQGMQARKTHMVVVVDEYGQTEGLVAMEDILEEIVGEIHDEYDEEEANIQPQLDQSVII 379

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           D  T LEEL + +G +     G+Q++++L G +  +LD IP   +  +   G+   IL  
Sbjct: 380 DGFTRLEELEEELGMEF----GDQEMETLNGYLTYMLDHIPTIKDKEVIANGYRFEILSV 435

Query: 303 DVRCVRRVRIRRL 315
           +   +++V+ R+L
Sbjct: 436 ENNTIQKVKARKL 448


>gi|212696590|ref|ZP_03304718.1| hypothetical protein ANHYDRO_01130 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676321|gb|EEB35928.1| hypothetical protein ANHYDRO_01130 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 406

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E EI NN+  F      DIM  R ++ A+   ++  E      +   S +PVY
Sbjct: 170 QGVINNEESEIINNVFDFGGSFASDIMTPRTNMEAIAIDSSKKEFDEFLIECKHSRIPVY 229

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G++HM+D++++++             ++   ++++   +   +M + DL  +
Sbjct: 230 GESIDNIVGVLHMKDIVTFVAE----------GREVILKDMLRQTFYAYENMNIIDLFKS 279

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++  + +A+V+DE+GGT+GLVS EDI+  L+ DI  E+      +  VSDN FIVDA  
Sbjct: 280 MKKMNVSLAIVVDEYGGTEGLVSIEDIIEELVGDIYDEYDPDDEKVYKVSDNEFIVDASM 339

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            + +       +   +K     DS+GGL+   L+R+P  G+VV
Sbjct: 340 HINDFNDYFNRNLQEVKN----DSIGGLVIDYLNRLPKSGDVV 378


>gi|168333368|ref|ZP_02691648.1| hypothetical protein Epulo_00794 [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 440

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+  N+  F      DIMI R  + A++  AT  E + ++++Y  S MPV+
Sbjct: 191 EGVIEAVEKEMITNVFDFGDSFAKDIMIPRTDMVAIDVDATYDEIIQLYKEYQFSRMPVF 250

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S DN  GM++++D+      +  + N  N NI+    N+++   FV      ++LL  
Sbjct: 251 EESHDNIVGMIYIKDL------LLQQFNQDNFNIK----NVLREPYFVHEFKRTAELLKE 300

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I MA V+DE+GGT GL + ED+V  ++ ++  E+        AV +N +IVD  +
Sbjct: 301 LRQKKIVMAFVVDEYGGTSGLXTLEDLVEEIVGELEDEYDIINENFVAVGENEYIVDGSS 360

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            + +    +G          + DS+GG +  +LD+ P  GEV+
Sbjct: 361 KISDFNDRLGLKIES----NEYDSVGGYLIGLLDKFPHDGEVI 399


>gi|313205332|ref|YP_004043989.1| gliding motility-associated protein glde [Paludibacter
           propionicigenes WB4]
 gi|312444648|gb|ADQ81004.1| gliding motility-associated protein GldE [Paludibacter
           propionicigenes WB4]
          Length = 445

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 151/272 (55%), Gaps = 16/272 (5%)

Query: 53  HHKGIRLPRIDASLEGIFS--ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE 110
           +H  I +  +  +LE   +  + + EI   I++F  I++ DIM SRV +  + D  T Y+
Sbjct: 182 NHSNISMDELSHALELTSNNKDEDTEILEGIIKFGNIQVVDIMTSRVDM-VIVDIKTNYK 240

Query: 111 AMLMFE-KYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK 169
            +L  + + G S +PVY  + DN +G+++ +D++    H+    N            LI+
Sbjct: 241 KLLEIKIESGYSRIPVYAGTRDNIKGLLYSKDLLP---HLDKPAN-------FRWQTLIR 290

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
              +VP +  + DLL   Q +++ +A+V+DE+GGT GLV+ EDI+  ++ DI+ E+ +++
Sbjct: 291 PAYYVPETKKIDDLLNEFQTNKVHLAIVVDEYGGTSGLVTLEDILEEIVGDISDEYDNEE 350

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGT-DCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
            + + + ++TFI +A+  L +  KI    + + +K  ++V++L GLI  +   IP + E 
Sbjct: 351 VLFTKIDNHTFIFEAKILLNDFFKIAEIEEDDFVKVTEEVETLAGLILELKGDIPTKNER 410

Query: 289 VLEIPGFEIVILDADVRCVRRVRIRRLVHFKN 320
           + +   +   I+ AD R +++V++     FKN
Sbjct: 411 I-DYGRYVFEIVAADNRRIKKVKLYIKDDFKN 441


>gi|255038185|ref|YP_003088806.1| CBS domain containing protein [Dyadobacter fermentans DSM 18053]
 gi|254950941|gb|ACT95641.1| CBS domain containing protein [Dyadobacter fermentans DSM 18053]
          Length = 438

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 150/289 (51%), Gaps = 26/289 (8%)

Query: 36  TRTIRALCK--TWKLMKLSHHKGIRLPR--------IDASLEGIFSETEKEIFNNILRFR 85
           T+ +  +CK  T  +MKL +  G+  P         ++A  E   SE E ++   +  FR
Sbjct: 161 TQFLIKICKPLTQPVMKLGYSFGVLTPEGAEITTEMLEAKAE---SEEETDLLRGLANFR 217

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           +      M +RV I A + +   +E M    K G S +PVY++ LD+  G+++++D++ +
Sbjct: 218 QTIARKAMQARVQITAFDIELDFHELMDRINKSGYSRVPVYRDDLDHVEGILNVKDLLPH 277

Query: 146 ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTD 205
           I          +L+   +   L++ + F+P S  + DL+ + Q  R+ MA+V+DE+GGT 
Sbjct: 278 I----------HLDEHFNWQKLLRPVYFIPESKRLDDLMKDFQNRRVHMAIVVDEYGGTS 327

Query: 206 GLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCL-K 263
           GL++ EDI+  +  DI  E+   + +  + V ++T++ + +  + +L +++  + +   +
Sbjct: 328 GLITLEDIIEEIFGDINDEYDEDEEVNYTQVDEHTYVFEGKVLINDLCRLLNLETDYFDE 387

Query: 264 GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
              + +SL GL+  +  R+P  GE+          +  AD + +++VR+
Sbjct: 388 VRGNSESLAGLLLELFSRLPRTGEIATH-REVTFKVQSADKKRIKKVRV 435


>gi|295401070|ref|ZP_06811044.1| protein of unknown function DUF21 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976863|gb|EFG52467.1| protein of unknown function DUF21 [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 422

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 128/250 (51%), Gaps = 20/250 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    EKE+ +  L F +I + +I   R  + AVE    + E   +F K   S +PVY
Sbjct: 181 EGIIDNKEKELIHRSLDFDEILVGEIFTPRSDMVAVEVNQPIGEIRDVFLKEKYSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +DN  G++   D  S +     +   IN+        L++  LFV  SM +SDLL  
Sbjct: 241 EEDIDNVIGILSESDFFSEL----VQQKEINVR------ALLRKPLFVVESMKISDLLPE 290

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH     +I  + +N++  +A  
Sbjct: 291 FQKSKVHMAIVVDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKIIQQIDENSYEFNAEL 350

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L+E  +I+  +      E    +LGG IF + +R+P  GE +   P      L   V+ 
Sbjct: 351 PLDEFCEIMKIEA----PESSSHTLGGWIFEMFERVPNVGETLHYGP------LTLTVQQ 400

Query: 307 VRRVRIRRLV 316
           V   RIR+++
Sbjct: 401 VENRRIRKVL 410


>gi|311742995|ref|ZP_07716803.1| CBS domain protein [Aeromicrobium marinum DSM 15272]
 gi|311313675|gb|EFQ83584.1| CBS domain protein [Aeromicrobium marinum DSM 15272]
          Length = 438

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 138/259 (53%), Gaps = 26/259 (10%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A+   +    E ++  ++       + ++M+ R  I  +E   T+ ++M +  + G S +
Sbjct: 179 AAASSLIESDESKMIQSVFELGDTIVREVMVPRTDIVFIEQHKTLRQSMSLALRSGYSRL 238

Query: 124 PVYKNSLDNPRGMVHMRDVISYI--SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
           PV +++LD+  GM +++DV   +  +H       +        S++++  LFVP +    
Sbjct: 239 PVVEDNLDDVVGMAYLKDVTKRVFDNHTAEHAERV--------SSILRPCLFVPDTKHAD 290

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
           +LL  +Q  R  +A+V+DE GGT G+V+ EDI+  ++ +IT E+ ++   +  + D ++ 
Sbjct: 291 ELLKEMQAQRTHVAIVVDEFGGTAGMVTIEDILEEIVGEITDEYDTEPDELEVLVDGSWR 350

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI-- 299
           V +R D+++LA++ G D      ++DVDS+GGL+   L ++P        IPG  IVI  
Sbjct: 351 VSSRYDVDDLAELTGVDLQ----DEDVDSVGGLLAKHLGKVP--------IPGSAIVIEG 398

Query: 300 --LDADVRCVRRVRIRRLV 316
             L A+    RR RI R++
Sbjct: 399 LRLVAEAPSGRRNRIGRVL 417


>gi|225620348|ref|YP_002721605.1| Hemolysin C [Brachyspira hyodysenteriae WA1]
 gi|3023976|sp|Q54318|HLYC_TREHY RecName: Full=Hemolysin C
 gi|511148|emb|CAA51657.1| hemolysin [Brachyspira hyodysenteriae]
 gi|225215167|gb|ACN83901.1| Hemolysin C [Brachyspira hyodysenteriae WA1]
          Length = 268

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 136/246 (55%), Gaps = 16/246 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            +E E+EI  N +  +   + +IM+ RV +  +  +++  + +  F +   S +PVYK+ 
Sbjct: 29  LTEAEREIITNTIELKSKSVREIMVPRVDVVMIPMESSYDKVIKAFNRDRNSRIPVYKDG 88

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +D+  G+++++D+I       A+  N +L        ++   LFVP S+ + +LL N +E
Sbjct: 89  IDDIVGVLYVKDLID------AEEKNFSL------KKILHKPLFVPISISLMELLKNFRE 136

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
            +I +A+V+DE+GG  G+VS ED++  ++ DI  E+  +   I +  D T++VDART ++
Sbjct: 137 KQIHIAMVVDEYGGFSGIVSMEDVLEQIIGDIRDEYDEEDEEIKSNDDGTYLVDARTRID 196

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
           +  K    +      + + D++GG +FS L R+P R E + E  G+   ++      V +
Sbjct: 197 DFNK---YEILPPIPDDEADTVGGFLFSYLGRLPKRNEDI-EYNGYSFTVVGKSGNIVTK 252

Query: 310 VRIRRL 315
           +RI +L
Sbjct: 253 IRIEKL 258


>gi|322368036|ref|ZP_08042605.1| hypothetical protein ZOD2009_01100 [Haladaptatus paucihalophilus
           DX253]
 gi|320552052|gb|EFW93697.1| hypothetical protein ZOD2009_01100 [Haladaptatus paucihalophilus
           DX253]
          Length = 463

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 135/249 (54%), Gaps = 12/249 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E+E+   I RF      ++M  R+ + AV   A++ EA+    + G   +PVY
Sbjct: 209 EGVIEEDEREMLQRIFRFNNTIAKEVMTPRLDMTAVPQDASIDEAIETLVQSGHERVPVY 268

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + SLDN  G+V +RD++   ++   KT+ + L      SNLI+  L VP S  V +LLT 
Sbjct: 269 EGSLDNVIGIVTVRDLVREKNYGETKTDGLKL------SNLIQPTLHVPESKNVDELLTE 322

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++E+R++M +VIDE G T+GLV+ ED+V  ++ +I      +   I  V ++T IV    
Sbjct: 323 MRENRMQMVIVIDEFGTTEGLVTMEDMVEEIVGEILDGEEEEP--IERVDEDTVIVRGEV 380

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           +++E+ + +  +   L   ++ +++ G IF+   R+   GE + +  G  + +   +   
Sbjct: 381 NIDEVNEAMKIE---LPEGEEFETIAGFIFNRAGRLVEEGEDI-DYEGVRLHVEQVENTR 436

Query: 307 VRRVRIRRL 315
           + + RI RL
Sbjct: 437 IMKARITRL 445


>gi|325847166|ref|ZP_08169965.1| hypothetical protein HMPREF9246_1878 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325480946|gb|EGC83992.1| hypothetical protein HMPREF9246_1878 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 417

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E EI NN+  F      DIM  R ++ A+   ++  E      +   S +PVY
Sbjct: 181 QGVINNEESEIINNVFDFGGSFASDIMTPRTNMEAIAIDSSKKEFDEFLIECKHSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G++HM+D++++++             ++   ++++   +   +M + DL  +
Sbjct: 241 GESIDNIVGVLHMKDIVTFVAE----------GREVILKDMLRQTFYAYENMNIIDLFKS 290

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++  + +A+V+DE+GGT+GLVS EDI+  L+ DI  E+      +  VSDN FIVDA  
Sbjct: 291 MKKMNVSLAIVVDEYGGTEGLVSIEDIIEELVGDIYDEYDPDDEKVYKVSDNEFIVDASM 350

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            + +       +   +K     DS+GGL+   L+R+P  G+VV
Sbjct: 351 HINDFNDYFNRNLQEVKN----DSIGGLVIDYLNRLPKSGDVV 389


>gi|306820358|ref|ZP_07453996.1| HCC HlyC/CorC family transporter [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551579|gb|EFM39532.1| HCC HlyC/CorC family transporter [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 413

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 136/248 (54%), Gaps = 15/248 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E E+  NI  F+ + +DDIMI R+ I A+    +  E + +F+    S +P+Y
Sbjct: 180 EGVLETDETEMIQNIFEFKDLTVDDIMIQRMDIVAISSDMSYDEIIDVFKNKQLSRLPIY 239

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++++D+  G+++ +D+       + + +  + N++     L++  +FV   + +SD    
Sbjct: 240 EDTIDDIIGVLYAKDL------FFTEQSKEDFNLK----TLMREPVFVNEFVKISDFFKK 289

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q+ +  +A+V+DE+GG  G+V+ ED+V  ++ DI  E+  +   +  V +N ++++  +
Sbjct: 290 MQQVKTHIAIVLDEYGGVAGIVTMEDLVESIVGDIYDEYDQQDEEVRKVKENIYVINGNS 349

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L E+ +++  +       +D +SLGG +   + +IP +G+ + E   F+ VI   D   
Sbjct: 350 KLTEIQELLQVELIS----KDYESLGGYLMDKMGKIPTQGD-IYEDENFKFVISSMDKNR 404

Query: 307 VRRVRIRR 314
           + +V++ R
Sbjct: 405 INKVKVIR 412


>gi|312112154|ref|YP_003990470.1| hypothetical protein GY4MC1_3182 [Geobacillus sp. Y4.1MC1]
 gi|311217255|gb|ADP75859.1| protein of unknown function DUF21 [Geobacillus sp. Y4.1MC1]
          Length = 422

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 130/252 (51%), Gaps = 24/252 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEA--MLMFEKYGRSWMP 124
           EGI    EKE+ +  L F +I + +I   R  + AVE    + E   + + EKY R  +P
Sbjct: 181 EGIIDNKEKELIHRSLDFDEILVGEIFTPRSDMVAVEVNQPIGEIRDVFLTEKYSR--IP 238

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +DN  G++   D  S +     +   IN+        L++  LFV  SM +SDLL
Sbjct: 239 VYEEDIDNVIGILSESDFFSEL----VQQKEINVR------ALLRKPLFVVESMKISDLL 288

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
              Q+S++ MA+V+DE GGT GL++ EDI+  ++ +I  EH     +I  + +N++  +A
Sbjct: 289 PEFQKSKVHMAIVVDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKIIQQIDENSYEFNA 348

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              L+E  +I+  +      E    +LGG IF + +R+P  GE +   P      L   V
Sbjct: 349 ELPLDEFCEIMKIEA----PESSSHTLGGWIFEMFERVPNVGETLHYGP------LTLTV 398

Query: 305 RCVRRVRIRRLV 316
           + V   RIR+++
Sbjct: 399 QQVENRRIRKVL 410


>gi|298492858|ref|YP_003723035.1| hypothetical protein Aazo_4712 ['Nostoc azollae' 0708]
 gi|298234776|gb|ADI65912.1| protein of unknown function DUF21 ['Nostoc azollae' 0708]
          Length = 452

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 132/244 (54%), Gaps = 11/244 (4%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
           +E+E+ NN+  F  I  +D+MI R SI A+ + A+ +  +      G S  P+   SLD+
Sbjct: 215 SERELLNNVFEFGDITAEDVMIPRTSIIALPEDASFHTLLQEMILTGHSRYPIIGESLDD 274

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
             G+V+ +D+   ++     T  +NL  Q+     +++  FVP   L+S+LL  +Q+ + 
Sbjct: 275 ICGIVYFQDLARPLA-----TGKLNLETQIQP--WMRSPRFVPEQTLLSELLPMMQQEKP 327

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            M +V++E GGT GLV+ +D+++ ++ +      S   +I  +   TF+V A+ +LEEL 
Sbjct: 328 AMVIVVNEFGGTVGLVTIQDVIAEIIGNAGEPGISDDLLIQMLDKQTFLVQAQVNLEELN 387

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +++  +   ++   +  +LGG +     +IPA+GE +      E  ++      + +++I
Sbjct: 388 EVLHLNLPLIR---EYQTLGGFVLYQWQKIPAKGE-IFHYGNLEFTVISVIGPRLHQIQI 443

Query: 313 RRLV 316
           RRL+
Sbjct: 444 RRLL 447


>gi|78356850|ref|YP_388299.1| hypothetical protein Dde_1807 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219255|gb|ABB38604.1| CBS protein [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 298

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 141/252 (55%), Gaps = 14/252 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           I+A  +G     E  +  +ILR  ++++ +IM  R  I+  +D++++ + + +    G S
Sbjct: 56  IEAQDDGELDSEESTMLLSILRLDEMQVYEIMTPRTDIDCADDQSSLGDIIDLIVSSGHS 115

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +PVY+++ DN  G+V+ +D++S ++    ++  +        +  ++  +FVP +  VS
Sbjct: 116 RIPVYRDNRDNIIGVVYAKDLLSVLTDTGQRSAPV--------TETMRQPIFVPETKKVS 167

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTF 240
           +LL   +  +  +A+ +DE+GGT GLV+ ED++ V++ DI  EH + ++  I A+ D T 
Sbjct: 168 ELLQEFRTRKNHLAIALDEYGGTSGLVTIEDVLEVIVGDIEDEHDAPRQEDIRALDDGTL 227

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
            V  R  LE+L++ +G     L+ +Q V+++GG +  +   +P  GE    +      ++
Sbjct: 228 EVSGRAFLEDLSERLGV---LLESDQ-VETIGGYLSEIAGHVPQAGE-SFTVGAHSYTVM 282

Query: 301 DADVRCVRRVRI 312
           +AD + ++ +R+
Sbjct: 283 EADAKQIKTIRV 294


>gi|312890380|ref|ZP_07749917.1| protein of unknown function DUF21 [Mucilaginibacter paludis DSM
           18603]
 gi|311297150|gb|EFQ74282.1| protein of unknown function DUF21 [Mucilaginibacter paludis DSM
           18603]
          Length = 447

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 139/267 (52%), Gaps = 16/267 (5%)

Query: 52  SHHKGIRLPRI-DASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVY 109
           +HH    L  + D   E G     E E+  N+  F +  + +IM+ R  I+ VE   +  
Sbjct: 186 AHHSSEELQYLLDQGKESGAIDSNEHELIKNVFDFNERVVKNIMVPRTKISGVEMNCSQK 245

Query: 110 EAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIK 169
           E +      G S MPVY  ++D   G+VH +D++  I        +++ N++    ++I+
Sbjct: 246 ELLDEIISEGYSRMPVYDETIDKIIGIVHAKDILPLI------VGHVDFNLK----DIIR 295

Query: 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK 229
              F+P +  +++L+  +Q+ RI++A+V+DE GGT G+V+ EDIV  L+ +I  E+  +K
Sbjct: 296 KPYFIPETKKINNLMAELQQKRIQIAIVLDEFGGTAGMVTLEDIVEELVGEIQDEYDEEK 355

Query: 230 SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            ++  +SD  F+V+A   + ++   +  D   L  + D D++ G +  V  +IP  GE  
Sbjct: 356 PIVEKLSDREFVVNALASIYDVNGFLPHD---LPEDGDFDTVSGWLGDVFGKIPEVGE-Q 411

Query: 290 LEIPGFEIVILDADVRCVRRVRIRRLV 316
            E  G+ I +L    + +  V++  L+
Sbjct: 412 KEANGYNITVLRKSDQNIESVKLELLI 438


>gi|332300827|ref|YP_004442748.1| gliding motility-associated protein GldE [Porphyromonas
           asaccharolytica DSM 20707]
 gi|332177890|gb|AEE13580.1| gliding motility-associated protein GldE [Porphyromonas
           asaccharolytica DSM 20707]
          Length = 452

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 145/301 (48%), Gaps = 29/301 (9%)

Query: 23  SPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETE-----KEI 77
           +P++S       W    + L KT KL+  +  KG  L   D S E +   TE      E+
Sbjct: 151 APAVSGLYKGIAWCS--KGLIKTSKLLGSNAKKGHELSVDDLS-EAVALTTEGDNKETEM 207

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
            + I++F     D+IM+ RV +  V      ++ +      G S +PVY  S D+ RG++
Sbjct: 208 IHEIVKFYHKTADEIMVPRVDMVGVNYHWAYHQTLSYAVDTGYSRLPVYDGSQDSIRGVL 267

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           +++D++    HM+ +              +I+   FVP +  +  LL  +Q+ RI MA+V
Sbjct: 268 YVKDLLP---HMHEEDT-------FPWQKIIRQAYFVPENKKIDTLLEELQQERIHMAIV 317

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGT 257
           IDE GGT GL++ EDI+  ++ +I  E+  +      +++  +++D    L +L K++  
Sbjct: 318 IDEFGGTSGLITLEDILEEIVGEIVDEYDDEDPPYVRLAEGVYLIDGGMSLIDLCKLLDV 377

Query: 258 DCNCLKGE-QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR--RVRIRR 314
           +        ++VD++GGL   VL  IP  G+        +I I D D    R  R RI +
Sbjct: 378 EPEYFAPHYEEVDTVGGLFLEVLQEIPQVGQ--------QITISDIDFTVTRMDRHRIMQ 429

Query: 315 L 315
           L
Sbjct: 430 L 430


>gi|311113630|ref|YP_003984852.1| magnesium and cobalt efflux protein CorC [Rothia dentocariosa ATCC
           17931]
 gi|310945124|gb|ADP41418.1| magnesium and cobalt efflux protein CorC [Rothia dentocariosa ATCC
           17931]
          Length = 455

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 124/220 (56%), Gaps = 12/220 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E +I  ++      RI  IM+ R  +  VE   ++  A+ +F + G S MPV   S D+ 
Sbjct: 190 EAQIVQSVFELDDTRIRSIMVPRTDMLTVEANESIENALSLFLRSGYSRMPVIGESNDDV 249

Query: 134 RGMVHMRDVISYISHM-YAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G+++++D +   +H+ Y++ +    +I     +L++   F P S  V DLL  +Q    
Sbjct: 250 LGILYLKDCMQ--AHLAYSRGDAPEPSI----ISLMREARFEPESKKVMDLLRQMQREST 303

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            +A+V+DE+GGT G+V+ ED++  L+ DI+ E+ ++K   S   D +F V AR  +E+L 
Sbjct: 304 HVAVVVDEYGGTAGMVTLEDLIEELVGDISDEYDNEKPEYSLQEDGSFKVSARLSIEDLG 363

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLE 291
           +I G D +    ++DVD++GGL+   L ++P  G EV +E
Sbjct: 364 EIFGIDLD----DEDVDTVGGLLAKHLGKVPIVGSEVTVE 399


>gi|72161250|ref|YP_288907.1| CBS domain-containing protein [Thermobifida fusca YX]
 gi|71914982|gb|AAZ54884.1| CBS domain protein [Thermobifida fusca YX]
          Length = 439

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 121/218 (55%), Gaps = 5/218 (2%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +    E+++ +++ +     + ++MI R  I  +E   ++ EA+      G S +PV   
Sbjct: 185 VIDPEERQMIHSVFQLDDTTVREVMIPRPDIVFLEGNVSIEEALEKALSSGYSRIPVIGE 244

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           SLD+  G+V+++D+++ +   + + N        +  ++++   +VP S  V +LL  +Q
Sbjct: 245 SLDDVIGIVYLKDLVARLYDAW-RANGGAPAPGRTIRDVMREPTYVPDSKPVDELLREMQ 303

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
           + RI +A+VIDE+GGT G+V+ EDIV  ++ +IT E+  +   I  + DN   V AR  L
Sbjct: 304 QQRIHLAVVIDEYGGTAGIVTIEDIVEEIVGEITDEYDDEVPPIEWLDDNRARVTARLPL 363

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            ELA++ G + +      DVD++GGL+   L R+P  G
Sbjct: 364 GELAELFGVEIDA----PDVDTVGGLLAYALGRVPVPG 397


>gi|303242425|ref|ZP_07328907.1| protein of unknown function DUF21 [Acetivibrio cellulolyticus CD2]
 gi|302590010|gb|EFL59776.1| protein of unknown function DUF21 [Acetivibrio cellulolyticus CD2]
          Length = 432

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 129/250 (51%), Gaps = 16/250 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G   ETEKE+ NNI  F    + +IM  R  I A+   A++ E +  +  EKY R  +PV
Sbjct: 195 GAIDETEKEMINNIFEFNNKIVSEIMTHRTEIAALPVDASLDEVIDFINLEKYSR--IPV 252

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y++S+DN  G++H + +I Y++    K        +    NL++   FVP+S    +L  
Sbjct: 253 YEDSIDNIVGIMHSKYLIKYLTEDGDKE-------KFDLKNLVRKPYFVPASKRTDELFK 305

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q +   +A++IDE+GGT G+VS ED++  ++ +I  E    +  I  + +NTFI++  
Sbjct: 306 ELQRNSTHIAVIIDEYGGTAGIVSLEDLIEEIVGNIFDEDDEIEKDIDKLDENTFIINGT 365

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV-VLEIPGFEIVILDADV 304
           T L  +   +  D       +D D+L G +   L RIP + +   +E  G    +   D 
Sbjct: 366 TSLVTVRDYLDVDLPT----EDYDTLSGFVIGQLGRIPDKDDSPSIEFNGLVFKVAKVDE 421

Query: 305 RCVRRVRIRR 314
           + V +V++ R
Sbjct: 422 KRVAKVKVCR 431


>gi|227495127|ref|ZP_03925443.1| HCC HlyC/CorC family transporter [Actinomyces coleocanis DSM 15436]
 gi|226831579|gb|EEH63962.1| HCC HlyC/CorC family transporter [Actinomyces coleocanis DSM 15436]
          Length = 429

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 123/218 (56%), Gaps = 11/218 (5%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           F E ++E+  ++       + ++M+ R  +  +  + T+ EA+ +F   G S +PV ++ 
Sbjct: 186 FEEEDREMLRSVFELGYTLVREVMVPRTEMVTIAAETTIDEALDLFVTSGYSRIPVIEDD 245

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +D+  G+V+ +DVIS +     + ++  + ++    N+ +   FVP  +L  D L  +Q 
Sbjct: 246 IDDIVGIVYFKDVISRLRR---RPDDKQVPVR----NVCREPRFVPEVVLADDELRQMQA 298

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           SR+ +ALV+DE+GG  GLV+ ED++  ++ ++T EH    +    +S+  + V AR  L 
Sbjct: 299 SRVHLALVVDEYGGIAGLVTIEDLLEEIVGELTDEHDRNVTQPEEISEGVWRVPARFSLW 358

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           EL +++G +      ++DVDS+GG +  +L ++P  G+
Sbjct: 359 ELGELLGVELE----DEDVDSVGGYLAKLLGKVPLPGD 392


>gi|150008606|ref|YP_001303349.1| hemolysin-like protein [Parabacteroides distasonis ATCC 8503]
 gi|298376128|ref|ZP_06986084.1| CBS domain protein [Bacteroides sp. 3_1_19]
 gi|149937030|gb|ABR43727.1| hemolysin-related protein [Parabacteroides distasonis ATCC 8503]
 gi|298267165|gb|EFI08822.1| CBS domain protein [Bacteroides sp. 3_1_19]
          Length = 450

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 132/245 (53%), Gaps = 12/245 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+   I++F     D+IM  R+ +  +E K +  E +    K G S +PVY  + DN 
Sbjct: 205 EKEMLAEIIKFYNKTADEIMTPRLDMEDIEIKISFREVVDFIIKSGYSRIPVYSETEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ YI     K +           +LI+   FVP +  + DLL   + ++I 
Sbjct: 265 KGILYIKDLLPYID----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEQQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D +   K  ++V++L GL+  +    P R E++ +   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPSDFGKLTEEVETLAGLLLEIKGDFPRRREII-DFKEYRFQVLEVDNRRILKVKF 433

Query: 313 RRLVH 317
            R++ 
Sbjct: 434 NRILE 438


>gi|325963342|ref|YP_004241248.1| CBS domain-containing protein [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469429|gb|ADX73114.1| CBS domain-containing protein [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 443

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 135/253 (53%), Gaps = 14/253 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           AS   +  +TE E+  ++  F    +  +M+ R  I  +E  +++ +AM +F + G S +
Sbjct: 174 ASESDMIEDTEAEMIQSVFDFGDTLVRAVMVPRTDILTIEAGSSLRQAMSLFLRSGYSRI 233

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S D   G+++++DV + I  +        +       +L + + +VP S  VSDL
Sbjct: 234 PVIGESTDQILGIIYLKDVAAVIHELAPNEEPPPVE------SLAREVRYVPESKPVSDL 287

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+    +A+VIDE+GGT GLV+ ED++  ++ +I  E+ ++ +    + D ++ V 
Sbjct: 288 LRELQKESTHVAIVIDEYGGTAGLVTLEDLIEEIVGEIVDEYDTESAEAVELGDGSYRVS 347

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +++L ++   + +    + +VD++GGL+   L R+P  G  V E+ G   V L AD
Sbjct: 348 ARMGIDDLGELFDIELD----DDEVDTVGGLLAKALGRVPIVGSTV-EVHG---VSLRAD 399

Query: 304 VRCVRRVRIRRLV 316
               RR R+  ++
Sbjct: 400 RLEGRRNRVSHII 412


>gi|301309504|ref|ZP_07215446.1| CBS domain protein [Bacteroides sp. 20_3]
 gi|300832593|gb|EFK63221.1| CBS domain protein [Bacteroides sp. 20_3]
          Length = 450

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 132/245 (53%), Gaps = 12/245 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+   I++F     D+IM  R+ +  +E K +  E +    K G S +PVY  + DN 
Sbjct: 205 EKEMLAEIIKFYNKTADEIMTPRLDMEDIEIKISFREVVDFIIKSGYSRIPVYSETEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ YI     K +           +LI+   FVP +  + DLL   + ++I 
Sbjct: 265 KGILYIKDLLPYID----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEQQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D +   K  ++V++L GL+  +    P R E++ +   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPSDFGKLTEEVETLAGLLLEIKGDFPRRREII-DFKEYRFQVLEVDNRRILKVKF 433

Query: 313 RRLVH 317
            R++ 
Sbjct: 434 NRILE 438


>gi|330469594|ref|YP_004407337.1| CBS domain-containing protein [Verrucosispora maris AB-18-032]
 gi|328812565|gb|AEB46737.1| CBS domain-containing protein [Verrucosispora maris AB-18-032]
          Length = 460

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 134/249 (53%), Gaps = 14/249 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+    E+++ +++         ++M+ R  +  +E   T+ +A+ +F + G S +
Sbjct: 187 AEQRGVVEHGERQMIHSVFALGDTIAREVMVPRTEMVWIESTKTLAQALALFLRSGFSRI 246

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S+D+  G+++++D+I       A+      + QL  + L++   FVP S  V DL
Sbjct: 247 PVIGESVDDVLGVLYLKDLIRRTQGGAAE------DRQLPVAELMRPATFVPDSKPVDDL 300

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L+ +Q +R  + +V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  I  + D    V 
Sbjct: 301 LSEMQAARNHLVIVVDEYGGTGGLVTIEDILEEIVGEITDEYDVERPPIEQLPDGAVRVT 360

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +E+L ++  T+        +V+++GGL+   L R+P  G  V E+ G +++   A+
Sbjct: 361 ARLPVEDLGELFDTELP----HDEVETVGGLLAQCLGRVPIPGAEV-EVAGLQLL---AE 412

Query: 304 VRCVRRVRI 312
               RR RI
Sbjct: 413 GTTGRRNRI 421


>gi|313887399|ref|ZP_07821089.1| gliding motility-associated protein GldE [Porphyromonas
           asaccharolytica PR426713P-I]
 gi|312923167|gb|EFR33986.1| gliding motility-associated protein GldE [Porphyromonas
           asaccharolytica PR426713P-I]
          Length = 452

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/301 (27%), Positives = 145/301 (48%), Gaps = 29/301 (9%)

Query: 23  SPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETE-----KEI 77
           +P++S       W    + L KT KL+  +  KG  L   D S E +   TE      E+
Sbjct: 151 APAVSGLYKGIAWCS--KGLIKTSKLLGSNAKKGHELSVDDLS-EAVALTTEGDNKETEM 207

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
            + I++F     D+IM+ RV +  V      ++ +      G S +PVY  S D+ RG++
Sbjct: 208 IHEIVKFYHKTADEIMVPRVDMVGVNYHWAYHQTLSYAVDTGYSRLPVYDGSQDSIRGVL 267

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           +++D++    HM+ +              +I+   FVP +  +  LL  +Q+ RI MA+V
Sbjct: 268 YVKDLLP---HMHEEDT-------FPWQKIIRQAYFVPENKKIDTLLEELQQERIHMAIV 317

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGT 257
           IDE GGT GL++ EDI+  ++ +I  E+  +      +++  +++D    L +L K++  
Sbjct: 318 IDEFGGTSGLITLEDILEEIVGEIVDEYDDEDPPYVRLAEGVYLIDGGMSLIDLCKLLDV 377

Query: 258 DCNCLKGE-QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR--RVRIRR 314
           +        ++VD++GGL   VL  IP  G+        ++ I D D    R  R RI +
Sbjct: 378 EPEYFAPHYEEVDTVGGLFLEVLQEIPQVGQ--------QVTISDIDFTVTRMDRHRIMQ 429

Query: 315 L 315
           L
Sbjct: 430 L 430


>gi|253578410|ref|ZP_04855682.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850728|gb|EES78686.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 459

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 133/255 (52%), Gaps = 12/255 (4%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  +G+  E E E+  NI+ F +    DIM  R ++ A +++  +   +    + G S 
Sbjct: 208 EAHEQGVIQENEAEMIQNIISFNETEAHDIMTHRKNVVAFDEEILLKNMIDTMLEEGNSR 267

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISH-MYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            PVY+ ++DN +G+VH +D + +++   +AK   +          +I+    +P +  + 
Sbjct: 268 YPVYEENIDNIKGIVHYKDALKFMTQNPWAKFKPLK-----ELPGIIRQASLIPETRGIG 322

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
           DL   +Q  +I MA+V+DE+G T G+V+ EDI+  ++ DI  E+   +  I A  DN+ I
Sbjct: 323 DLFHTMQARKIHMAIVVDEYGQTAGIVTMEDILEEIVGDILDEYDEDEITIRAQKDNSLI 382

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP--GFEIVI 299
           +D    LE++ + +  D     G+ + ++L G + ++L  IPA  +V   I   G+   I
Sbjct: 383 IDGLAYLEDVEEELDADF----GDTEFETLNGYLTNILGHIPADKDVNTSIKAIGYCFTI 438

Query: 300 LDADVRCVRRVRIRR 314
           L    + + +V++ R
Sbjct: 439 LSIGNKTIGKVKVER 453


>gi|300741537|ref|ZP_07071558.1| integral membrane transporter with CBS domains [Rothia dentocariosa
           M567]
 gi|300380722|gb|EFJ77284.1| integral membrane transporter with CBS domains [Rothia dentocariosa
           M567]
          Length = 450

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 122/220 (55%), Gaps = 12/220 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E +I  ++      RI  IM+ R  +  VE   ++  A+ +F + G S MPV   S D+ 
Sbjct: 190 EAQIVQSVFELDDTRIRSIMVPRTDMLTVEANESIENALSLFLRSGYSRMPVIGESNDDV 249

Query: 134 RGMVHMRDVI-SYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G+++++D + ++++H        ++       +L++   F P S  V DLL  +Q    
Sbjct: 250 LGILYLKDCMQAHLAHSRGDAPEPSI------ISLMREARFEPESKKVMDLLRQMQREST 303

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            +A+V+DE+GGT G+V+ ED++  L+ DI+ E+ ++K   S   D +F V AR  +E+L 
Sbjct: 304 HVAVVVDEYGGTAGMVTLEDLIEELVGDISDEYDNEKPEYSLQEDGSFKVSARLSVEDLG 363

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLE 291
           +I G D +    ++DVD++GGL+   L ++P  G EV +E
Sbjct: 364 EIFGIDLD----DEDVDTVGGLLAKHLGKVPIVGSEVTVE 399


>gi|86605702|ref|YP_474465.1| HlyC/CorC (HCC) family transporter [Synechococcus sp. JA-3-3Ab]
 gi|86554244|gb|ABC99202.1| putative transporter, HlyC/CorC (HCC) family [Synechococcus sp.
           JA-3-3Ab]
          Length = 477

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 130/230 (56%), Gaps = 15/230 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           I +S+E G     E+E+ +NI  F +    ++MI R SI+AV + ATV E +    + G 
Sbjct: 211 IASSVESGNIEAEERELLSNIFEFGETVASEVMIPRTSIDAVPETATVQEVLAEVAESGH 270

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S  PVY  SLD+ RG++H++++I  ++       +I+L+  +  +N I+   F P +  +
Sbjct: 271 SRYPVYGESLDDIRGLIHVKELIGQLAK-----GSIDLHSPI--TNFIREAHFEPENKPI 323

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT--SEHHSKKSMISAVSDN 238
           ++LL  +++    M +++DE GGT GL++ +D+V  ++  ++   +  +K++ I  + +N
Sbjct: 324 AELLPEMRQHHWPMVVLVDEFGGTAGLITIQDLVEEIVGKLSDGPDPKAKEADIQELDEN 383

Query: 239 TFIVDARTDLEELAKIIGTDCNC-LKGEQDVDSLGGLIFSVLDRIPARGE 287
           T ++ A+ D+EE    +   C+  L   +D  +LGG +   L +IP  GE
Sbjct: 384 TLLIQAQLDIEE----VNERCHLNLPLHEDYQTLGGFLIYHLQKIPRVGE 429


>gi|294673597|ref|YP_003574213.1| hypothetical protein PRU_0860 [Prevotella ruminicola 23]
 gi|294473500|gb|ADE82889.1| CBS/transporter associated domain protein [Prevotella ruminicola
           23]
          Length = 425

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 114/218 (52%), Gaps = 11/218 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F + +I D M+ R  I+AVED  T+ +   +F + G S + VY   +D
Sbjct: 193 EEEVKIFQNALDFSETKIRDCMVPRTEIDAVEDTDTIEQLRQVFIESGHSKILVYHEDID 252

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  D       M+    N N    +    L++ I FVP +ML S L+T + + +
Sbjct: 253 HIIGYVHSSD-------MFRLDKN-NYQSSIVNCQLVREISFVPETMLASKLMTQLMQQK 304

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             +A+V+DE GGT GLVS EDI+  +  +I  EH +   +   +SD+ +++ AR ++ ++
Sbjct: 305 RSLAVVVDEFGGTSGLVSLEDIMEEITGEIEDEHDNTNHVAKQLSDHEYMLSARLEIAKI 364

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            ++   D   L    +  +LGGLI       P   EVV
Sbjct: 365 NEMFDLD---LPESDEYMTLGGLILHEYQSFPKLNEVV 399


>gi|220912721|ref|YP_002488030.1| CBS domain containing protein [Arthrobacter chlorophenolicus A6]
 gi|219859599|gb|ACL39941.1| CBS domain containing protein [Arthrobacter chlorophenolicus A6]
          Length = 443

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 138/253 (54%), Gaps = 14/253 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           AS   +  +TE E+  ++  F    +  +M+ R  I  ++  ++++EAM +F + G S +
Sbjct: 174 ASESDMIEDTEAEMIQSVFDFGDTLVRAVMVPRTDIVGIDSGSSLHEAMSLFLRSGYSRV 233

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV     D+  G+V+++DV + +  + A      ++      ++ + + +VP S  VSDL
Sbjct: 234 PVIGEDTDHILGIVYLKDVAAVVHELDAGVEPPTVD------SMAREVRYVPESKPVSDL 287

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+    +A+VIDE+GGT GLV+ ED++  ++ +I  E+ ++ +    + D ++ V 
Sbjct: 288 LRELQKESTHVAIVIDEYGGTAGLVTLEDLIEEIVGEIVDEYDTESAEAVELGDGSYRVS 347

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           +R  +++L ++   + +    + +VD++GGL+   L R+P  G  V E+ G   V L AD
Sbjct: 348 SRMSIDDLGELFDIELD----DDEVDTVGGLLAKALGRVPIVGSRV-EVQG---VSLRAD 399

Query: 304 VRCVRRVRIRRLV 316
               RR R+  ++
Sbjct: 400 RLEGRRNRVSHII 412


>gi|157273303|gb|ABV27202.1| CBS domain protein [Candidatus Chloracidobacterium thermophilum]
          Length = 427

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 15/248 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           GI  E E E+  +++ F    + +IM  R  I +V   ATV EA     +   S +PV++
Sbjct: 183 GIIEEDEGELIQSVIEFSDTAVREIMTQRPDIISVRASATVREASETMTRERHSRLPVFE 242

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
              D+  G V +RDV+  + H            Q    N+++   FVP S  ++DLL ++
Sbjct: 243 QDSDDIVGFVFIRDVLDCLLHG---------RDQEPVRNIVRPAYFVPESKGIADLLEDM 293

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNTFIVDART 246
           +++ +++ALVIDE+G   GLV+ EDI+  ++ +I  E   S +  +   +D  ++V   T
Sbjct: 294 RKASVQIALVIDEYGDVAGLVTIEDILEEIVGEIQDEDQPSGEDEVLMETDGAWLVHGST 353

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           ++ ++  +   + +      D  ++ G I S L+R+P+ GE  + + G E+ +L++D R 
Sbjct: 354 EIRKIELVTERELSS----DDFQTVNGFIVSALERVPSTGEHFI-VRGLEVEVLESDGRA 408

Query: 307 VRRVRIRR 314
           +RR R+R+
Sbjct: 409 IRRARLRK 416


>gi|256841377|ref|ZP_05546884.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256737220|gb|EEU50547.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 450

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+   I++F     D+IM  R+ +  +E K +  E +    K G S +PVY  + DN 
Sbjct: 205 EKEMLAEIIKFYNKTADEIMTPRLDMEDIEIKISFREVVDFIIKSGYSRIPVYSETEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ YI     K +           +LI+   FVP +  + DLL   + ++I 
Sbjct: 265 KGILYIKDLLPYID----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEQQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D +   K  ++V++L GL+  +    P R E++ +   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPSDFGKLTEEVETLAGLLLEIKGDFPRRREII-DFKEYRFQVLEVDNRRILKVKF 433

Query: 313 RRL 315
            R+
Sbjct: 434 NRI 436


>gi|325479753|gb|EGC82843.1| hypothetical protein HMPREF9290_0937 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 414

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 125/247 (50%), Gaps = 15/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E E+ NN+  F    + DIM +R ++ A+       E     +K   S +PVY
Sbjct: 181 QGVINNEESEMINNVFEFGNSDVSDIMTARTNMEAIACDMPKDELKDFLKKSNHSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++DN  G++HM+D++S   HM           +L   ++I+   +V  +M + DL T 
Sbjct: 241 GKNIDNILGILHMKDLVS---HMVEDK-------ELKLVDVIRPAFYVYDNMHIFDLFTT 290

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++   + +A+VIDE+GGT GLV+ EDIV  L+ +I  E+ S    I  ++D  ++V+   
Sbjct: 291 MRTENLSLAIVIDEYGGTSGLVTIEDIVEELVGEIDDEYDSAYETIYKINDKEYLVNPSI 350

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L +      TD   +K     DS+GG +   L RIP +G+ +  +    I +L  D   
Sbjct: 351 HLNDFNDYFDTDLEEIKN----DSIGGFVIDKLSRIPKQGDSI-TVSNINISVLQVDRYK 405

Query: 307 VRRVRIR 313
           +  +++ 
Sbjct: 406 IEMLKVN 412


>gi|192337539|gb|ACF04191.1| hymolysin-related protein [Wheat blue dwarf phytoplasma]
          Length = 421

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 138/253 (54%), Gaps = 17/253 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMP 124
           +GI  + E ++  NI  F    I ++M  R  I A++ + T  E +  +  EKY R   P
Sbjct: 180 KGIIDKDENKMIQNIFEFDHTNISEVMRHRTEIVAIDVEITKKELIKTIQNEKYTR--FP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+NS+DN  G++H++D+ +Y+  M +  N I           I+    V       ++ 
Sbjct: 238 VYENSIDNIIGILHVKDIFNYL--MSSNPNKI-----FDLKKFIRKPYLVQDVQNTREIF 290

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +++++  +A+VIDE+GGT G++++ED++  ++ +I+ E+ +++ MI  V+ N +IV+ 
Sbjct: 291 REMKKNKTHIAIVIDEYGGTAGIITFEDLIEEILGEISDEYDNEELMIKEVAKNEYIVNG 350

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEI--PGFEIVILDA 302
             +LEE+A+ I  + N     +D D+L G +   L R P + +   EI    F+  IL  
Sbjct: 351 FVNLEEVAEAIKLEFNT----EDYDTLSGFLIGKLGRCPNQNDKNTEIIYKNFKFKILKH 406

Query: 303 DVRCVRRVRIRRL 315
           + + + +++I ++
Sbjct: 407 NDKVISQIKITKI 419


>gi|224026373|ref|ZP_03644739.1| hypothetical protein BACCOPRO_03129 [Bacteroides coprophilus DSM
           18228]
 gi|224019609|gb|EEF77607.1| hypothetical protein BACCOPRO_03129 [Bacteroides coprophilus DSM
           18228]
          Length = 438

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  +   I+RF +    ++M SR+ +  ++ +A+  E +    +   S +PVY+ + DN 
Sbjct: 195 ETNMLEGIIRFGEETAKEVMTSRLDMVDLDIEASYSEVLKCIVENAYSRIPVYQENRDNV 254

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ Y+                   NLI+   FVP +  + DLL + Q +RI 
Sbjct: 255 KGILYIKDLLPYLDR----------GDDFKWQNLIRPAYFVPETKKIDDLLRDFQINRIH 304

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T++ + +T L +  K
Sbjct: 305 IAIVVDEFGGTSGLVTMEDIIEEIVGEINDEYDEEERTYVKLADDTYVFEGKTLLSDFYK 364

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +  +  E D D+L GL+  +    P+  EV+     F   +L+ D R + +V++
Sbjct: 365 ILKIDSDVFETVEGDADTLAGLLLELKGEFPSLHEVI-TYQYFRFEVLEMDARRILKVKV 423


>gi|320449966|ref|YP_004202062.1| CBS domain-containing protein [Thermus scotoductus SA-01]
 gi|320150135|gb|ADW21513.1| CBS domain containing protein [Thermus scotoductus SA-01]
          Length = 430

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 136/254 (53%), Gaps = 15/254 (5%)

Query: 51  LSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE 110
           +S H+ ++L    A   G     E+E+ ++IL   +  + +IM  RV + A+E +A++ +
Sbjct: 173 VSEHE-LKLILAGAEESGTIEAQEEEMIHSILELEETPVREIMTPRVEMVAIEAEASLED 231

Query: 111 AMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKN 170
            + +F ++  S +PVYK S+D+  G+ + +D++ Y      K   +        +++   
Sbjct: 232 FLHLFREHRYSRVPVYKESVDHIVGVAYAKDLLDYYCEEDLKGRTV--------ASIAHP 283

Query: 171 ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS 230
             FVP +M    LL  ++  ++ MA+V+DE GGT GLV+ ED++  ++ +I  E    + 
Sbjct: 284 PYFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTMEDVMEEIVGEIYDETDEPED 343

Query: 231 M-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           + I  + D +F + A+T ++E+++ +G +      E + D+L G ++    RIP  GE V
Sbjct: 344 LAIRRLPDGSFSIQAQTPVDEVSEALGVELP----EGEYDTLSGFLYEQFGRIPGVGESV 399

Query: 290 LEIPGFEIVILDAD 303
            E  GF  V+  AD
Sbjct: 400 -EWQGFRFVVESAD 412


>gi|94264475|ref|ZP_01288263.1| CBS:Transporter-associated region [delta proteobacterium MLMS-1]
 gi|94266982|ref|ZP_01290630.1| CBS:Transporter-associated region [delta proteobacterium MLMS-1]
 gi|93452316|gb|EAT02950.1| CBS:Transporter-associated region [delta proteobacterium MLMS-1]
 gi|93455106|gb|EAT05330.1| CBS:Transporter-associated region [delta proteobacterium MLMS-1]
          Length = 301

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 119/247 (48%), Gaps = 13/247 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+ S  E E+ + I+  +     +IM  R  +  VE   T+   + +  + G S +PVY+
Sbjct: 56  GLISPEEGEMISGIMELKDTLAYEIMTPRAEMVLVEAATTLPAMVALIIERGYSRIPVYR 115

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
              D   G+VH +D++ Y      +  N          +L K + F+P    V  LL   
Sbjct: 116 EDPDQIIGLVHAKDILPYCLQPEGEPPNAE--------SLAKPVEFIPEKRGVLRLLKFF 167

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           QE++I +A+V DE GG  GLV+ EDIV  ++ DI  EH         V   T + DA+ D
Sbjct: 168 QENKIHLAVVNDEFGGVRGLVTLEDIVEEIVGDINDEHDRITRRWKVVDQRTVLADAKVD 227

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +EE+ +    +      E   +S+GGLI   LDR+P  G V L I      +L AD R V
Sbjct: 228 IEEVEEFFKIELP----EGPYESVGGLILHHLDRVPPPG-VTLSIDSLVFEVLAADKRRV 282

Query: 308 RRVRIRR 314
             V+I++
Sbjct: 283 ITVKIQQ 289


>gi|255014404|ref|ZP_05286530.1| hemolysin-related protein [Bacteroides sp. 2_1_7]
          Length = 450

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+   I++F     D+IM  R+ +  +E K +  E +    K G S +PVY  + DN 
Sbjct: 205 EKEMLAEIIKFYNKTADEIMTPRLDMEDIEIKISFREVVDFIIKSGYSRIPVYSETEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ YI     K +           +LI+   FVP +  + DLL   + ++I 
Sbjct: 265 KGILYIKDLLPYID----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEQQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D +   K  ++V++L GL+  +    P R E++ +   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPSDFGKLTEEVETLAGLLLEIKGDFPRRREII-DFKEYRFQVLEVDNRRILKVKF 433

Query: 313 RRL 315
            R+
Sbjct: 434 NRI 436


>gi|269836846|ref|YP_003319074.1| CBS domain-containing protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269786109|gb|ACZ38252.1| CBS domain containing protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 424

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 134/246 (54%), Gaps = 19/246 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
             E E+E+ + +L   +  + +IM+ R+ I A     ++ E + +    G S +PVY++S
Sbjct: 179 IEEDEQEMISGVLGLEEATVREIMVPRLDIVAAPQDMSISEVVDLARSAGHSRIPVYRDS 238

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +D+  G+++ +D++ +++    +   + L       +L++   FVP S  V +LL ++++
Sbjct: 239 IDSIVGVIYAKDLLRFVNE---QATGVKL------LDLLRPAYFVPESKHVDELLRDMRQ 289

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           +++ +A+V+DE+GGT GLV+ EDI+  ++ +I  E+  +  +I  +     IVD R  ++
Sbjct: 290 AKVHIAIVVDEYGGTAGLVTIEDILEEIVGEIQDEYDRETPLIERLGAEEVIVDGRIAVD 349

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
           E+A I  T+      E +  ++GG +   L RIP  GE  L   G  I     +V+ V  
Sbjct: 350 EIADIFETEF----AEGETGTIGGFVQKRLGRIPKAGE-SLRADGLLI-----EVQAVEH 399

Query: 310 VRIRRL 315
            RIR+L
Sbjct: 400 HRIRKL 405


>gi|262383456|ref|ZP_06076592.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262294354|gb|EEY82286.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 450

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+   I++F     D+IM  R+ +  +E K +  E +    K G S +PVY  + DN 
Sbjct: 205 EKEMLAEIIKFYNKTADEIMTPRLDMEDIEIKISFREVVDFIIKSGYSRIPVYSETEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ YI     K +           +LI+   FVP +  + DLL   + ++I 
Sbjct: 265 KGILYIKDLLPYID----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEQQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D +   K  ++V++L GL+  +    P R E++ +   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPSDFGKLTEEVETLAGLLLEIKGDFPRRREII-DFKEYRFQVLEVDNRRILKVKF 433

Query: 313 RRL 315
            R+
Sbjct: 434 NRI 436


>gi|189463290|ref|ZP_03012075.1| hypothetical protein BACCOP_04007 [Bacteroides coprocola DSM 17136]
 gi|189430020|gb|EDU99004.1| hypothetical protein BACCOP_04007 [Bacteroides coprocola DSM 17136]
          Length = 427

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 127/242 (52%), Gaps = 16/242 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  +   I+RF +   +++M SR+ I  +E      E +    +   S +PVY+ S DN 
Sbjct: 187 ESNMLKGIIRFGEETAEEVMTSRLDIVDLEINTPFPEVIKCIVENAYSRIPVYEESRDNI 246

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ Y+                   NLI+   FVP + ++ DLL + Q ++I 
Sbjct: 247 KGVLYIKDLLPYLDK----------GADFKWQNLIRPAFFVPETKMIDDLLRDFQANKIH 296

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART---DLEE 250
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     +S+N +I + +T   D  +
Sbjct: 297 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDEEERTYVKISENVYIFEGKTLLSDFYK 356

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
           LA+I   D   + G  D D+L GL+  +    P   EV+     +   IL+ DVR + +V
Sbjct: 357 LAEINPDDFEAVAG--DADTLAGLLLELKGEFPVLHEVI-NYDRYRFEILEMDVRRIVKV 413

Query: 311 RI 312
           ++
Sbjct: 414 KV 415


>gi|154496261|ref|ZP_02034957.1| hypothetical protein BACCAP_00546 [Bacteroides capillosus ATCC
           29799]
 gi|150274344|gb|EDN01421.1| hypothetical protein BACCAP_00546 [Bacteroides capillosus ATCC
           29799]
          Length = 429

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 141/289 (48%), Gaps = 27/289 (9%)

Query: 37  RTIRALCKTWK-LMKLSHHK----GIRLPRI-----DASLEGIFSETEKEIFNNILRFRK 86
           R +  L   WK L+ L  HK    GI    +      A  EG   + E E+  + + F  
Sbjct: 139 RPLNFLFTLWKKLLTLVFHKSEDEGITEEELITMVDQAEDEGGLDQHESELIRSAIEFGD 198

Query: 87  IRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYI 146
           + +++I+  RV I AVED A + E   +F + G S +PVY   +D+  G++H +D   + 
Sbjct: 199 MEVEEILTPRVDIVAVEDTADMDEVARVFAESGFSRLPVYHEDIDDIVGVIHEKD---FH 255

Query: 147 SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDG 206
           +  Y   +++        S+ +  +L+   +  +S++L  +Q  +  M +V+DE+GGT+G
Sbjct: 256 AARYHGISDL--------SSFMGTVLYTTGNTKISEMLRILQREKAHMVIVVDEYGGTEG 307

Query: 207 LVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQ 266
           LV+ EDIV  L+ +I  EH          +D ++++    DL +L      D   +KG  
Sbjct: 308 LVTMEDIVEELVGEIWDEHDEVIEQFQKQADGSYLISCSADLTDL-----YDLFSIKGSC 362

Query: 267 DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
           D +++ G +   + RIP  G+   +  G ++ +   D R V  +++  L
Sbjct: 363 DANTVSGWVMEQIGRIPEEGD-RFQADGLDVTVTKVDHRRVMEIKVAVL 410


>gi|86607975|ref|YP_476737.1| HlyC/CorC (HCC) family transporter [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556517|gb|ABD01474.1| putative transporter, HlyC/CorC (HCC) family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 480

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 130/229 (56%), Gaps = 13/229 (5%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           I +S+E G     E+E+ +NI  F +    ++MI R SI+AV + ATV E +    + G 
Sbjct: 214 IASSVESGNIEAEERELLSNIFEFGETVASEVMIPRTSIDAVPETATVQEVLAEVAESGH 273

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S  PVY  SLD+ RG++H++++I  ++       +I+L+  +  +  I+   F P +  +
Sbjct: 274 SRYPVYGESLDDIRGLIHVKELIGQLAK-----GSIDLHSPI--TPFIREAHFEPENKPI 326

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT--SEHHSKKSMISAVSDN 238
           ++LL  +++    M +V+DE GGT GL++ +D+V  ++  ++   + ++K+  I  + +N
Sbjct: 327 AELLPEMRQHHWPMVVVVDEFGGTAGLITIQDLVEEIVGKLSDGPDPNTKEPDIQELDEN 386

Query: 239 TFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           T ++ A+ D+EE+ +  G +   L   +D  +LGG +   + +IP  GE
Sbjct: 387 TLLIQAQLDIEEINERCGLN---LPLHEDYQTLGGFLIYHMQKIPRAGE 432


>gi|76801358|ref|YP_326366.1| hypothetical protein NP1414A [Natronomonas pharaonis DSM 2160]
 gi|76557223|emb|CAI48798.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 457

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 132/247 (53%), Gaps = 14/247 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  E E+E+   I RF      ++M  R+ + AV   AT+ EA+    + G + +PVY+
Sbjct: 209 GVLEEDEREMLQRIFRFTNTIAKEVMTPRLDMEAVPKDATIEEAIQTCVQSGHARVPVYE 268

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLDN  G+VH+ D++      Y + ++I L       ++I+  L VP S  + +LL  +
Sbjct: 269 GSLDNVLGVVHISDLVR--DDTYGEASDIELE------DVIEETLHVPESKNIDELLAEM 320

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +E+R+ M +VIDE G T+GLV+ EDI   ++ +I      ++  I  VSDN  +V    +
Sbjct: 321 RENRLHMVIVIDEFGTTEGLVTMEDITEEIVGEIL--QADEEEPIEFVSDNEILVKGEVN 378

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           ++E+ + +  D    +GE+  +++ G IF+   R+   GE + E  G EI +   +   +
Sbjct: 379 IDEVNEKL--DVAIPEGEE-FETIAGFIFNRAGRLVEEGERI-EYEGLEIRVERVENTRI 434

Query: 308 RRVRIRR 314
            + RI +
Sbjct: 435 MKARITK 441


>gi|269958333|ref|YP_003328120.1| putative transporter [Anaplasma centrale str. Israel]
 gi|269848162|gb|ACZ48806.1| putative transporter [Anaplasma centrale str. Israel]
          Length = 292

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 144/275 (52%), Gaps = 20/275 (7%)

Query: 40  RALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSI 99
           R++  ++ L +L   K     RI A  E         I NN++R  +  + DIM+ R  I
Sbjct: 27  RSVFYSFVLERLPGFKEFAKNRIMA--ENALHFGSSHIMNNLVRLDECSVKDIMVQRSEI 84

Query: 100 NAVE-DKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL 158
            A+  D + +   +L   +   + +PVYK+++DN  G +H++D+ S           ++ 
Sbjct: 85  LALGIDDSDLLTKVL---RSQHTRVPVYKDNIDNIVGFIHIKDITS--------KEGLDF 133

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM 218
           N++    ++I N+++VP SM   +L   +Q SR+ MA+V+DE+G TDGLV+  DI+  ++
Sbjct: 134 NVK----SIIHNVMYVPHSMKAVNLFVKMQSSRVHMAIVLDEYGSTDGLVTMADIIEEIV 189

Query: 219 RDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
            DI  EH       I  +S++   V+AR  +  L + +G      + E+ V ++GGLI +
Sbjct: 190 GDIEDEHDVPSIPDIVNISNDKIEVNARVLVRTLEQSLGISLKDSEEEEYV-TVGGLILA 248

Query: 278 VLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           ++ R+P   EV     G   +I + D RC+ RV I
Sbjct: 249 MVGRVPVVDEVFNHKSGASFLIKEVDNRCIYRVVI 283


>gi|313158268|gb|EFR57670.1| gliding motility-associated protein GldE [Alistipes sp. HGB5]
          Length = 428

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 134/247 (54%), Gaps = 23/247 (9%)

Query: 50  KLSHHKGIRLPRIDASLEGIFSETEKE--IFNNILRFRKIRIDDIMISRVSI---NAVED 104
           K SH   I L  +  +++   S + +E  + + I+ F    + +IM  RV I   N  +D
Sbjct: 170 KASHKSEISLDELADAVDMTQSSSPEEHVMLSGIVNFVNTEVQEIMKPRVDITVLNITDD 229

Query: 105 KATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE 164
             TV + ++   + G S +PVY++ +DN +G ++++D++ YI+H            +   
Sbjct: 230 YETVKKTII---ESGFSRIPVYEDDIDNIKGTLYVKDLLPYINH----------GSEFGW 276

Query: 165 SNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE 224
             L++   FVP    ++DLL + Q ++I MA+V+DE+G T GLVS EDI+  ++ +I+ E
Sbjct: 277 QQLVRKPYFVPEHKKINDLLADFQSNKIHMAIVVDEYGSTLGLVSLEDIIEEIVGEISDE 336

Query: 225 HHSKKSMISAVSDNTFIVDARTDLEELAKIIGTD---CNCLKGEQDVDSLGGLIFSVLDR 281
             + +S  + + +  FI D ++ L +  +++G D    N +KGE   ++L GL+  +   
Sbjct: 337 SDADESFFTRLDEKCFIFDGKSHLGDFERVLGLDEEIFNDVKGE--AETLAGLMLELKRD 394

Query: 282 IPARGEV 288
            P +G+V
Sbjct: 395 FPRKGDV 401


>gi|160879063|ref|YP_001558031.1| hypothetical protein Cphy_0907 [Clostridium phytofermentans ISDg]
 gi|160427729|gb|ABX41292.1| protein of unknown function DUF21 [Clostridium phytofermentans
           ISDg]
          Length = 487

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 132/255 (51%), Gaps = 20/255 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMP 124
           +G+    E E+ +NI+ F +    DIM  R  + A+     + +A+  ++ E Y R   P
Sbjct: 198 QGVLEAEEAEMISNIIEFNEKAAKDIMTHRKKMIAINSALCIEDALRFMLDENYSR--FP 255

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           +Y   +DN  G++H++DV+ Y      K   +        S + +   F+P +  +  L 
Sbjct: 256 LYDGDIDNIVGLLHLKDVMLYFLDPRLKVEPL--------SKVAREPYFIPDTQSIDVLF 307

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
            ++Q  +I MA+ IDE+G T G+V+ EDI+  ++ DI  E+  ++ + + + D+++++  
Sbjct: 308 HDMQTKKIHMAIAIDEYGQTAGIVAMEDILEEIVGDIQDEYDDEEELYTRLEDDSYLLSG 367

Query: 245 RTDLEELAKIIGTDCNCLKGEQDV---DSLGGLIFSVLDRIPARGE-VVLEIPGFEIVIL 300
              LE+L  I+         E+D+   D+L GLI S+LD IP   E   +   G+E  ++
Sbjct: 368 EASLEDLEDILSLPF----AEEDIKNYDTLNGLIVSLLDHIPGDDERATIRYCGYEYELM 423

Query: 301 DADVRCVRRVRIRRL 315
           +   R +  VR+R++
Sbjct: 424 EIQNRMITSVRVRKI 438


>gi|167770398|ref|ZP_02442451.1| hypothetical protein ANACOL_01741 [Anaerotruncus colihominis DSM
           17241]
 gi|167667405|gb|EDS11535.1| hypothetical protein ANACOL_01741 [Anaerotruncus colihominis DSM
           17241]
          Length = 472

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 132/249 (53%), Gaps = 13/249 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G   ++EK++ NNI  F    + ++M  R  + AV    T+   + +  + G S +PVY
Sbjct: 227 KGAIEQSEKDMINNIFEFDDRNVSEVMTHRTDMTAVPKDVTIDRIVAIAIETGFSRIPVY 286

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
              +D+  G+V+++D++  I      T  ++ + Q      ++  LFVP SM   DL   
Sbjct: 287 DEDIDDIMGIVYVKDLLCLIG-----TPGVDFDAQ----KYMRPALFVPESMSCVDLFAQ 337

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++ ++ +A+V+DE+GGT G+ S ED++  ++ +I  E+  +   I  +SD  + +D   
Sbjct: 338 FKQKKVMVAIVVDEYGGTAGIASMEDLLESIVGNIQDEYDDEDEEICKMSDGVYTLDGAV 397

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
            +E++ ++   +   L  + + D++GGL+   L+RIP+  E   LE+ G    +L  + R
Sbjct: 398 SIEDVERLFDIE---LDEDSEYDTIGGLLIEKLERIPSPHEHPALELSGVRFTVLLVEDR 454

Query: 306 CVRRVRIRR 314
            + R+R  +
Sbjct: 455 RIARIRAEK 463


>gi|261368086|ref|ZP_05980969.1| putative transporter [Subdoligranulum variabile DSM 15176]
 gi|282570076|gb|EFB75611.1| putative transporter [Subdoligranulum variabile DSM 15176]
          Length = 439

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 127/227 (55%), Gaps = 15/227 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  +G  ++ E E+  + + F  + ++D++  RV + AVED   + E + MF + G S 
Sbjct: 176 EAEKDGELTDRESELIRSAIEFDDVEVEDVLTPRVDVVAVEDDTPMEEVVDMFAESGYSR 235

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY  ++DN  G+VH +D  + +     +  N+    ++   NL+   L+  ++  +S 
Sbjct: 236 LPVYHETIDNIIGVVHEKDCFAAL-----RKGNVK---EVKLENLVSPTLYTTTATQISS 287

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL  ++ES+  MA+V+DE+GGT G+++ EDI+  L+ +I  EH      I   SD +++V
Sbjct: 288 LLLTLRESKHHMAVVVDEYGGTAGIITLEDILEELVGEIWDEHDDVVEEIHQQSDGSWLV 347

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLG--GLIFSVLDRIPARGE 287
                ++++A+ +      +K ++++D++   GL+   L R+P  G+
Sbjct: 348 SGAAGIDDVAEEL-----SIKDQEEIDAIAISGLVQEKLGRLPKVGD 389


>gi|227495953|ref|ZP_03926264.1| HCC HlyC/CorC family transporter [Actinomyces urogenitalis DSM
           15434]
 gi|226834507|gb|EEH66890.1| HCC HlyC/CorC family transporter [Actinomyces urogenitalis DSM
           15434]
          Length = 432

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 129/249 (51%), Gaps = 19/249 (7%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
             + ++++  +++   +  + ++M+ R  +  ++    V  AM +F K G S +PV    
Sbjct: 183 IEDEDRQMLRSVVELGQTLVREVMVPRTDMVTIDADKPVSAAMRLFIKSGFSRVPVIGQD 242

Query: 130 LDNPRGMVHMRDVISYISHM--YAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            D+ RG+V+++D++  +     YA+   +           ++  ++VP + L  DLL  +
Sbjct: 243 ADDVRGVVYLKDLLRRLDAQPEYAQREVVTC---------MREAVYVPETKLADDLLREM 293

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q   + MAL +DE+GGT GLV+ ED++  ++ D+T EH   +  +  + D  + V AR  
Sbjct: 294 QTDSVHMALAVDEYGGTAGLVTMEDLLEEVVGDMTDEHDHAEPEVEDLGDGVYRVPARLS 353

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           L+EL ++ G + +    + DVD+ GGL+   + R+P  G    E+ G  +V   AD    
Sbjct: 354 LDELGELFGLEID----DDDVDTAGGLLTKAIGRVPLPG-ASGEVQGLHLV---ADQATG 405

Query: 308 RRVRIRRLV 316
           RR ++  L+
Sbjct: 406 RRRQVTSLL 414


>gi|310828645|ref|YP_003961002.1| hypothetical protein ELI_3070 [Eubacterium limosum KIST612]
 gi|308740379|gb|ADO38039.1| hypothetical protein ELI_3070 [Eubacterium limosum KIST612]
          Length = 420

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 126/255 (49%), Gaps = 18/255 (7%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  EG+  E E E+  + + F  +   DI I RV I A++ +  + E   +F   G S 
Sbjct: 175 EAQNEGVLDEHESELIRSAIEFDDLSAGDIAIPRVDITAIDLETPLDEIEQLFSTTGYSR 234

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY  S+DN  GM+H +D  S I+H       I           + ++++   +M +S 
Sbjct: 235 LPVYIKSIDNIVGMIHEKDFHSLINHGITSIQGI-----------VADVVYASENMKIST 283

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL  +Q+S+  MA+V DE GGT GLV+ EDI+  L+ DI  EH     +   + ++T +V
Sbjct: 284 LLRLLQKSKTHMAIVADEFGGTFGLVTLEDILEELVGDIWDEHDQIVEVFKPLDEHTTLV 343

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDS--LGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
               +L ++ +      N     +D+DS  + G +  +L  IP  G+         + I 
Sbjct: 344 SCHANLIDMFEYF----NIQFQNKDLDSNTVNGWVVDLLGHIPKVGD-TFTYENLAVTIT 398

Query: 301 DADVRCVRRVRIRRL 315
            A ++CV  ++I RL
Sbjct: 399 KASLKCVLEIKIVRL 413


>gi|170077826|ref|YP_001734464.1| CBS domain-containing protein [Synechococcus sp. PCC 7002]
 gi|169885495|gb|ACA99208.1| CBS domain protein [Synechococcus sp. PCC 7002]
          Length = 479

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 123/241 (51%), Gaps = 11/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+ +N++ F  +  ++IM  R  I+A+ + AT+ + +    +   S  PVY  S+D+ 
Sbjct: 212 ERELLSNVIEFGDVVAEEIMTPRTKIHAIANGATLGKLLQKVSQTNHSAYPVYGESIDDI 271

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G V  RD   +   + A   N+N  I    +  +K I FV     ++DLL  +Q ++  
Sbjct: 272 VGFVRFRD---FAKPLAAGGMNLNTAI----NRWVKPIPFVAEGTPIADLLPKMQRTKQP 324

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE GGT GLV+ +DI++ ++ D    H +      A+   TF+VDA+ DLEEL  
Sbjct: 325 MVMVVDEFGGTAGLVTLKDIINEIIGDELDSHPNAPLHFKALDRQTFLVDAQIDLEELND 384

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++  +   L    D  +L G +     +IP  GE V      +  ++  D   +++V+I 
Sbjct: 385 LLNVE---LPYTDDYQTLSGFLLYQWQKIPETGE-VFHFEDLKFQVMGIDGPRLQQVKIT 440

Query: 314 R 314
           R
Sbjct: 441 R 441


>gi|56751524|ref|YP_172225.1| hypothetical protein syc1515_c [Synechococcus elongatus PCC 6301]
 gi|81301404|ref|YP_401612.1| hypothetical protein Synpcc7942_2595 [Synechococcus elongatus PCC
           7942]
 gi|56686483|dbj|BAD79705.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81170285|gb|ABB58625.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 476

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 119/215 (55%), Gaps = 13/215 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E++I +N++ F +I   ++M+ R  I A+E+ AT  + +   ++ G +  PV ++SLD  
Sbjct: 230 ERQILSNVIEFGEITAGEVMVPRTRIVALEEDATFLDLLAAIQESGHACFPVIRDSLDQV 289

Query: 134 RGMVHMRDV-ISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G++  R + +   S     ++ +   +Q +         FVP  + + +LL  +Q S +
Sbjct: 290 LGLIDFRALAVPMASGELQPSSPVKAWVQPAR--------FVPEGLSLKELLPQMQRSPL 341

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            MA+V+DE GGT+GLV+ +DI++ ++ D   +   +      + D T +V A+TD+E + 
Sbjct: 342 PMAIVVDEFGGTEGLVTLQDILAEILGD-EEQDAEENEQFRRIDDQTVLVQAQTDIETVN 400

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           + +G D   L  E++ ++LGG + + L +IP  GE
Sbjct: 401 ERLGLD---LPLEEEYNTLGGFVVAQLQKIPEAGE 432


>gi|115374917|ref|ZP_01462189.1| CBS:Transporter-associated region [Stigmatella aurantiaca DW4/3-1]
 gi|310819207|ref|YP_003951565.1| CBS/transporter associated domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115368044|gb|EAU67007.1| CBS:Transporter-associated region [Stigmatella aurantiaca DW4/3-1]
 gi|309392279|gb|ADO69738.1| CBS/transporter associated domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 442

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 124/244 (50%), Gaps = 15/244 (6%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++  ++  +I      R  D+M+SR  +  VE      E + +  +   S +PVY++ +D
Sbjct: 195 KSAPQLIRSIFELSDKRCRDVMVSRTEVVTVELSTPPTEVLRLLAEENHSRIPVYRDDVD 254

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
              G++H RD+I  + H       I L       ++I+   FVP    + DLL ++Q+ R
Sbjct: 255 RIVGILHARDLIPLLQH----PELIVL------PDVIRPAHFVPWMKPIGDLLRDMQKRR 304

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
           I MA+V+DE+GG  G+V+ EDI+  ++ DI  E   ++  +   +D +F+VDA  ++E  
Sbjct: 305 IHMAMVVDEYGGFMGVVTLEDILREIVGDIGDEFEVEEKQVEKQADGSFLVDAALEVESF 364

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            K  G +      E D D+LGG + S+   +P  GE      G++  +   +   + RVR
Sbjct: 365 TKAFGFELP----EGDFDTLGGFLSSLAGHLPDVGE-RFTYGGWQFTVASKEGARIDRVR 419

Query: 312 IRRL 315
           + RL
Sbjct: 420 VARL 423


>gi|266620458|ref|ZP_06113393.1| hemolysin [Clostridium hathewayi DSM 13479]
 gi|288867944|gb|EFD00243.1| hemolysin [Clostridium hathewayi DSM 13479]
          Length = 351

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 129/254 (50%), Gaps = 12/254 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG-RSWMPV 125
           +G+    E E+  NI         DIM  R ++ A++   T+ EA+    K G  S  PV
Sbjct: 81  QGVLEAREAEMITNIFELDDKDAGDIMTHRKNLVALDGSMTLREAVNFILKEGYNSRYPV 140

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSDLL 184
           Y+  +D+  G++HM+D       + A  N  N  + + E   L++   F+P +  +  L 
Sbjct: 141 YEKDIDDITGILHMKDA------LIAAENGSNGMVPICEIDGLLREAHFIPETRNIDSLF 194

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +I M +V+DE+G T G+V+ EDI+  ++  I  E+   +  I+   D ++I+  
Sbjct: 195 KEMQSQKIHMVIVVDEYGQTAGIVTMEDILEEIVGSIMDEYDVDEEFIAQAEDGSYIISG 254

Query: 245 RTDLEELAKIIGTDCNCLKGEQD-VDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDA 302
              L+E+AK +  D    + + D  D++ G + S LDRIP  GE   +E  G+   IL  
Sbjct: 255 MAPLDEVAKTL--DIEFEEDDYDSYDTINGFLISRLDRIPQEGEQTEVEYQGYGFKILQV 312

Query: 303 DVRCVRRVRIRRLV 316
           + + +  +R+++LV
Sbjct: 313 ENKMIHTIRVQKLV 326


>gi|218296548|ref|ZP_03497276.1| protein of unknown function DUF21 [Thermus aquaticus Y51MC23]
 gi|218243090|gb|EED09622.1| protein of unknown function DUF21 [Thermus aquaticus Y51MC23]
          Length = 441

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 138/266 (51%), Gaps = 14/266 (5%)

Query: 39  IRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVS 98
           +RAL    +   L   + +RL    A   G     E+E+ ++IL   +  + +IM  RV 
Sbjct: 171 LRALGLEPRNASLVSEEELRLILAGAEEAGTIEAQEEEMIHSILELEETPVREIMTPRVE 230

Query: 99  INAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL 158
           + A+E +A++ + + +F ++  S +PVY+ S+D+  G+ + +D++ Y      K   +  
Sbjct: 231 MVAIEAEASLEDFLHLFREHRYSRVPVYRESVDHIVGIAYAQDLLDYHCQEDLKGRTV-- 288

Query: 159 NIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM 218
                 +++     FVP +M    LL  ++  ++ MA+V+DE GGT GLV+ ED++  ++
Sbjct: 289 ------ASIAHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEIV 342

Query: 219 RDITSE-HHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFS 277
            +I  E    + + I  ++D    + A+T ++E+++ +G +      E + D+L G ++ 
Sbjct: 343 GEIYDETDEPEDAPIKRLADGALSIQAQTPIDEVSEALGVELP----EGEYDTLSGFLYE 398

Query: 278 VLDRIPARGEVVLEIPGFEIVILDAD 303
              RIP  GE V E  GF  V+  AD
Sbjct: 399 RFGRIPGVGESV-EWQGFRFVVESAD 423


>gi|212702491|ref|ZP_03310619.1| hypothetical protein DESPIG_00508 [Desulfovibrio piger ATCC 29098]
 gi|212674152|gb|EEB34635.1| hypothetical protein DESPIG_00508 [Desulfovibrio piger ATCC 29098]
          Length = 287

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 139/255 (54%), Gaps = 21/255 (8%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           I+A  +G     E+ +   ILRF  +++ D M  R  I+ V +   + E   +  + G S
Sbjct: 35  IEARADGEVEPDEESMLLGILRFNDLQVQDTMTPRTDIDCVPEDMLLPEVARVIVESGHS 94

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE---SNLIKNILFVPSSM 178
            +PV++++ DN  GM+H +D++S +           L+ ++++   S +++   FVP + 
Sbjct: 95  RIPVFRDTRDNMVGMLHAKDILSCL-----------LDPKMADQPASAIMREPFFVPETK 143

Query: 179 LVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSD 237
            + +LL   + S+  +A+ +DE+GGT GL++ ED++  ++ DI  EH + ++  I  +  
Sbjct: 144 PIRNLLQEFRASKQHIAIALDEYGGTSGLITIEDLLEEIVGDIEDEHDAPREEDIRPLGA 203

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
           + + +  R  LE+L + +G D +      +VD++GG +      +PA GEV + + G+  
Sbjct: 204 HVYELTGRALLEDLEE-LGVDLSS----DEVDTIGGYLSMEAGHVPAPGEVFI-LRGWRF 257

Query: 298 VILDADVRCVRRVRI 312
            +LDAD + +R +R+
Sbjct: 258 EVLDADKKLIRHLRM 272


>gi|325289588|ref|YP_004265769.1| protein of unknown function DUF21 [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964989|gb|ADY55768.1| protein of unknown function DUF21 [Syntrophobotulus glycolicus DSM
           8271]
          Length = 432

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 123/221 (55%), Gaps = 15/221 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE--AMLMFEKYGRSWMP 124
           +G   ETEK + NNI  F    ++++M  R  I A+  +A++ +  A L  EKY R  +P
Sbjct: 194 KGTIQETEKVMINNIFEFNNKTVEEVMTHRTEIAALPVEASLQDVVAFLKEEKYSR--IP 251

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY++++DN  G++H + +I Y++    +        + S ++ I+   FVP+S    +L 
Sbjct: 252 VYEDTIDNITGVMHSKYLIQYLAREKDQE-------KFSLADFIRQPYFVPASKRTDELF 304

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+++  +A++IDE+GGT G+V+ ED++  ++ +I  E    +  I  + + TF+++ 
Sbjct: 305 RELQQNKTHLAVIIDEYGGTAGIVTLEDLIEEIVGNIFDEDDEIEKDIEKLDETTFLING 364

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPAR 285
            TDL+++   +G +    + E    +L G +   L RIP +
Sbjct: 365 TTDLDKVEDYLGVELPTAEYE----TLSGFVIGKLGRIPEK 401


>gi|228470378|ref|ZP_04055281.1| gliding motility-associated protein GldE [Porphyromonas uenonis
           60-3]
 gi|228307960|gb|EEK16843.1| gliding motility-associated protein GldE [Porphyromonas uenonis
           60-3]
          Length = 452

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 141/297 (47%), Gaps = 27/297 (9%)

Query: 23  SPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSET-----EKEI 77
           +P++S       W    + L KT KL+     +G  L   D S E +   T     E E+
Sbjct: 151 APAVSGLYKGIAWCS--KGLIKTSKLLGSKARRGPELSVDDLS-EAVALTTNGDNKETEM 207

Query: 78  FNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMV 137
            + I++F     D+IM+ RV +  V      ++ +      G S +PVY  S D+ RG++
Sbjct: 208 IHEIVKFYHKTADEIMVPRVDMIGVNYHWAYHQTLSFAVDTGYSRLPVYDGSQDSIRGVL 267

Query: 138 HMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALV 197
           +++D++    HM+ +              +I+   FVP +  +  LL  +Q+ RI MA+V
Sbjct: 268 YVKDLLP---HMHEEDT-------FPWQKIIRQAYFVPENKKIDTLLEELQQERIHMAIV 317

Query: 198 IDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGT 257
           IDE GGT GL++ EDI+  ++ +I  E+  +      +++  +++D    L +L K++  
Sbjct: 318 IDEFGGTSGLITLEDILEEIVGEIVDEYDDEDPPYVRLAEGVYLIDGGMSLIDLCKLLDV 377

Query: 258 DCNCLKGE-QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +        ++VD++GGL   VL  IP  G+        +I I D D    R  R R
Sbjct: 378 EPEYFAPHYEEVDTVGGLFLEVLQEIPQVGQ--------QITISDIDFIVTRMERHR 426


>gi|317485853|ref|ZP_07944716.1| CBS domain pair [Bilophila wadsworthia 3_1_6]
 gi|316922895|gb|EFV44118.1| CBS domain pair [Bilophila wadsworthia 3_1_6]
          Length = 270

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 132/263 (50%), Gaps = 21/263 (7%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  EG     E  +  +ILR   +++ DIM  R   + +   A V E      + G S
Sbjct: 22  MEARDEGELDLAEGSMILSILRLDDVQVQDIMTPRTDFDCMPTGAPVSEVAQCILETGHS 81

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +P+YK++ DN  G+ + +D+IS +         ++         ++++  FVP + +VS
Sbjct: 82  RLPIYKDTRDNIIGIAYAKDLISLLVDPAKHHTAVD--------EIMRSPFFVPETKIVS 133

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTF 240
           +LL   +  +  +A+ +DE+GGT GL + EDI+  ++ DI  EH + K+  I  + D+ +
Sbjct: 134 ELLQEFRSRKNHIAIAVDEYGGTSGLATIEDILEEIVGDIEDEHDAPKEEDIHPLGDSRY 193

Query: 241 IVDART---DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
            +  R    DLEEL   +  D        +VD++GG +      +P +GE + E  G+  
Sbjct: 194 ALSGRAYLEDLEELGINLEAD--------EVDTIGGYLCLEAGHVPEKGE-IFECGGWRF 244

Query: 298 VILDADVRCVRRVRIRRLVHFKN 320
           ++ +AD + +RRV +      +N
Sbjct: 245 IVDEADAKQIRRVIVEPATQEEN 267


>gi|237753081|ref|ZP_04583561.1| magnesium and cobalt efflux protein CorC [Helicobacter winghamensis
           ATCC BAA-430]
 gi|229375348|gb|EEO25439.1| magnesium and cobalt efflux protein CorC [Helicobacter winghamensis
           ATCC BAA-430]
          Length = 440

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 126/231 (54%), Gaps = 17/231 (7%)

Query: 62  IDASLEGIFSET-EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +  SL+G + +T E EI  N + F      +IM  R  +  + D  T  E M +      
Sbjct: 193 VGESLKGGYLDTIENEIIQNAVSFSDTMAKEIMTPRKDMICLYDDNTYEENMQIVTTTKH 252

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           +  P  K   DN  GMVH+RD++  +      +NN +  ++    +L++ ++ VP S  +
Sbjct: 253 TRYPYCKEGKDNIIGMVHLRDLLETM-----LSNNPSKELE----SLVREMIIVPESASI 303

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           S++L  +   +I  ALV+DE+GGT GL++ EDI+  +M DI+ EH  K      +S++++
Sbjct: 304 SNILNQMNRRQIHTALVVDEYGGTAGLLTMEDILEEVMGDISDEHDKKSDDCHKISEDSY 363

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVV 289
             D   DLE +A ++G     +  E+D +  ++GG +F++L+R+P  G+V+
Sbjct: 364 SFDGMLDLERVADVLG-----ISFEEDTEQVTIGGYVFNLLERMPVVGDVI 409


>gi|312880028|ref|ZP_07739828.1| protein of unknown function DUF21 [Aminomonas paucivorans DSM
           12260]
 gi|310783319|gb|EFQ23717.1| protein of unknown function DUF21 [Aminomonas paucivorans DSM
           12260]
          Length = 425

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 138/250 (55%), Gaps = 14/250 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           ++   G   E E+++ + I+ F + R+ +IM+ R  + A+    +V  A+  F + G S 
Sbjct: 178 ESGASGALEEEERKMIHGIIAFEETRVSEIMVPRTDMTALPSSCSVRSAIEAFRESGHSR 237

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           MP++   LD+  G+++++D++  +S     + +++  +    +   +  LFVP +M +++
Sbjct: 238 MPLFDGDLDHIDGVLYVKDLLQCLS-----SGDVDKPV----APFQRKSLFVPETMKIAE 288

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           L   ++++R+ MA+V+DE+GGT GL++ ED++  ++ +I  E+  +   +   +D +++V
Sbjct: 289 LFDLMKKARVHMAIVVDEYGGTAGLLTLEDLLEEIVGEIQDEYDEEVPPVQKEADGSYVV 348

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
             +  LE+L+  +G         +DVD++GGL  S+    P  G+ V E P + I  LD 
Sbjct: 349 QGQVHLEDLSDALGYPFEA----EDVDTVGGLALSLFGGFPKSGQEVTEGP-WRIQALDV 403

Query: 303 DVRCVRRVRI 312
               V +VR 
Sbjct: 404 KNHRVLQVRF 413


>gi|291525104|emb|CBK90691.1| Hemolysins and related proteins containing CBS domains [Eubacterium
           rectale DSM 17629]
 gi|291529407|emb|CBK94993.1| Hemolysins and related proteins containing CBS domains [Eubacterium
           rectale M104/1]
          Length = 303

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 133/250 (53%), Gaps = 10/250 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G    +E E+ +N+  F    + DIM  R +I +++   +  +A+      G+S  PVY
Sbjct: 57  QGTILASEAELIHNVFEFDDKEVKDIMTHRKNIVSLDGNMSFIDAIEFIIDTGKSRFPVY 116

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +N +D+  G++H++D  ++        ++I          LI+ + F+P ++ ++DL   
Sbjct: 117 ENDVDSIIGVLHIKDAFTFFEKNEVYRSSIK-----DIDGLIRPVDFIPETVNINDLFKK 171

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  +  +A+V+DE+G   GL++ EDI+  L+ +I  EH  +++ I    D TFI+D  T
Sbjct: 172 MQSKKSHLAMVVDEYGQISGLIAMEDILEELVGNIEDEHDEEENYIRKNDDETFIMDGMT 231

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
           +  ++ + +    +    +   ++L G I S+ D+IP  G+  V+   G+   ++  + +
Sbjct: 232 EFSDVKEALSLPVD----DDAYETLNGFIISLSDKIPEEGDKTVISAYGYRFSVMSVEDK 287

Query: 306 CVRRVRIRRL 315
            +++V I++L
Sbjct: 288 VIKQVMIKKL 297


>gi|163782296|ref|ZP_02177294.1| hypothetical protein HG1285_05900 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882329|gb|EDP75835.1| hypothetical protein HG1285_05900 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 422

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 134/246 (54%), Gaps = 16/246 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G FSE E+E+   +    ++ + +IM  R  I A+++   V E +   +K+G S +PVYK
Sbjct: 184 GEFSEDEREMVEKVFEMDEVLVREIMTPRPDIFALKEDLKVGEVIEDIKKHGHSRIPVYK 243

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             LD+  G+VH++D++            +N N   +     + +LFVP  M V  LL  +
Sbjct: 244 ERLDDVSGVVHVKDLLP-----------VNKNRDRALGEFKREVLFVPEVMSVGSLLQEL 292

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +++R ++A+V+DEHG   GLV+  D++  L+     E   ++  I  +S + F +D   D
Sbjct: 293 RKARTQIAMVVDEHGAVSGLVTMYDVLRWLV-GEVPEEWEEEKEIEKLSYDMFRIDGSAD 351

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +EE+A+ +G +   L  E D D++ G + + L+++P +G+   E  GF+ ++ D +   V
Sbjct: 352 IEEVAQKLGFE---LPEEYDYDTVSGFVMANLEKVPEKGD-EFEYDGFKFIVGDVERNRV 407

Query: 308 RRVRIR 313
           + V ++
Sbjct: 408 KEVIVK 413


>gi|198277149|ref|ZP_03209680.1| hypothetical protein BACPLE_03357 [Bacteroides plebeius DSM 17135]
 gi|198269647|gb|EDY93917.1| hypothetical protein BACPLE_03357 [Bacteroides plebeius DSM 17135]
          Length = 434

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  +   I+RF +    ++M SR+ I  +E  +T  E +    + G S +PVY+ + D  
Sbjct: 191 ENNMLEGIIRFGEETAKEVMTSRLDIVDLEIHSTFSEVLKCINENGYSRIPVYEETRDQI 250

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ Y+                   NLI+  LFVP + ++ DLL + Q ++I 
Sbjct: 251 KGILYIKDLLPYLDK----------GEDFKWQNLIRPALFVPENKMIGDLLRDFQANKIH 300

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     +++N ++ + +T L +  K
Sbjct: 301 IAVVVDEFGGTSGIVTMEDIIEEIVGEINDEYDEEERTYVKLTENVYVFEGKTLLSDFYK 360

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           II       +    D DSL GL+  +    PA  E++     +   IL+   R +++V++
Sbjct: 361 IIKDSEEVFEDVSGDADSLAGLLLELKGEFPALHEII-NYQNYRFEILEMTSRRIQKVKV 419


>gi|330836141|ref|YP_004410782.1| hypothetical protein Spico_0162 [Spirochaeta coccoides DSM 17374]
 gi|329748044|gb|AEC01400.1| protein of unknown function DUF21 [Spirochaeta coccoides DSM 17374]
          Length = 450

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 126/233 (54%), Gaps = 13/233 (5%)

Query: 57  IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFE 116
           IRL     S  GI  + E+E+ +NI  F    I ++M  R  I A+ + A++ E   +  
Sbjct: 184 IRLMVDAGSDSGIIEDDEQEMIHNIFDFNDSPISELMTHRSDIVAIPETASMSEVFHLAN 243

Query: 117 KYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPS 176
               S  PVY++S+DN  G+VH++D+ ++  H      + +L      +++I+   FVP 
Sbjct: 244 DGHYSRFPVYRDSIDNIIGIVHIKDLFTFYGH---DEESFDL------TSIIRPPYFVPF 294

Query: 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVS 236
           S L  DL   +++++  MA+++DE+GGT GLV+ ED++  +M  I  EH  ++ +I A  
Sbjct: 295 SKLADDLFREMKKTKTHMAIILDEYGGTLGLVTMEDLIEHVMGRIYDEHDEEELVIQAQE 354

Query: 237 DNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           D ++++     + E+ + +G        E + +++GG +  +L RIP+  E V
Sbjct: 355 DGSYLISGIVPIYEVNEELGLALP----EDEYETIGGFLVGLLGRIPSGSEDV 403


>gi|257052623|ref|YP_003130456.1| protein of unknown function DUF21 [Halorhabdus utahensis DSM 12940]
 gi|256691386|gb|ACV11723.1| protein of unknown function DUF21 [Halorhabdus utahensis DSM 12940]
          Length = 468

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 132/250 (52%), Gaps = 18/250 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E+++    LRF +    ++M  R+ ++A+   ++V EA+      G + +PVY
Sbjct: 210 EGVLDEEERQMLQRTLRFNRTIAKEVMTPRLDMDAISADSSVEEAIAECVHSGHTRLPVY 269

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  LDN  G+V++RD++      Y  T+++ L       +LI+  L VP S  V DLLT 
Sbjct: 270 EGGLDNVIGVVNIRDLVR--DAQYGGTDDVELQ------DLIEPTLHVPESKNVDDLLTE 321

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI--TSEHHSKKSMISAVSDNTFIVDA 244
           ++  R+ M +VIDE G T+GLV+ ED+   ++ +I    E H     I  V+D+T  V  
Sbjct: 322 MRSERLHMVIVIDEFGTTEGLVTMEDLTEEIVGEILEGEEEHP----IEFVNDDTVTVKG 377

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
             ++EE+ + +  D   L   ++ +++ G IF+   R+   GE + E  G +I +   + 
Sbjct: 378 EVNIEEVNEALSID---LPEGEEFETIAGFIFNRAGRLVEEGESI-EYEGIQIRVEQVEN 433

Query: 305 RCVRRVRIRR 314
             + + RI R
Sbjct: 434 TRIMKARITR 443


>gi|94987383|ref|YP_595316.1| Mg2+/Co2+ transporter [Lawsonia intracellularis PHE/MN1-00]
 gi|94731632|emb|CAJ54995.1| Putative Mg2+ and Co2+ transporter CorC [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 283

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 133/256 (51%), Gaps = 15/256 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  +G     E  +  +IL+F ++++ D+MI R   + +   + V E      + G S
Sbjct: 32  LEARDDGELDTEEGSMILSILKFDELQVQDVMIPRTDFDCMPSGSPVSEVASCIVETGHS 91

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +P+YK++ DN  G+ + +D+I  +         I+  +        +   FVP +  V 
Sbjct: 92  RIPIYKDTRDNIVGIAYAKDLIELLLDPSKHHTPIDTTM--------REPFFVPETKPVR 143

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTF 240
           +LL   +  +  +A+ IDE+GGT GL++ ED++  ++ DI  EH + K+  I  + DN +
Sbjct: 144 ELLQEFRTRKNHLAIAIDEYGGTSGLLTIEDVLEEIVGDIEDEHDAPKEEDIHVIGDNCY 203

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
            +  R  L++L K +G +        +VD++GG +      +P +GE   E  G++  + 
Sbjct: 204 ELSGRAYLDDLLK-LGINLEA----DEVDTIGGYLSLEAGHVPEQGE-TFEFDGWKFEVT 257

Query: 301 DADVRCVRRVRIRRLV 316
           +AD + +R+VR+ +L+
Sbjct: 258 EADAKQIRKVRVEKLL 273


>gi|238924322|ref|YP_002937838.1| hemolysin [Eubacterium rectale ATCC 33656]
 gi|238875997|gb|ACR75704.1| hemolysin [Eubacterium rectale ATCC 33656]
          Length = 303

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 133/250 (53%), Gaps = 10/250 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G    +E E+ +N+  F    + DIM  R +I +++   +  +A+      G+S  PVY
Sbjct: 57  QGTILASEAELIHNVFEFDDKEVKDIMTHRKNIVSLDGSMSFIDAIEFIIDTGKSRFPVY 116

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +N +D+  G++H++D  ++        ++I          LI+ + F+P ++ ++DL   
Sbjct: 117 ENDVDSIIGVLHIKDAFTFFEKNEVYRSSIK-----DIDGLIRPVDFIPETVNINDLFKK 171

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  +  +A+V+DE+G   GL++ EDI+  L+ +I  EH  +++ I    D TFI+D  T
Sbjct: 172 MQSKKSHLAMVVDEYGQISGLIAMEDILEELVGNIEDEHDEEENYIRKNDDETFIMDGMT 231

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
           +  ++ + +    +    +   ++L G I S+ D+IP  G+  V+   G+   ++  + +
Sbjct: 232 EFSDVKEALSLPVD----DDAYETLNGFIISLSDKIPEEGDKTVISAYGYRFSVMSVEDK 287

Query: 306 CVRRVRIRRL 315
            +++V I++L
Sbjct: 288 VIKQVMIKKL 297


>gi|317472661|ref|ZP_07931976.1| hypothetical protein HMPREF1011_02326 [Anaerostipes sp. 3_2_56FAA]
 gi|316899838|gb|EFV21837.1| hypothetical protein HMPREF1011_02326 [Anaerostipes sp. 3_2_56FAA]
          Length = 382

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 123/228 (53%), Gaps = 14/228 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +DAS E G+  + EKE+  N+  F+     DIMI R+ I  V   A+  E M +F     
Sbjct: 136 VDASHEDGVIEKDEKEMIYNVFDFKDSIAKDIMIPRIDITFVSADASYDEVMELFMATQY 195

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S +PVY+ + D   G+V+++D+  Y +    +  +I         ++++   F   +  +
Sbjct: 196 SRLPVYEETKDKVIGIVYLKDIYFYRTQHRGEIFHIR--------DVLRKPFFTYETQKI 247

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S LLT +Q+  +  ++V+DE+G T GL++ EDI+  L+ +I  E+  S+      + D +
Sbjct: 248 SSLLTQMQQENVSFSIVLDEYGITAGLITLEDILEELVGEIRDEYDESESESFQELEDGS 307

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           ++V+A   L++L  +I T+       +D DS+GG +  +LD +P+ GE
Sbjct: 308 YLVNASLKLDDLNDLIDTEIES----EDYDSVGGYVIELLDHLPSEGE 351


>gi|55379245|ref|YP_137095.1| hypothetical protein rrnAC2600 [Haloarcula marismortui ATCC 43049]
 gi|55231970|gb|AAV47389.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 475

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 133/249 (53%), Gaps = 12/249 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E+E+    LRF    + ++M  R+ + AV    TV EA+    + G + +PVY
Sbjct: 224 EGVLDEDEREMLQRTLRFNDTIVKEVMTPRLDMTAVAKDNTVEEALETCIQSGHARIPVY 283

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + SLDN  G++H+RD++  +++  A   +++L       +LI+  L VP S  V DLLT 
Sbjct: 284 EGSLDNVIGVIHIRDLVRDLNYGEALARDMDLE------DLIEPTLHVPESKNVDDLLTE 337

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++  R+ M +VIDE G T+GLV+ ED+   ++         ++  I  V D+T  V    
Sbjct: 338 MRAERLHMVIVIDEFGTTEGLVTMEDLTEEIVG--EILEGEEEEPIEYVDDDTVTVKGEV 395

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           ++EE+ + +  D +  +GE+  +++ G IF+   R+   GE +    G EI +   +   
Sbjct: 396 NIEEVNEAL--DLDLPEGEE-FETIAGFIFNRAGRLVEEGETIT-YDGVEIRVEQVENTR 451

Query: 307 VRRVRIRRL 315
           + + R+ RL
Sbjct: 452 IMKARVVRL 460


>gi|218261476|ref|ZP_03476287.1| hypothetical protein PRABACTJOHN_01953 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223994|gb|EEC96644.1| hypothetical protein PRABACTJOHN_01953 [Parabacteroides johnsonii
           DSM 18315]
          Length = 446

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+ + I++F     D+IM  R+ +  ++ K +    +    + G S +PVY +S DN 
Sbjct: 205 EKEMLSEIIKFYNKTADEIMTPRLDMEDIDIKTSFRTVVDFIIRSGYSRIPVYADSEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ Y+     K +           +LI+   FVP +  + DLL   + S+I 
Sbjct: 265 KGILYIKDLLPYVE----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTSKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEKQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D     K  ++V++L GL+  +    P R E++ E   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPTEFGKLTEEVETLAGLLLEIKGDFPRRREII-EYDDYRFQVLEIDNRRILKVKF 433

Query: 313 RRL 315
            R+
Sbjct: 434 NRI 436


>gi|326336223|ref|ZP_08202395.1| hemolysin C [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691732|gb|EGD33699.1| hemolysin C [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 432

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 132/246 (53%), Gaps = 16/246 (6%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E +I + I+ F    I  +M  R+ I+A+++  T  E +   ++ G S +PVY+ ++
Sbjct: 196 TQEEHKILSGIVSFGNTDIRAVMRPRIDISAIDETMTYQEVLAFIQENGYSRVPVYQENI 255

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D   G+++ +D++ Y+     + N I            +   FVP +  + DLL   Q+ 
Sbjct: 256 DKITGIIYAKDLLPYLDEKDFEWNQIK-----------RKAFFVPENKKLDDLLAEFQQK 304

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +I +A+V+DE+GGT G+V+ EDI+  ++ +I+ E+ +  S  S + ++ F+ D +T L++
Sbjct: 305 KIHLAIVVDEYGGTLGVVTLEDIIEEIVGEISDEYDADDSFFSKIDEHNFLFDGKTSLKD 364

Query: 251 LAKIIGTD----CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
             +I+  +     N  K   + +++ G +  ++   P + +VVL    +   + + D + 
Sbjct: 365 FYRILNINEEKQENFEKVRGESETIAGFLLELIGVFPEKKQVVL-FEDYTFTVENIDKKR 423

Query: 307 VRRVRI 312
           ++++R+
Sbjct: 424 IKQLRV 429


>gi|154490937|ref|ZP_02030878.1| hypothetical protein PARMER_00854 [Parabacteroides merdae ATCC
           43184]
 gi|154088685|gb|EDN87729.1| hypothetical protein PARMER_00854 [Parabacteroides merdae ATCC
           43184]
          Length = 446

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EKE+ + I++F     D+IM  R+ +  ++ K +    +    + G S +PVY +S DN 
Sbjct: 205 EKEMLSEIIKFYNKTADEIMTPRLDMEDIDIKTSFRTVVDFIIRSGYSRIPVYADSEDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ Y+     K +           +LI+   FVP +  + DLL   + S+I 
Sbjct: 265 KGILYIKDLLPYVE----KPDTFRWQ------SLIRPAYFVPETKKIDDLLEEFRTSKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT G+V+ EDI+  ++ +I+ E+   +     ++D + I +A+  L +  +
Sbjct: 315 MAIVVDEFGGTSGIVTMEDILEEIVGEISDEYDEDEKQFIRLADGSLIFEAKILLTDFFR 374

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +I  D     K  ++V++L GL+  +    P R E++ E   +   +L+ D R + +V+ 
Sbjct: 375 VIDADPTEFGKLTEEVETLAGLLLEIKGDFPRRREII-EYDDYRFQVLEIDNRRILKVKF 433

Query: 313 RRL 315
            R+
Sbjct: 434 NRI 436


>gi|149369661|ref|ZP_01889513.1| putative transmembrane CorC/HlyC family transporter associated
           protein [unidentified eubacterium SCB49]
 gi|149357088|gb|EDM45643.1| putative transmembrane CorC/HlyC family transporter associated
           protein [unidentified eubacterium SCB49]
          Length = 410

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 131/244 (53%), Gaps = 14/244 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E++I   I+ F       +M  R+ I A+ + A   + M    + G S +PVY++S+DN 
Sbjct: 177 EQKILQGIVTFGNTDTKQVMKPRMEIFALNEAAAFADIMPQIIERGFSRIPVYEDSIDNI 236

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+++++D++ YI H            +L    L ++  FVP +  + DLL   +E +  
Sbjct: 237 TGVLYVKDLMPYIEHK-----------ELDWKTLKRDTYFVPENKKLDDLLNEFKEMKKH 285

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT GL+S EDI+  ++ +I+ E   +  + S + DNTF+ + +T L++  +
Sbjct: 286 LAIVVDEYGGTSGLISLEDIIEEIVGEISDEFDDEDLIFSKLDDNTFVFEGKTSLKDFYR 345

Query: 254 IIG-TDCNCLKGEQ-DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           +I   D +  + E+ + +++ G +  +    P + E++     +   I   D + +++++
Sbjct: 346 VIELEDPSLFENEKGEAETIAGFLLEISKGFPKKNEII-NFHNYAFAIEVFDNKRIKQIK 404

Query: 312 IRRL 315
           + R+
Sbjct: 405 LSRV 408


>gi|94985386|ref|YP_604750.1| hypothetical protein Dgeo_1285 [Deinococcus geothermalis DSM 11300]
 gi|94555667|gb|ABF45581.1| CBS domain-containing protein DUF21 [Deinococcus geothermalis DSM
           11300]
          Length = 446

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 133/261 (50%), Gaps = 25/261 (9%)

Query: 52  SHHKG-----IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
            HH       IR+    +S EG+  + EKE+  N+    +  + ++M  R  +  VE   
Sbjct: 175 GHHTAYSEEEIRMIVSASSQEGVLEDDEKELVYNVFDLSETTVREVMTPRTEMVTVEATC 234

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-- 164
            +   + +  ++G S +PVY++S DN  G+ H  DV+ Y+              +L E  
Sbjct: 235 PLRRLLELNAEHGYSRVPVYQDSADNVVGVAHTSDVLRYLD-------------RLDETL 281

Query: 165 -SNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITS 223
            ++++  + FVP  M ++DLL  ++E +  MA+V+DE GGT GLV+ ED +  ++ +I  
Sbjct: 282 IADVMHPVFFVPEGMKINDLLAKMREKKSHMAIVVDEFGGTSGLVTLEDALEEIVGEIYD 341

Query: 224 E-HHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRI 282
           E    ++ +I  + +  +++DA   + E+ + +GT  N   GE + D+L G + S    I
Sbjct: 342 ETDEEEQPLIEVLGEGIYLMDASLTVGEVEERLGT--NLEDGEGEYDTLSGFMTSHFGDI 399

Query: 283 PARGEVVLEIPGFEIVILDAD 303
           P  G+  +   G+   ++DAD
Sbjct: 400 PEIGQSFV-YGGWAFTVVDAD 419


>gi|197294655|ref|YP_001799196.1| Putative transporter [Candidatus Phytoplasma australiense]
 gi|171853982|emb|CAM11945.1| Putative transporter [Candidatus Phytoplasma australiense]
          Length = 437

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 132/250 (52%), Gaps = 11/250 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +GI  + E  +  NI  F    I ++M  R  + A+ D  T  E +        +  PVY
Sbjct: 183 KGIIDKNENNMIQNIFDFDHTSISEVMRHRTQVVAINDDITKEEIIDFIRNQKYTRFPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K ++DN  G+VH++D+   +  M+  +N           NLI+   FVP S   S+L   
Sbjct: 243 KTNIDNIIGVVHVKDIFKCL--MFNPSNE-----PFDIKNLIRETYFVPDSKNTSELFRE 295

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDAR 245
           +Q S+  +A+VIDEHGGT G++++ED++  ++ +I  E+   +  MI  +S   +I +  
Sbjct: 296 MQSSKNHIAVVIDEHGGTAGIITFEDLIEEILGEIFDEYDKDEEIMIKEISQGEYIANGF 355

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADV 304
           ++LEE+ +II  + +   G+ D D+L G +   L R+P + E + +   G++  +L    
Sbjct: 356 SNLEEIEEIIKIEFD--DGDCDYDTLNGFLIGKLGRLPQKDEKIKINYKGYQFEVLQLKD 413

Query: 305 RCVRRVRIRR 314
           + + +++IR+
Sbjct: 414 KVISKIKIRK 423


>gi|308062754|gb|ADO04642.1| hypothetical protein HPCU_07510 [Helicobacter pylori Cuz20]
          Length = 447

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ EH  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEHDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDIIIS-HGYAFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|110637788|ref|YP_677995.1| transport protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110280469|gb|ABG58655.1| conserved hypothetical protein; possible transport protein
           [Cytophaga hutchinsonii ATCC 33406]
          Length = 434

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 129/253 (50%), Gaps = 14/253 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
              + G  +  E ++  N+  F  + +  +M  R SINA++    +   +      G S 
Sbjct: 191 QGKMSGALNPNEHQLIKNVFGFIDVTVRQVMTPRTSINAIDIDLPLEYVLNKIVNEGYSR 250

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVYK+++DN  G+++ +D++     M  K   I L       + ++   FVP +  +++
Sbjct: 251 LPVYKDNIDNIIGILYTKDLLK----MMNKGEQIKLQ------SAMRQPYFVPETKKINE 300

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL N+Q   + MA++IDE GG  G+ + EDI+  L+ +I  EH  +  ++  VS N F+V
Sbjct: 301 LLKNLQAKHLHMAIIIDEFGGVSGITTIEDIIEELVGEIQDEHDDEAPVVEQVSANEFVV 360

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           +A  +++++ + +      L    + D+L GL+  +  RIP   E  L   G++  IL  
Sbjct: 361 NALANIQDVNEWLPVP---LPEGPEYDTLAGLLIKIFTRIPDLSE-KLTFEGYQFTILKK 416

Query: 303 DVRCVRRVRIRRL 315
           + + +  V++ +L
Sbjct: 417 NKQSILLVKVHKL 429


>gi|315185806|gb|EFU19572.1| CBS domain containing protein [Spirochaeta thermophila DSM 6578]
          Length = 269

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 129/242 (53%), Gaps = 16/242 (6%)

Query: 72  ETEKE-IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           E EK+ +   I    +  + ++M+ R+ +  V+ ++ + E +      G S +P Y+ ++
Sbjct: 27  EAEKQDMIRGIEELSETTVKEVMVPRIDVVFVDIESPLEELLERVADSGHSRLPAYEKTI 86

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G+++++D++     +  K   I +        L++   F+P S  + DLL  ++  
Sbjct: 87  DNVVGILYVKDILK----LLVKNQPIEIG------KLVRPAYFIPESKRLDDLLREMKRR 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           R+ +A+V+DE+GG  G+V  EDI+  ++ DI  E  +++  +  + + TF+ DAR  LEE
Sbjct: 137 RVHIAIVVDEYGGVSGIVCLEDIIEEIVGDIQDEFDNEEEEVVQLDERTFLCDARILLEE 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
           L   +G +        + D+LGG +F +L +IP R E V+     E ++ D +   +++V
Sbjct: 197 LGDTLGIELES----PETDTLGGFVFELLGKIPVRYERVI-YNDIEFIVQDLEGHKIKKV 251

Query: 311 RI 312
           ++
Sbjct: 252 KV 253


>gi|297568440|ref|YP_003689784.1| CBS domain containing protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296924355|gb|ADH85165.1| CBS domain containing protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 292

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 121/248 (48%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ +  E E+   I+  +  +  ++M  R  +   E    + + + +    G S +PVY
Sbjct: 56  QGLITPEEGEMIAGIMELKDTQAYEVMTPRAEMVMAEAATPLADLLQLIIDRGFSRIPVY 115

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++S D   G++H +D++ Y          +N +   +   L K  +FV     V  LL +
Sbjct: 116 RDSPDQIIGILHAKDLLPYC---------LNGSEPPTAGMLAKPAVFVQEKSKVIKLLKS 166

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            Q+ +  MA+V DE GG  GL++ EDIV  ++ DI  EH         V  NT + DA+ 
Sbjct: 167 FQQQKNHMAVVNDEFGGVRGLITLEDIVEEIVGDIVDEHDRTTRRWKVVDPNTVLADAKV 226

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           D+EE+    GT+      E   +SLGGLI   LD++P  G V L I      ++ AD R 
Sbjct: 227 DIEEVEDFFGTELP----EGPYESLGGLILHHLDQVPPPG-VTLSIESLVFEVIAADKRR 281

Query: 307 VRRVRIRR 314
           V  V+I++
Sbjct: 282 VLTVKIQK 289


>gi|317056988|ref|YP_004105455.1| hypothetical protein Rumal_2341 [Ruminococcus albus 7]
 gi|315449257|gb|ADU22821.1| protein of unknown function DUF21 [Ruminococcus albus 7]
          Length = 412

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 129/246 (52%), Gaps = 13/246 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E ++  + L F +I I  I + RVSI AVE +  + +   +F K   S +PVY
Sbjct: 174 EGVLEEQESDLVRSALDFDEITISSIFVPRVSIAAVELEDDIEDIKDLFLKTKYSRLPVY 233

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +D+  G++H  D       MY      ++      S ++   +++  S  +S+ L  
Sbjct: 234 EKDIDHITGVIHQADFF----EMYVSKGKKDI------SRILGEPIYITESRKISETLKL 283

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q+ ++ MA+V+D++GGT G+ + EDI+  L+ +I  E   + +    +SDN+  V A  
Sbjct: 284 MQKEKVHMAVVLDQYGGTAGICTLEDIIEELVGEIYDESDEEDTSFVKLSDNSCEVSAEL 343

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            + +  +    D N ++ E+   S+GG I  +LDRIP  GE +   P FE+ I   D + 
Sbjct: 344 SISDFLERWELDENAIETER--HSVGGWIMELLDRIPEEGERIFS-PPFEMEIHMQDDQK 400

Query: 307 VRRVRI 312
           + RV+I
Sbjct: 401 IGRVKI 406


>gi|325285935|ref|YP_004261725.1| gliding motility-associated protein GldE [Cellulophaga lytica DSM
           7489]
 gi|324321389|gb|ADY28854.1| gliding motility-associated protein GldE [Cellulophaga lytica DSM
           7489]
          Length = 443

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 129/247 (52%), Gaps = 19/247 (7%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E++I   I+ F       +M  R+ I A++ +    E +   ++ G S +PVY+ ++
Sbjct: 205 TKEEQKILEGIVSFGNTDTKQVMRPRIDIFALDAELKFLEVVEEIKQKGYSRIPVYEENV 264

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN +G+++++D++ YI                +   L++   FVP +  + DLL   QE 
Sbjct: 265 DNVKGVLYVKDLLPYIDRK-----------AFNWVTLLREPYFVPENKKLDDLLKEFQEK 313

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +  +A+V+DE+GGT G+V+ EDI+  ++ DI+ E   +  + S + D TF+ D +T L+E
Sbjct: 314 KNHLAVVVDEYGGTSGIVTLEDIIEEIVGDISDEFDDEDLVFSKIDDLTFVFDGKTTLKE 373

Query: 251 LAKII-----GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             ++        D    KGE   +++ G +  +    P RGE VL    ++ V+   D +
Sbjct: 374 FYRVARITEDEDDFEEQKGES--ETIAGFVLEIAGSFPKRGEKVL-FKNYQFVVESLDKK 430

Query: 306 CVRRVRI 312
            ++++++
Sbjct: 431 RLKQIKV 437


>gi|302869292|ref|YP_003837929.1| hypothetical protein Micau_4844 [Micromonospora aurantiaca ATCC
           27029]
 gi|315504233|ref|YP_004083120.1| hypothetical protein ML5_3455 [Micromonospora sp. L5]
 gi|302572151|gb|ADL48353.1| protein of unknown function DUF21 [Micromonospora aurantiaca ATCC
           27029]
 gi|315410852|gb|ADU08969.1| protein of unknown function DUF21 [Micromonospora sp. L5]
          Length = 461

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 132/249 (53%), Gaps = 15/249 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+    E+++ +++         ++M+ R  +  +E++ T+ +A+ +F + G S +
Sbjct: 188 AEQRGVVEHGERQMIHSVFALGDTIAREVMVPRTEMVWIEERKTLAQALALFLRSGFSRI 247

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   ++D+  G+++++D+I  +    A         Q+  + L++   FVP S  V DL
Sbjct: 248 PVIGENVDDVLGVLYLKDLIRRVQGDQAAR-------QMPVAELMRPATFVPESKPVDDL 300

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L+ +Q +R  + +V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  +  + D    V 
Sbjct: 301 LSEMQAARNHLVIVVDEYGGTGGLVTIEDILEEIVGEITDEYDVERPPVEHLPDGAVRVT 360

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +E L ++  T+        +V+++GGL+   L R+P  G    E+ G  +V   A+
Sbjct: 361 ARLPVENLGELFDTELPT----DEVETVGGLLAQALGRVPIPGAEA-EVAGLRLV---AE 412

Query: 304 VRCVRRVRI 312
               RR RI
Sbjct: 413 GTTGRRNRI 421


>gi|283796373|ref|ZP_06345526.1| putative transporter [Clostridium sp. M62/1]
 gi|291075781|gb|EFE13145.1| putative transporter [Clostridium sp. M62/1]
          Length = 459

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 117/224 (52%), Gaps = 11/224 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG-RSWMPV 125
           +G+    E E+  NI+     +  DIM  R ++ A+    T+ EA+    + G  S  PV
Sbjct: 198 QGVLEADEAEMITNIVELGDKQAGDIMTRRRNVAALPASMTLGEAVDFILREGINSRFPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y   +D+ RG++H+RD ++       +   I+         L++   F+P +  ++ L  
Sbjct: 258 YGEDIDDIRGILHLRDAVACAQSQENRGKQID-----QVEGLLRTAHFIPETRNINPLFK 312

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q  +I M +V+DE+G T G+V+ EDI+  ++ +I  E+   + MIS   D +F+ D  
Sbjct: 313 EMQSQKIHMEIVVDEYGQTAGIVTMEDILEEIVGNILDEYDEDEEMISRREDGSFVFDGL 372

Query: 246 TDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGE 287
           T LE+++K +G       GE  ++ D+L G + S L+R+P  GE
Sbjct: 373 TPLEDVSKELGL---AFDGEDSENFDTLNGFLISRLNRVPREGE 413


>gi|295091464|emb|CBK77571.1| Hemolysins and related proteins containing CBS domains [Clostridium
           cf. saccharolyticum K10]
          Length = 459

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 117/224 (52%), Gaps = 11/224 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG-RSWMPV 125
           +G+    E E+  NI+     +  DIM  R ++ A+    T+ EA+    + G  S  PV
Sbjct: 198 QGVLEADEAEMITNIVELGDKQAGDIMTRRRNVAALPASMTLGEAVDFILREGINSRFPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y   +D+ RG++H+RD ++       +   I+         L++   F+P +  ++ L  
Sbjct: 258 YGEDIDDIRGILHLRDAVACAQSQENREKQID-----QVEGLLRTAHFIPETRNINPLFK 312

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q  +I M +V+DE+G T G+V+ EDI+  ++ +I  E+   + MIS   D +F+ D  
Sbjct: 313 EMQSQKIHMEIVVDEYGQTAGIVTMEDILEEIVGNILDEYDEDEEMISRREDGSFVFDGL 372

Query: 246 TDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGE 287
           T LE+++K +G       GE  ++ D+L G + S L+R+P  GE
Sbjct: 373 TPLEDVSKELGL---AFDGEDSENFDTLNGFLISRLNRVPREGE 413


>gi|293374397|ref|ZP_06620722.1| CBS domain protein [Turicibacter sanguinis PC909]
 gi|325837147|ref|ZP_08166318.1| hypothetical protein HMPREF9402_0430 [Turicibacter sp. HGF1]
 gi|292646957|gb|EFF64942.1| CBS domain protein [Turicibacter sanguinis PC909]
 gi|325491097|gb|EGC93391.1| hypothetical protein HMPREF9402_0430 [Turicibacter sp. HGF1]
          Length = 422

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 139/255 (54%), Gaps = 23/255 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAV------EDKATVYEAMLMFEKYGR 120
           EG+  + E E+  ++L   +  + DIM  RV + AV      ED   V+    + EKY R
Sbjct: 178 EGVLQQDEVEMLQSVLDLSETFVKDIMTPRVDVTAVSIHDSNEDIKNVF----LEEKYSR 233

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
             +PVY+ S DN  G+++ RD+ + I        +IN+       +++++ ++V  +M V
Sbjct: 234 --IPVYEESRDNIIGILYQRDLFAEIIEK-GSVEDINI------VDIMRDPMYVSYTMRV 284

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           SDLLT +Q  +  +A+V DE+GGT GLV+ ED++  ++ +I  EH  ++ +++  SD  +
Sbjct: 285 SDLLTRLQFEKQHIAIVADEYGGTAGLVTMEDVLEEVVGEIYDEHDEEEQLVTKKSDTLY 344

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
              A  DL+EL  I+  D +     +D  SLG  ++S ++ IP  G+ + +       I+
Sbjct: 345 EAKADIDLDELFDIMDIDLDI---PEDAYSLGSWMYSKIEDIPDIGD-MYQYHHLVFTII 400

Query: 301 DADVRCVRRVRIRRL 315
           + + R +++V+I  L
Sbjct: 401 EVEDRRIKKVKIEVL 415


>gi|223984376|ref|ZP_03634516.1| hypothetical protein HOLDEFILI_01810 [Holdemania filiformis DSM
           12042]
 gi|223963671|gb|EEF68043.1| hypothetical protein HOLDEFILI_01810 [Holdemania filiformis DSM
           12042]
          Length = 399

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 129/253 (50%), Gaps = 21/253 (8%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  EG     E ++    + F  + + DI+  RV + AV+   ++ E  LMF     S 
Sbjct: 138 EAQNEGDLEAHESDLICAAIEFNDLDVKDILTPRVDVIAVDVTDSLDEIELMFRNNNFSR 197

Query: 123 MPVYKNSLDNPRGMVHMRDVIS-YISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
           +PVY+NS+DN  G++H +D  + Y +HM             +  ++ + +L+    + +S
Sbjct: 198 LPVYENSIDNIVGVIHEKDFYNLYYNHMG------------TFKSITQTLLYTSPHVKIS 245

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
            LL  +Q S+  MA+V+DE+GGT G+++ EDI+  L+ +I  EH   K     +  NT++
Sbjct: 246 SLLKQLQSSKTHMAVVLDEYGGTAGIITLEDILEELVGEIYDEHDQVKEYYKELDPNTYL 305

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           ++   DL+++ +  G     L+ E+D D  ++ G +   L+RIP  GE         + +
Sbjct: 306 IECDMDLDDMFEFFG-----LEDEEDYDFITVSGWVIHELERIPKVGE-SFTYKNLVVTV 359

Query: 300 LDADVRCVRRVRI 312
              D R V  V++
Sbjct: 360 TQTDARKVIEVKV 372


>gi|300770809|ref|ZP_07080687.1| CBS domain protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762366|gb|EFK59184.1| CBS domain protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 437

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 130/246 (52%), Gaps = 14/246 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G    +E E+  N+  F +  + +IM+ R  I A++  AT  E +    + G S +P+Y 
Sbjct: 195 GALDFSEHELIKNVFDFNERIVKNIMVPRTKIVAIDKDATADEFINTVTEEGYSRIPIYD 254

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +++D   G+VH +D++  I     K   + L       N+++   F+P +  ++DL+   
Sbjct: 255 DNIDQIVGIVHTKDILPII----VKGKEVVLK------NIMRKPYFIPETKKINDLMAEF 304

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  RI++A+V+DE GGT G+V+ EDIV  L+ +I  E+  +  ++  +S+  +++DA   
Sbjct: 305 QLKRIQIAIVLDEFGGTAGMVTLEDIVEELVGEIQDEYDEETPVVERISETEYMIDAGAS 364

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + ++ + +  +   L    D D++ GL+  + D+IP  GE   E+ G+   I+    + +
Sbjct: 365 VHDVNEYLPLE---LPESSDYDTMAGLVSDLFDKIPEVGEYK-ELYGYTFTIMKKTQQNI 420

Query: 308 RRVRIR 313
             V++ 
Sbjct: 421 EFVKLE 426


>gi|254410841|ref|ZP_05024619.1| conserved domain protein [Microcoleus chthonoplastes PCC 7420]
 gi|196182196|gb|EDX77182.1| conserved domain protein [Microcoleus chthonoplastes PCC 7420]
          Length = 453

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 123/241 (51%), Gaps = 11/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+ NN+  F ++   ++M+ R SI+A+   ATV   +        S  PV   SLD+ 
Sbjct: 181 ERELLNNVFEFGEVLATEVMVPRTSIDAISSTATVQMVLEEIANTNHSRYPVTGESLDDI 240

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG++H +++   +S          L +       I+   FVP    +S+LL  +Q S + 
Sbjct: 241 RGIIHFKELAKPLSER-------KLTLDTPIEPWIRPARFVPEFTPLSELLPLMQRSHLA 293

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE GGT GLV+ +D+V+ ++ D       ++  I  V + TF+V A+ DLEE+ +
Sbjct: 294 MVMVVDEFGGTAGLVTLKDLVAEIIGDNPEPESPEEVPIQLVDEQTFLVQAQMDLEEVNE 353

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++  D N L    +  +L G +     +IP +GE +L     E+ ++ A    + R+ I 
Sbjct: 354 LL--DLN-LPVTDEYQTLAGFLLYQFQKIPLQGE-ILNYENLELKVISAAGPRLNRISIH 409

Query: 314 R 314
           R
Sbjct: 410 R 410


>gi|303247213|ref|ZP_07333487.1| CBS domain containing protein [Desulfovibrio fructosovorans JJ]
 gi|302491372|gb|EFL51260.1| CBS domain containing protein [Desulfovibrio fructosovorans JJ]
          Length = 271

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 139/280 (49%), Gaps = 22/280 (7%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW     AL K ++   +S  + I    ++A  EG   + +  +  NILR  K ++ DIM
Sbjct: 9   FWG----ALGKFFRQKSISIEELI----LEAKAEGTLIQEDASMLLNILRLEKKQVFDIM 60

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT 153
           I R  I   E    +     +   +G S +PVY+ + DN  G+V+ +D++S+I     + 
Sbjct: 61  IPRPDIVCAEADDGIPAICDLIRTHGHSRIPVYEGNRDNILGIVYAKDLLSHIVGAQGEM 120

Query: 154 NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI 213
            +           +++  LFVP ++ +  +L   +  +  MA+ +DE+GGT GL++ ED+
Sbjct: 121 PD--------PRAIMRAPLFVPETLDLKRMLLEFRSQKKHMAVALDEYGGTSGLITLEDV 172

Query: 214 VSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLG 272
           +  ++ +I  EH  SK   I       + V  R  LE+L   +G D   L+ EQ V+++G
Sbjct: 173 LEEIVGEIEDEHDPSKPEEIQETGPGVYRVSGRFPLEDLNAALGLD---LESEQ-VETIG 228

Query: 273 GLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           G +  +  R+P +G+    + G    I +AD R +R + I
Sbjct: 229 GFLTELAGRVPRQGD-AFTLEGRRFTIREADRRQIRWIAI 267


>gi|227538373|ref|ZP_03968422.1| TlyC family hemolysin [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241755|gb|EEI91770.1| TlyC family hemolysin [Sphingobacterium spiritivorum ATCC 33300]
          Length = 437

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 130/246 (52%), Gaps = 14/246 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G    +E E+  N+  F +  + +IM+ R  I A++  AT  E +    + G S +P+Y 
Sbjct: 195 GALDFSEHELIKNVFDFNERIVKNIMVPRTKIVAIDKDATADEFINTVTEEGYSRIPIYD 254

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +++D   G+VH +D++  I     K   + L       N+++   F+P +  ++DL+   
Sbjct: 255 DNIDQIVGIVHTKDILPII----VKGKEVVLK------NIMRKPYFIPETKKINDLMAEF 304

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  RI++A+V+DE GGT G+V+ EDIV  L+ +I  E+  +  ++  +S+  +++DA   
Sbjct: 305 QLKRIQIAIVLDEFGGTAGMVTLEDIVEELVGEIQDEYDEETPVVERISETEYMIDAGAS 364

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + ++ + +  +   L    D D++ GL+  + D+IP  GE   E+ G+   I+    + +
Sbjct: 365 VHDVNEYLPLE---LPESSDYDTMAGLVSDLFDKIPEVGEYK-ELYGYTFTIMKKTQQNI 420

Query: 308 RRVRIR 313
             V++ 
Sbjct: 421 EFVKLE 426


>gi|254780000|ref|YP_003058107.1| putative TlyC-like hemolysin; putative membrane protein
           [Helicobacter pylori B38]
 gi|254001913|emb|CAX30166.1| Putative TlyC-like hemolysin; putative membrane protein
           [Helicobacter pylori B38]
          Length = 449

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 133/245 (54%), Gaps = 13/245 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKGHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++ N         +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFN--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  I+ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGINKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIVS-HGYSFEVLSVDGAR 433

Query: 307 VRRVR 311
           ++R++
Sbjct: 434 IKRLK 438


>gi|330752744|emb|CBL88207.1| protein containing CBS and DUF21 domains [uncultured
           Leeuwenhoekiella sp.]
          Length = 428

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 134/242 (55%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F +++  ++MI R  I AVE   +  +    F + G S + VY++S+D
Sbjct: 201 DSEIQIFQNALEFSEVKSREVMIPRTEIVAVEKNQSPSDLNKQFTETGLSKILVYQDSID 260

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  +       ++ K   I        ++++  ++FVP +MLV D+L+ + + R
Sbjct: 261 DIIGYVHSFE-------LFKKPATI--------TDVLMPVIFVPETMLVKDVLSILIKKR 305

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+VIDE+GGT G+++ EDIV  L  +I  EH S   +   + ++T+   AR +++ L
Sbjct: 306 KSMAVVIDEYGGTSGMMTVEDIVEELFGEIEDEHDSVVLIEEKLEEDTYKFSARLEVDYL 365

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    +   L  +++ ++LGGLI +  + IP  G++V +I G++  IL      +  V+
Sbjct: 366 NEAYKLE---LPEDENYETLGGLIVNHTEGIPEEGDIV-DIDGYQFHILQTSTTKIELVK 421

Query: 312 IR 313
           +R
Sbjct: 422 VR 423


>gi|330506818|ref|YP_004383246.1| integral membrane protein [Methanosaeta concilii GP-6]
 gi|328927626|gb|AEB67428.1| integral membrane protein with CBS domains [Methanosaeta concilii
           GP-6]
          Length = 425

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 132/246 (53%), Gaps = 16/246 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  + EK +  N+  F    + DIM+ R+ I A+   AT  + + +      S  PVY
Sbjct: 182 EGVIEDHEKTMICNVFDFGDQLVKDIMVPRMDIIAININATYEDVIKIIRAEQFSRYPVY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
            N +DN  G+++++D++    ++ +K +             +K   +    M  S+L + 
Sbjct: 242 SNRIDNIVGILNVKDLV----YLDSKRD-------FDMKGFVKKPYYTFEFMNTSELFSE 290

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ R  MA+V+DE+GGT G+V+ ED+V  ++ +I+ E+  + + I  + +  +IVD  T
Sbjct: 291 MKKRRTHMAIVLDEYGGTAGIVTMEDLVEEIVGEISDEYDMQTNEIETIREGEYIVDGST 350

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +EEL ++IGTD       +  +S+GG +  +L R+P +GE V E      VI + +   
Sbjct: 351 RIEELNELIGTDIES----EHYESIGGFMIQLLGRLPRQGESV-EYMNTRFVIENVEKNR 405

Query: 307 VRRVRI 312
           ++++R+
Sbjct: 406 IKKIRV 411


>gi|297194456|ref|ZP_06911854.1| CBS domain-containing protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197718734|gb|EDY62642.1| CBS domain-containing protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 434

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 140/254 (55%), Gaps = 17/254 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + ++E   TV +A+ +  + G S +
Sbjct: 175 AEQESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVSIERYKTVRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D+        A+  +IN +   SE++++   +    FVP +  
Sbjct: 235 PVTGENEDDIVGVVYLKDL--------ARKTHINRD---SEADVVSTTMRPAVFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + D  
Sbjct: 284 AGDLLREMQQKRNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEELGDGC 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           F V AR D+ +L ++ G   + L  ++DV+++GGL+   L R+P  G + V+++P    +
Sbjct: 344 FRVTARLDIGDLGELYGLGADELD-DEDVETVGGLLAKALGRVPIAGAKAVVDLPDGRAL 402

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 403 RLTAESPAGRRNKI 416


>gi|317013260|gb|ADU83868.1| hypothetical protein HPLT_07415 [Helicobacter pylori Lithuania75]
          Length = 449

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S+ S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSH-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  I+ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGINKLEEGVFELEGML 377

Query: 247 DLE--ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE  E A  I  D  C   EQ   +LGG +FS+L+R+P  G+ +L   G+   +L  D 
Sbjct: 378 DLESVEEALHIEFDKEC---EQ--VTLGGYVFSLLERMPMEGDTILS-HGYAFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|308185260|ref|YP_003929393.1| hypothetical protein HPSJM_07600 [Helicobacter pylori SJM180]
 gi|308061180|gb|ADO03076.1| hypothetical protein HPSJM_07600 [Helicobacter pylori SJM180]
          Length = 449

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 133/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++ N         +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFN--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYSFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|68171345|ref|ZP_00544742.1| CBS:Transporter-associated region [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|67999243|gb|EAM85896.1| CBS:Transporter-associated region [Ehrlichia chaffeensis str.
           Sapulpa]
          Length = 224

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 122/229 (53%), Gaps = 28/229 (12%)

Query: 93  MISRVSINAVEDKATVYEAMLMFEK-----YGRSWMPVYKNSLDNPRGMVHMRDVISYIS 147
           MI R  I A+ D   V ++  + +K     Y R  +P Y+N+LDN  G +H++D+IS   
Sbjct: 1   MIPRTEIYAI-DITDVPDSKNLIDKVVSGQYTR--IPAYENNLDNIIGFIHIKDIIS--- 54

Query: 148 HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
                    N +   +  N+I+ ++++P SM   +L   +Q S I +A+V+DE+GGT+GL
Sbjct: 55  ---------NFHNDFNVRNIIREVMYIPPSMKAVNLFIKMQSSHIHVAVVVDEYGGTEGL 105

Query: 208 VSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDART---DLEELAKIIGTDCNCLK 263
           V+  D++  ++ DI  EH       I  +SDN   V+AR    +LEE+  I   DC    
Sbjct: 106 VTMADLIEEIVGDIDDEHDVPTVPSIVNISDNKIEVNARVLVKNLEEIFNIDFRDCK--- 162

Query: 264 GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            E D  ++GGLI S++ R+P   EV     G    I +AD RC+ ++ I
Sbjct: 163 -EDDYVTIGGLILSMIGRVPMTNEVFKHKSGAVFSIKEADDRCIYKIVI 210


>gi|210135657|ref|YP_002302096.1| hemolysin domain-containing protein [Helicobacter pylori P12]
 gi|210133625|gb|ACJ08616.1| hemolysin domain-containing protein [Helicobacter pylori P12]
          Length = 445

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++ N         +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFN--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIVS-HGYSFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|95930743|ref|ZP_01313476.1| protein of unknown function DUF21 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133223|gb|EAT14889.1| protein of unknown function DUF21 [Desulfuromonas acetoxidans DSM
           684]
          Length = 417

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 118/220 (53%), Gaps = 14/220 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  +  ++ + + +    ++R+ D+MI R  +  VE  A   + +   ++   S  PVYK
Sbjct: 181 GTLAGEQRRMLDGVFELSQLRVRDLMIPRTEVKGVEVDAPFQDLLDEVKRSTHSRFPVYK 240

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++LDN  G++H +DV+ ++       +N N+        +++   FVP +  V  LL   
Sbjct: 241 DTLDNIMGVIHSKDVLRFVDC----PHNFNMR------EVMRRPYFVPEAKQVEALLLAF 290

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  RI +A+V+DE+GG +G+V+ ED++  ++ +I  E+  ++S I+ ++   F+V+    
Sbjct: 291 RRRRIHLAVVLDEYGGVEGIVTLEDVLEEIVGEIRDEYDQEESGITPITPQRFLVEGGVG 350

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           L ++ + +G   +    E+D  +L GL+   L +IP  G+
Sbjct: 351 LRQVNRHVGLHLS----EEDATTLAGLMLRCLGQIPQEGD 386


>gi|29346906|ref|NP_810409.1| hemolysin-like protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|29338804|gb|AAO76603.1| hemolysin-related protein, containing CBS domain [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 352

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ +    E M    +   S +P+Y  S DN 
Sbjct: 110 ENNILEGIIRFGGETVKEVMTSRLDMVDLDVRTPFKEVMQCIIENAYSRIPIYSGSRDNI 169

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 170 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 219

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 220 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 279

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 280 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKVT-YHNYEFEVLEMDSRRILKVKF 338


>gi|19704818|ref|NP_604380.1| integral membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19715161|gb|AAL95679.1| magnesium and cobalt efflux protein CorC [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 426

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEATKTINEVWDEIIDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +NL I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIVGILYVKDLMEHI-----KNNELNLPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAIVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFFKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V IR L
Sbjct: 410 RVSKVFIRIL 419


>gi|260592566|ref|ZP_05858024.1| CBS domain protein [Prevotella veroralis F0319]
 gi|260535612|gb|EEX18229.1| CBS domain protein [Prevotella veroralis F0319]
          Length = 409

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 123/242 (50%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  INA+E+  ++ E   MF + G S + VY+  +D
Sbjct: 182 EDEVKIFQNALDFQDTKVRDCMVPRTEINAIEENCSLDELQQMFIESGNSKIIVYEGDID 241

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H        S M+    N   NI        + + FVP +M    L+    + +
Sbjct: 242 HIKGYIHS-------SEMFRSPKNWRDNI--------RRMPFVPETMAAQKLMQVFLQQK 286

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +    SDN +++ AR +++++
Sbjct: 287 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNLKYVAKQTSDNEYVLSARLEIDKV 346

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   +   L    D  ++GGLI  V    P   E++  I  +E  I+ + +  +  V+
Sbjct: 347 NEMFDLE---LPESDDYMTVGGLILHVYQSFPKLNEII-TIGQYEFKIIKSTMTKIELVK 402

Query: 312 IR 313
           ++
Sbjct: 403 LK 404


>gi|325681535|ref|ZP_08161060.1| hypothetical protein CUS_5394 [Ruminococcus albus 8]
 gi|324106802|gb|EGC01093.1| hypothetical protein CUS_5394 [Ruminococcus albus 8]
          Length = 412

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 130/246 (52%), Gaps = 13/246 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E ++  + L F +I I+ I + RVS+ AV+ +  + E   +F K   S +PVY
Sbjct: 174 EGVLEEQESDLVRSALDFDEITINSIFVPRVSVAAVDVEDDIEEIKDLFLKTKYSRLPVY 233

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +D+  G++H  D       MY      ++   L+E       +++  S  +S+ L  
Sbjct: 234 EKDIDHIIGVIHQADFF----EMYVSKGKKDIRRILNEP------IYITESRKISETLKI 283

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q+ ++ MA+V+D++GGT G+ + EDI+  L+ +I  E   + +    +S+N   V A  
Sbjct: 284 MQKEKVHMAVVLDQYGGTAGICTLEDIIEELVGEIYDESDEEDTSFIKISENECEVSAEL 343

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            + +  +  G + N ++ E+   S+GG I  +LDRIP  GE +   P FE+ I   D + 
Sbjct: 344 SISDFLERFGLEENAIETER--HSVGGWIMELLDRIPEEGERIFS-PPFEMEIHMQDEQK 400

Query: 307 VRRVRI 312
           + RV+I
Sbjct: 401 IGRVKI 406


>gi|299146725|ref|ZP_07039793.1| CBS domain protein [Bacteroides sp. 3_1_23]
 gi|298517216|gb|EFI41097.1| CBS domain protein [Bacteroides sp. 3_1_23]
          Length = 451

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|160886219|ref|ZP_02067222.1| hypothetical protein BACOVA_04226 [Bacteroides ovatus ATCC 8483]
 gi|156108104|gb|EDO09849.1| hypothetical protein BACOVA_04226 [Bacteroides ovatus ATCC 8483]
          Length = 451

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|213963776|ref|ZP_03392025.1| GldE [Capnocytophaga sputigena Capno]
 gi|213953552|gb|EEB64885.1| GldE [Capnocytophaga sputigena Capno]
          Length = 441

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 141/278 (50%), Gaps = 21/278 (7%)

Query: 46  WKLMKLSHHKG-IRLPRIDASLEGIFSE----TEKEIFNNILRFRKIRIDDIMISRVSIN 100
           W   +L   K  I + ++  +LE    E     EK+I  +I+ F      ++M+ RV I 
Sbjct: 172 WIQKRLGKQKSNISIGQLSQALELASEEDTTNEEKKILESIVSFGNTETREVMVPRVDIF 231

Query: 101 AVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNI 160
           A+ ++ +  E +      G S +PVY+ SLDN  G+++++D++ ++       N++    
Sbjct: 232 ALSEELSYQELLNEIVAIGYSRIPVYRESLDNITGVIYIKDLLPHLDKTDFDWNSVK--- 288

Query: 161 QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRD 220
                   +N  FVP +  + DLL+  QE +I +A+V+DE+GGT G+++ EDI+  ++  
Sbjct: 289 --------RNAFFVPENKKLDDLLSEFQEKKIHLAVVVDEYGGTCGVITLEDIIEEIVGS 340

Query: 221 ITSEHHSKKSMISAVSDNTFIVDARTDLEELAKII--GTDCNCLKGEQ--DVDSLGGLIF 276
           I  E          V DNTFI + +T L++  +I+    +   L  E+  D ++L G + 
Sbjct: 341 INDEFDDDDVTYFKVDDNTFIFEGKTVLKDFYRILDFNDEEEALFDEKRGDAETLAGFLL 400

Query: 277 SVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            +    P +G  +L    ++ ++   D + +++V+I R
Sbjct: 401 EIAGNFPQKGIPIL-FNNYKFIVEAFDKKRIKQVKIIR 437


>gi|327398444|ref|YP_004339313.1| hypothetical protein Hipma_0277 [Hippea maritima DSM 10411]
 gi|327181073|gb|AEA33254.1| protein of unknown function DUF21 [Hippea maritima DSM 10411]
          Length = 421

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 141/251 (56%), Gaps = 13/251 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI     +E+ +NI+  ++I + +IM+ R  +  V+ ++++   + + E+Y  S +P Y
Sbjct: 180 EGILENQTREMMHNIIDIKEISVKEIMVPRTEMVCVDVESSIDTLLNLIEEYEYSRIPAY 239

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             +LDN  G+V+++D+I       AK  +I+    +S   +++  +FVP +  + DL   
Sbjct: 240 DGTLDNIVGIVYIKDLIKK-----AKEKDIH---SISIKEVLRGAMFVPETKHIYDLFKE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDN-TFIVDAR 245
            Q   I +A+VIDE+GG  GLV+ EDI+  ++ DI  E+  ++       D+  +IVDA 
Sbjct: 292 FQAKHIHVAIVIDEYGGVAGLVTMEDILEEIVGDIRDEYDEREEDEFVKLDSGVYIVDAG 351

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPG-FEIVILDADV 304
            DL++  + +  + N     ++ +++ GL++ + DRIP  G+   E+ G ++I +L    
Sbjct: 352 MDLDDFCEKL--NINKESYMEEYETVAGLVYDLADRIPNEGD-EFELEGKYKIKVLKISG 408

Query: 305 RCVRRVRIRRL 315
           + + +V +RR+
Sbjct: 409 KKIEKVEVRRI 419


>gi|227486280|ref|ZP_03916596.1| HCC HlyC/CorC family transporter [Anaerococcus lactolyticus ATCC
           51172]
 gi|227235691|gb|EEI85706.1| HCC HlyC/CorC family transporter [Anaerococcus lactolyticus ATCC
           51172]
          Length = 415

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 119/225 (52%), Gaps = 14/225 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ ++ E EI NN+  F    ++DIM +R ++ A+       E     +    S +PVY
Sbjct: 182 QGVINDQESEIINNVFEFGDSDVEDIMTARTNMEAIAVDMEDKELKDFLKNCKHSRIPVY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G++HM+D++++I+       +  LNI+     +++   +V  +M + DL   
Sbjct: 242 GKSIDNIIGILHMKDIVAFIAE------DKELNIE----EMVRPAFYVYDNMHIFDLFKQ 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++   + +A+VIDE+GGT G+V+ EDIV  L+ +I  E+ +    +  ++D  ++V+   
Sbjct: 292 MRGENVSLAIVIDEYGGTSGIVTIEDIVEELVGEIEDEYDTHLETVLKINDKEYLVNPSI 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLE 291
            + +      TD   +K     DS+GG +   L RIP  G+ V E
Sbjct: 352 HINDFNDYFDTDLEQIKN----DSIGGFLIDKLGRIPKLGDSVEE 392


>gi|297380655|gb|ADI35542.1| Hypothetical protein HPV225_1525 [Helicobacter pylori v225d]
          Length = 449

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH++D++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIKDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ EH  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEHDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDIIIS-HGYAFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|261855781|ref|YP_003263064.1| hypothetical protein Hneap_1181 [Halothiobacillus neapolitanus c2]
 gi|261836250|gb|ACX96017.1| CBS domain containing protein [Halothiobacillus neapolitanus c2]
          Length = 299

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 144/287 (50%), Gaps = 14/287 (4%)

Query: 20  IDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFN 79
           +D   S S++  P ++ R    L + W + ++     I      A+ + I   +   + +
Sbjct: 1   MDEDSSPSRSDEPGWFAR----LRQQWCISQVKSCSDILTVAKAAAEKQIIPHSTASLID 56

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           ++L F   R+ D+MI R  ++ +   +T+ + +    + G S  PV   + D   G++ +
Sbjct: 57  SVLEFHDSRVRDVMIPRGQMDVINITSTLPQILSEIAETGHSRYPVILENRDEITGILLV 116

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           ++++    H YA T +       +  N I++ L+VP S  +  LL   + +R  MA+V+D
Sbjct: 117 KELL----HFYAGTPSEEDIAGFTLKNHIRSALYVPESKRLDVLLAEFRLTRTHMAIVLD 172

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTD 258
           E GG  GLV+ ED++  ++ DI  E+ + + + I   S N F V A T ++E     GTD
Sbjct: 173 EFGGVAGLVTIEDVLEEIVGDIDDEYDTAEPVHIREQSANRFTVRALTPIDEFNAHFGTD 232

Query: 259 CNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            +    + + D++GG I   L  +P RGEVV  + G+E  IL AD R
Sbjct: 233 FS----DDEYDTIGGFITHELGHLPRRGEVVC-VGGYEFKILGADKR 274


>gi|83648013|ref|YP_436448.1| putative Mg2+ and Co2+ transporter CorC [Hahella chejuensis KCTC
           2396]
 gi|83636056|gb|ABC32023.1| putative Mg2+ and Co2+ transporter CorC [Hahella chejuensis KCTC
           2396]
          Length = 280

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 127/239 (53%), Gaps = 14/239 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +    ++   +++ +IMI R  ++ V+   +  E M    +   S  PV   S D   G+
Sbjct: 53  LIEGAMQVTDMQVREIMIPRAQMSVVKASQSPQEYMDELLESAHSRYPVIGESKDEVVGI 112

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           +  +D++       A  N +N   +    ++++ + F+P S  ++ LL   +E+R  MA+
Sbjct: 113 LLAKDLLGL-----ALKNELN---KSKVQDILRPVWFIPESKRLNQLLKEFKENRNHMAI 164

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKII 255
           V+DE+GG  GLV+ ED++  ++ +I  EH   ++S+I     N ++V A T +EE  +  
Sbjct: 165 VVDEYGGVAGLVTIEDVLEQIVGEIEDEHDFDEESLIKCTGHNQYVVKALTPVEEFNEYF 224

Query: 256 GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            T  +    E++ D++GGL+     R+P RGE V    GF+I IL+AD R +R +++ R
Sbjct: 225 TTKLD----EEEFDTIGGLVIKQFGRLPKRGETV-SFHGFDIKILNADSRQIRLIQVSR 278


>gi|323341639|ref|ZP_08081872.1| CBS domain protein [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322464064|gb|EFY09257.1| CBS domain protein [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 442

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 132/249 (53%), Gaps = 19/249 (7%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
           TEKE+ NNI  F  + + DIM  R  +  ++  ++  + M + ++   +  PVY++S+DN
Sbjct: 195 TEKEMINNIFEFDNLDVADIMTHRTEVVGIDVSSSFADIMELVDEERYTRYPVYEDSIDN 254

Query: 133 PRGMVHMRDVISYIS-HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
             G++H+RD++ Y+  H   +   I          +I+   +VP S    +L   +Q S+
Sbjct: 255 IIGLIHLRDLLRYVKDHRDDEVFEIK--------KIIREPYYVPDSKRTDELFRELQNSK 306

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +  A+VIDE+GGT G+V+ ED++  +M +I       ++  I AV+ + ++VD   D+E+
Sbjct: 307 MHFAVVIDEYGGTAGIVTMEDLIEEIMGNIMDEYDEEEEQEIVAVNLDEYLVDGACDIED 366

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP-----GFEIVILDADVR 305
           L  +I  +       +D D++ G +   + R+P   +V  ++      G+   I++ D +
Sbjct: 367 LEDVININLPV----EDYDTVSGFVVGQIGRLPTEEDVREDLSDVIYHGYRFSIMELDEK 422

Query: 306 CVRRVRIRR 314
            + RVR+ +
Sbjct: 423 VIARVRVTK 431


>gi|163784710|ref|ZP_02179525.1| hypothetical protein HG1285_08086 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880020|gb|EDP73709.1| hypothetical protein HG1285_08086 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 400

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 133/254 (52%), Gaps = 13/254 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+FSE EKEI    L   +  + +IM  R  I A+E+  T+ + + + +    S +PVY
Sbjct: 156 KGLFSEEEKEIIEAALELDETSVSEIMTPRRDIFAIENGITIKQTIEILKNKDYSRIPVY 215

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K +LDN  G+++++D+I        K N +           ++  LFVP    +  L+  
Sbjct: 216 KENLDNIIGVLYVKDII--FLKFEGKENEVI-------DKYLRKPLFVPEFTPLLTLMKE 266

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            ++++   A+V+DEHG   G+ +++D+V  L+ DI  E  S++  I  +S   + V  + 
Sbjct: 267 FEKTKNHFAIVVDEHGTVVGIATFQDLVEFLVGDIPQEFESEEPFIKQISTYEWKVSGKI 326

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           D+EEL++ IG     L  + + D+L G IF  L++IP  GE   E  GF   I   +   
Sbjct: 327 DIEELSEEIGLK---LPEDYEFDTLAGFIFHQLEKIPQEGE-TFEYEGFLFKIEKVEKNR 382

Query: 307 VRRVRIRRLVHFKN 320
           +  VRI++L +++ 
Sbjct: 383 IVMVRIKKLQNYRK 396


>gi|325270106|ref|ZP_08136713.1| CBS domain protein [Prevotella multiformis DSM 16608]
 gi|324987407|gb|EGC19383.1| CBS domain protein [Prevotella multiformis DSM 16608]
          Length = 409

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 121/242 (50%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  INAVE+   + E   MF + G S + VY+  +D
Sbjct: 182 EDEVKIFQNALDFQDTKVRDCMVPRTEINAVEENCPLEELQQMFIESGNSKIIVYEEDID 241

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H  ++     H                 + I+ + FVP +M    L+    + +
Sbjct: 242 HIKGYIHSSEMFRSPEHW---------------KDHIRKMPFVPETMPAQKLMQVFLQQK 286

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +   ++DN +++ AR +++++
Sbjct: 287 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNTKYVAKQIADNEYVLSARLEIDKV 346

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   D   L    D  ++GGL+  V    P   E++  +  +E  I+   +  +  VR
Sbjct: 347 NEMFNLD---LPESDDYMTVGGLLLHVYQSFPKVNEII-TVGKYEFKIVKNTMTKIELVR 402

Query: 312 IR 313
           ++
Sbjct: 403 VK 404


>gi|260173656|ref|ZP_05760068.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D2]
 gi|315921918|ref|ZP_07918158.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D2]
 gi|313695793|gb|EFS32628.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D2]
          Length = 451

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|311745195|ref|ZP_07718980.1| CBS domain protein [Algoriphagus sp. PR1]
 gi|126577718|gb|EAZ81938.1| CBS domain protein [Algoriphagus sp. PR1]
          Length = 449

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 126/246 (51%), Gaps = 17/246 (6%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E++I   I+ F  + +  +M SR+ I AV++    +E M    K G S +PV++ ++D
Sbjct: 203 EEERDILKGIVNFGTLTVKQVMRSRMDITAVDEDMDFHELMDKINKSGFSRIPVFQETID 262

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           N  G+++++D++ +I     +  + N N      +LI+   FVP +  V  LL + Q  R
Sbjct: 263 NISGILYIKDLLPFIE----RDEDFNWN------DLIRKSYFVPENKKVDTLLKDFQLKR 312

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEE 250
           + MA+V+DE+GGT GLV+ ED++  ++ +I  E   +       +  NTFI + +  L +
Sbjct: 313 VHMAIVVDEYGGTSGLVTLEDLIEEIIGEINDEFDDTDDVFFQEIDTNTFIFEGKVSLND 372

Query: 251 LAKIIGTDCNCL---KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
             K +  D       KGE +      L   +  ++P  G  +     FE  IL  D R +
Sbjct: 373 FCKKLELDAQMFDEVKGENESLGGLLL--ELNSKLPKNGTKI-HFEEFEFTILAVDARKI 429

Query: 308 RRVRIR 313
           ++V++R
Sbjct: 430 KKVKVR 435


>gi|237723031|ref|ZP_04553512.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229447553|gb|EEO53344.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 442

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 199 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 258

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 259 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 308

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 309 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 368

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 369 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 427

Query: 313 RRL 315
             L
Sbjct: 428 TIL 430


>gi|222100704|ref|YP_002535272.1| Hemolysin-related protein [Thermotoga neapolitana DSM 4359]
 gi|221573094|gb|ACM23906.1| Hemolysin-related protein [Thermotoga neapolitana DSM 4359]
          Length = 466

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 123/221 (55%), Gaps = 10/221 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  + E+ I       ++I + +IM  RV I A+E+  TV + + + E  G S +PVY+
Sbjct: 205 GVIEQEEERIVKRAFEMKQIAVKEIMTPRVDIVAIEENQTVRDLIELIEDEGYSRIPVYR 264

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+ + +DV+S ++    +    N+ ++    +++++ L+VP +M + +LL  +
Sbjct: 265 ETIDNIVGVCYAKDVLSILAEKDCEEVK-NMKVK----DIMRDALYVPETMNIDELLKIL 319

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  +I +A+V+DE+GGT G+V+ EDI+  L  DI  E+ + + S I  + + T+IVD  T
Sbjct: 320 KSKKIHIAIVVDEYGGTAGIVTLEDIIEELFGDIMDEYDYDEVSGIKKIGEKTYIVDGST 379

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            + +L      +      + + +++ G +     RIP  GE
Sbjct: 380 PINDLE----IELRIQFPQTEYETIAGYLLEHFKRIPNVGE 416


>gi|197122635|ref|YP_002134586.1| hypothetical protein AnaeK_2230 [Anaeromyxobacter sp. K]
 gi|196172484|gb|ACG73457.1| protein of unknown function DUF21 [Anaeromyxobacter sp. K]
          Length = 464

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 126/271 (46%), Gaps = 32/271 (11%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E ++E+ N++L F      ++MI R  + AV+      E + +  +   S MPVY
Sbjct: 187 EGVLDEVKEELLNSVLEFADRVAKEVMIPRTRMVAVDRAVEPDELVRIVTENPYSRMPVY 246

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S+DN  G++ +RD+I  + H       I L+        +K   FVP  M +S LL  
Sbjct: 247 EGSIDNVVGILLVRDIIQELRH--GPLRRIALD------RYLKPAFFVPEQMKISRLLKE 298

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  R  +A+V+DE GGT GLV+ ED++  ++ +I  E   + + + AV+   ++ DA  
Sbjct: 299 MQRRRTHLAVVVDEFGGTSGLVTMEDVIEEIVGEIQDEADVESAPVKAVAPGVWLADAAI 358

Query: 247 DLEELAKII------------GTDCNCLK-GEQ----------DVDSLGGLIFSVLDRIP 283
            L +L   +            G D    + GE           D ++LGG + +   R+P
Sbjct: 359 PLHDLQSFLNEQREEPAPRPAGDDAPEFEDGEPPPEIRFPEQGDYETLGGFVTATAGRVP 418

Query: 284 ARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             G   L   G    +   D R V RV I R
Sbjct: 419 PVG-ATLAWDGLTFTVRAGDERRVTRVEIAR 448


>gi|296327793|ref|ZP_06870332.1| HCC HlyC/CorC family transporter [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155140|gb|EFG95918.1| HCC HlyC/CorC family transporter [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 416

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 173 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEATKTINEVWDEIIDNGFSRIPIY 232

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +NL I+      I++  FVP +  + ++L  
Sbjct: 233 EETIDNIVGILYVKDLMEHI-----KNNELNLPIK----QFIRSAYFVPETKSIIEILKE 283

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 284 FRGLKVHIAIVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFFKKIADNEYEVDAM 343

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 344 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 399

Query: 306 CVRRVRIRRL 315
            V +V IR L
Sbjct: 400 RVSKVFIRIL 409


>gi|260437328|ref|ZP_05791144.1| hemolysin-related protein [Butyrivibrio crossotus DSM 2876]
 gi|292810240|gb|EFF69445.1| hemolysin-related protein [Butyrivibrio crossotus DSM 2876]
          Length = 443

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 131/251 (52%), Gaps = 12/251 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+    E E+  NI         DIM  R +I AVE   T+   +    +   S  PVY
Sbjct: 190 QGVLEAGEAEMITNIFELGDKHAGDIMTHRSNIEAVESTITLDNFIQNHIEGKYSRFPVY 249

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +DN  G +H+RD + +  ++  +   +          L++    VP +M + D+L +
Sbjct: 250 EGDIDNIVGTIHIRDALIFYRNIPNRKKLLK-----DIKGLLRKPYMVPETMDIDDMLKD 304

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +QE +I M +V+DE+G T G+VS EDI+  ++ +I  E+  ++ ++    D+T++VD  T
Sbjct: 305 MQEKKIHMGIVVDEYGQTAGIVSMEDIIEEIVGNILDEYDDEEEVVEYAGDDTYVVDGLT 364

Query: 247 DLEELAKIIGTDCNCLKGEQD-VDSLGGLIFSVLDRIPARGEV-VLEIPGFEIVILDADV 304
           D+E++  ++G     +K E D  ++L G + S L RI +  E  V+E  GF   IL+   
Sbjct: 365 DIEDINSLLG-----IKIESDGFETLNGFLISKLGRIASENETEVIEAYGFSFKILEVTG 419

Query: 305 RCVRRVRIRRL 315
             +R+V I ++
Sbjct: 420 NVIRKVEITKI 430


>gi|125975351|ref|YP_001039261.1| hypothetical protein Cthe_2870 [Clostridium thermocellum ATCC
           27405]
 gi|256005503|ref|ZP_05430465.1| protein of unknown function DUF21 [Clostridium thermocellum DSM
           2360]
 gi|281419311|ref|ZP_06250326.1| protein of unknown function DUF21 [Clostridium thermocellum JW20]
 gi|125715576|gb|ABN54068.1| protein of unknown function DUF21 [Clostridium thermocellum ATCC
           27405]
 gi|255990558|gb|EEU00678.1| protein of unknown function DUF21 [Clostridium thermocellum DSM
           2360]
 gi|281406931|gb|EFB37194.1| protein of unknown function DUF21 [Clostridium thermocellum JW20]
 gi|316939466|gb|ADU73500.1| protein of unknown function DUF21 [Clostridium thermocellum DSM
           1313]
          Length = 433

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 122/223 (54%), Gaps = 15/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           +G   E EKE+ NNI  F    + DIM  R  I A+   A++ E + +F  EKY R  +P
Sbjct: 195 KGTIQENEKEMINNIFDFDNKTVMDIMTHRTDIVALPVDASLDEVISLFNEEKYTR--IP 252

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ S+DN  G++H++D+I YI  + + T + +L        +I+    VP S    +L 
Sbjct: 253 VYEESIDNIVGILHVKDLIKYIG-VGSDTADFDLR------KIIRKPYNVPWSKKADELF 305

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
           + +Q++++ MA++IDE+GGT G+V+ ED+V  ++ +I  E+  ++     + ++T+I   
Sbjct: 306 SELQKNKVHMAIIIDEYGGTAGIVTVEDLVEEIVGNIFDEYDEEEKDFEKLDESTYIFSG 365

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              L+    ++    +    E + D+L G I S L RIP   E
Sbjct: 366 TAGLD----VLNEWADAQLPEDEYDTLSGFIISQLGRIPEYDE 404


>gi|258405987|ref|YP_003198729.1| CBS domain containing protein [Desulfohalobium retbaense DSM 5692]
 gi|257798214|gb|ACV69151.1| CBS domain containing protein [Desulfohalobium retbaense DSM 5692]
          Length = 285

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 132/253 (52%), Gaps = 15/253 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  +G     E  +  N+LR  + ++ +IMI R  I  VE  A++ +   +  ++G S
Sbjct: 30  LEARTDGELEAFEASMLINVLRMGRKQVREIMIPRTDIQCVEQNASIQDVAELIIEHGHS 89

Query: 122 WMPVYKNSLDNPRGMVHMRDVISY-ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
            +PVY+ + D+  G+VH +D++ Y ++H     + +        S +++   F+P +  V
Sbjct: 90  RIPVYRENKDHIIGVVHAKDLLPYLLNHCETPPDPL--------SAIMRPPFFIPETKNV 141

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNT 239
            +++   Q  ++ MA+ +DE+GGT GLV++ED++  ++ +I  E+   +   I  + D  
Sbjct: 142 KNMIAEFQAQKVHMAIALDEYGGTSGLVTFEDVLEEIVGEIEDEYDLPRPEDIQVMEDGR 201

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
            +V  RT L +L +  G     L  +Q V+++GG +  +  R+P  GE   +  G    I
Sbjct: 202 HLVAGRTSLNDLEEETGV---SLTSDQ-VETIGGFVTELAGRVPMTGE-EFDYLGHNFRI 256

Query: 300 LDADVRCVRRVRI 312
            +AD + V  V I
Sbjct: 257 EEADSKQVYAVSI 269


>gi|237715016|ref|ZP_04545497.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D1]
 gi|294807156|ref|ZP_06765973.1| gliding motility-associated protein GldE [Bacteroides xylanisolvens
           SD CC 1b]
 gi|229444849|gb|EEO50640.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D1]
 gi|294445656|gb|EFG14306.1| gliding motility-associated protein GldE [Bacteroides xylanisolvens
           SD CC 1b]
          Length = 441

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 199 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 258

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 259 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 308

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 309 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 368

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 369 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHHYEFEVLEMDSRRILKVKF 427

Query: 313 RRL 315
             L
Sbjct: 428 TIL 430


>gi|110640050|ref|YP_680260.1| hemolysin-like protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110282731|gb|ABG60917.1| hemolysin-related protein, with CBS domain; gliding motility
           protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 293

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 149/291 (51%), Gaps = 20/291 (6%)

Query: 27  SKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFS-ETEKEIFNNILRFR 85
           +K S  AF ++ +R L    ++ +       +L R   S +G  S   EKE+   +++F 
Sbjct: 8   NKKSTDAF-SKYMRKLFGIQEITESQREYIEKLERELESAKGTLSTREEKEMIRGLVKFG 66

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMF-EKYGRSWMPVYKNSLDNPRGMVHMRDVIS 144
            I +  IM  R+ + AV D A  YE +  +    G S +PVYK S D   G+++++D+  
Sbjct: 67  NIMVKQIMCPRMDMAAV-DIALNYEQLQEYISTCGFSRIPVYKESADKIEGVLNIKDLFP 125

Query: 145 YISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGT 204
           +    Y K  + N         LI+ + F+P + L+ +LL   Q   + MA+V+DE+GGT
Sbjct: 126 F----YNKEKDFNWQ------QLIRTVEFIPETKLIEELLREFQLKHLHMAIVVDEYGGT 175

Query: 205 DGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCL-- 262
            GL++ ED++  ++ DI  E+   +   + +SD +++ + +  L +  K I  D +    
Sbjct: 176 AGLITMEDVIEEIVGDIHDEYDDDEKPYAQLSDTSYLFEGKISLVDFYKAIELDKDIFDE 235

Query: 263 -KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            KGE   ++LGGL+ ++   +P  G+ ++   G+   I   + + + RV++
Sbjct: 236 VKGES--ETLGGLLLNINSDLPRLGDEII-YEGYVFKIDAVNSKRILRVKV 283


>gi|219851195|ref|YP_002465627.1| protein of unknown function DUF21 [Methanosphaerula palustris
           E1-9c]
 gi|219545454|gb|ACL15904.1| protein of unknown function DUF21 [Methanosphaerula palustris
           E1-9c]
          Length = 421

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 121/223 (54%), Gaps = 12/223 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG   + E+E+  N+L        ++M  RV +  +ED +T+  ++ +F + G S +PVY
Sbjct: 178 EGTIEQEEQEMLYNVLELGDTTAREVMTPRVDVAMIEDTSTLESSLTIFHETGFSRLPVY 237

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
              +DN  G+++++DV + I        ++ +      S+L+ +  FVP +  + DLL  
Sbjct: 238 HEKIDNLTGVLNIKDVYTVI---VGHKKDVKI------SDLMYDPYFVPETKKIDDLLKE 288

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  ++ MA+V+DE+GG  G+V+ EDI+  L+ DI  E   ++  +S + +  +++DAR 
Sbjct: 289 LQLRKVPMAMVMDEYGGFVGVVTVEDILEELVGDILDEFDDEEPELSRIGEGIYMLDARM 348

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            +++L + +      L      +++GGL+   L  IP  GE V
Sbjct: 349 WVDDLNEQLDI---ALPTSDTYETIGGLLIEQLGHIPHPGETV 388


>gi|320538439|ref|ZP_08038306.1| transporter associated domain protein [Treponema phagedenis F0421]
 gi|320144701|gb|EFW36450.1| transporter associated domain protein [Treponema phagedenis F0421]
          Length = 262

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 130/247 (52%), Gaps = 15/247 (6%)

Query: 66  LEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPV 125
           L+   +E +K++   I+      + ++MI R+ ++ +      +E +    + G S  PV
Sbjct: 17  LQDDLNEEKKDMIQGIVDLSDTSVKEVMIPRIDVDFLALDIESHELIEKIAESGHSRFPV 76

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y  S+DN  G+++++D+I     ++ K   I L      S +I+   FVP S  +  LL 
Sbjct: 77  YDESIDNVVGVLYVKDLIK----LFGKPEEIAL------SKIIRKPFFVPESKRIDGLLR 126

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
             +   + +A+ +DE+GG  G+V  EDI+  ++ DI  E  +++  IS + D+ ++ DAR
Sbjct: 127 EFKRRHVHIAVAVDEYGGVSGIVCMEDIIEEIVGDIQDEFDNEREDISPLGDDVWLCDAR 186

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            ++++L++ + T+       ++ D+LGG +F +  +IP + E V     F+ +I D +  
Sbjct: 187 INMDDLSEFLETEFPS----EEFDTLGGFVFDLFGKIPVKYEKV-SWHDFDFIIQDMEGH 241

Query: 306 CVRRVRI 312
            +  V+I
Sbjct: 242 KINTVKI 248


>gi|298481896|ref|ZP_07000086.1| CBS domain protein [Bacteroides sp. D22]
 gi|298272118|gb|EFI13689.1| CBS domain protein [Bacteroides sp. D22]
          Length = 450

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHHYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|153808084|ref|ZP_01960752.1| hypothetical protein BACCAC_02370 [Bacteroides caccae ATCC 43185]
 gi|149128987|gb|EDM20203.1| hypothetical protein BACCAC_02370 [Bacteroides caccae ATCC 43185]
          Length = 316

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ +    E M    +   S +P+Y  S DN 
Sbjct: 73  ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTPFKEVMQCIIENAYSRIPIYSGSRDNI 132

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 133 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 182

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 183 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 242

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   +   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 243 IAKVDEDEFERVVGDADTLAGMLLEIKGEFPALHEKVT-YHNYEFEVLEMDSRRILKVKF 301


>gi|255690598|ref|ZP_05414273.1| CBS domain protein [Bacteroides finegoldii DSM 17565]
 gi|260623868|gb|EEX46739.1| CBS domain protein [Bacteroides finegoldii DSM 17565]
          Length = 450

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ +    E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTPFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRLAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IVKVDEDEFEKVIGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|157804109|ref|YP_001492658.1| acetyl-CoA acetyltransferase [Rickettsia canadensis str. McKiel]
 gi|172045659|sp|A8EZU0|HLYC_RICCK RecName: Full=Possible hemolysin C
 gi|157785372|gb|ABV73873.1| acetyl-CoA acetyltransferase [Rickettsia canadensis str. McKiel]
          Length = 298

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 134/245 (54%), Gaps = 20/245 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVE---DKATVYEAMLMFEKYGRSWMPVYKNSL 130
           E  IF N+L+ +   I DIM+ R  I A++   +   + E++ +   + R+   +Y  +L
Sbjct: 61  ECNIFANLLKIKDKTIADIMVPRSDIAAIKLTTNLEELSESIKLKVLHARTL--IYDGTL 118

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G +H++D+       +A   N  L        LI+  +    SM + DLLT ++  
Sbjct: 119 DNVVGFIHIKDLFK----AFATKQNGCL------KKLIRKHIIAAPSMKLLDLLTKMRRE 168

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK--KSMISAVSDNTFIVDARTDL 248
           R  +A+V+DE+GGTDGLV+ ED++  ++  I  EH  +     +  ++++T I++AR ++
Sbjct: 169 RTHIAIVVDEYGGTDGLVTIEDLIEEIVGRIDDEHDQQLDSDNLKVINNSTIILNARVEV 228

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           E L +IIG     LK + + D++GGL+ + +  +PA G  +      EI + DA  R ++
Sbjct: 229 EVLEEIIGEK---LKNDDEFDTIGGLVLTRVGSVPAIGTRINISENIEIEVTDATPRSLK 285

Query: 309 RVRIR 313
           +V+IR
Sbjct: 286 QVKIR 290


>gi|293372579|ref|ZP_06618961.1| gliding motility-associated protein GldE [Bacteroides ovatus SD CMC
           3f]
 gi|292632388|gb|EFF50984.1| gliding motility-associated protein GldE [Bacteroides ovatus SD CMC
           3f]
          Length = 451

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|253572370|ref|ZP_04849773.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           1_1_6]
 gi|298386447|ref|ZP_06996003.1| CBS domain protein [Bacteroides sp. 1_1_14]
 gi|251838145|gb|EES66233.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           1_1_6]
 gi|298260824|gb|EFI03692.1| CBS domain protein [Bacteroides sp. 1_1_14]
          Length = 450

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 130/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ +    E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDVRTPFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHNYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|262409035|ref|ZP_06085580.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           2_1_22]
 gi|294647096|ref|ZP_06724702.1| gliding motility-associated protein GldE [Bacteroides ovatus SD CC
           2a]
 gi|262353246|gb|EEZ02341.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           2_1_22]
 gi|292637560|gb|EFF55972.1| gliding motility-associated protein GldE [Bacteroides ovatus SD CC
           2a]
          Length = 450

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF    + ++M SR+ +  ++ + +  E M    +   S +P+Y  S DN 
Sbjct: 208 ENNILEGIIRFGGETVKEVMTSRLDMVDLDIRTSFKEVMQCIIENAYSRIPIYSGSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHVN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++     ++D+T+I +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGLVTMEDIIEEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K   D D+L G++  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 IAKVDEDEFEKVVGDADTLAGMLLEIKGEFPALHEKV-TYHHYEFEVLEMDSRRILKVKF 436

Query: 313 RRL 315
             L
Sbjct: 437 TIL 439


>gi|261840166|gb|ACX99931.1| hypothetical protein HPKB_1394 [Helicobacter pylori 52]
          Length = 441

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 137/254 (53%), Gaps = 13/254 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 199 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 258

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K +++          +++ ++ VP S  +S +L  
Sbjct: 259 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDLK--------QIVRKMIIVPESASISQILIK 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 310 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 369

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 370 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIIS-HGYLFEVLSVDGAR 425

Query: 307 VRRVRIRRLVHFKN 320
           ++R++  +  H +N
Sbjct: 426 IKRLKASKKDHGEN 439


>gi|86158055|ref|YP_464840.1| hypothetical protein Adeh_1630 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774566|gb|ABC81403.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 464

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 126/271 (46%), Gaps = 32/271 (11%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E ++E+ N++L F      ++MI R  + AV+      E + +  +   S MPVY
Sbjct: 187 EGVLDEVKEELLNSVLEFADRVAKEVMIPRTRMVAVDRAVEPDELVRIVTENPYSRMPVY 246

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S+DN  G++ +RD+I  + H       I L+        +K   FVP  M +S LL  
Sbjct: 247 EGSIDNVVGILLVRDIIQELRH--GPLRRIALD------RYLKPAFFVPEQMKISRLLKE 298

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  R  +A+V+DE GGT GLV+ ED++  ++ +I  E   + + + AV+   ++ DA  
Sbjct: 299 MQRRRTHLAVVVDEFGGTSGLVTMEDVIEEIVGEIQDEADVEAAPVKAVAPGVWLADAAI 358

Query: 247 DLEELAKII------------GTDC-NCLKGEQ----------DVDSLGGLIFSVLDRIP 283
            L +L   +            G D     +GE           D ++LGG + +   R+P
Sbjct: 359 PLHDLQSFLNEQRDEPAPRPAGEDAPEPDEGEPTPEVRFPEQGDYETLGGFVTATAGRVP 418

Query: 284 ARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             G   L   G    +   D R V RV I R
Sbjct: 419 PVG-ATLAWDGLTFTVRAGDERRVTRVEIAR 448


>gi|148272751|ref|YP_001222312.1| hypothetical protein CMM_1570 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830681|emb|CAN01621.1| conserved membrane protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 440

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 119/244 (48%), Gaps = 14/244 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  E ++E+ ++I  F    + ++MI R  +  VE  A V  A+ +F   G S  PV   
Sbjct: 178 VLEEDDRELIHSIFEFNDTVVREVMIPRTDMVVVEQTAHVGSALGLFLSRGISRAPVTGR 237

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D   G++++RD+   +     +     ++       L +  +FVP S     LL  +Q
Sbjct: 238 DSDEIEGVLYLRDLARMVYERPEEAERTTVD------QLARPAVFVPESQKADALLRQMQ 291

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
                +A+V+DE+GG  GLV+ ED++  L+ DI+ E+         + D  + V AR  +
Sbjct: 292 LESNHLAMVVDEYGGIAGLVTLEDLIEELVGDISDEYDRDVPEFEDLGDGVYRVSARLPI 351

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           +EL  + G + +    + DVDS GGL+   L R+P RG VV  + G    +L AD    R
Sbjct: 352 DELGDLFGLELD----DDDVDSAGGLLAKTLGRLPERGSVV-RVGGL---VLTADRVEGR 403

Query: 309 RVRI 312
           R RI
Sbjct: 404 RTRI 407


>gi|257790022|ref|YP_003180628.1| hypothetical protein Elen_0247 [Eggerthella lenta DSM 2243]
 gi|317489468|ref|ZP_07947978.1| CBS domain pair [Eggerthella sp. 1_3_56FAA]
 gi|325830239|ref|ZP_08163696.1| hypothetical protein HMPREF9404_3430 [Eggerthella sp. HGA1]
 gi|257473919|gb|ACV54239.1| protein of unknown function DUF21 [Eggerthella lenta DSM 2243]
 gi|316911397|gb|EFV32996.1| CBS domain pair [Eggerthella sp. 1_3_56FAA]
 gi|325487706|gb|EGC90144.1| hypothetical protein HMPREF9404_3430 [Eggerthella sp. HGA1]
          Length = 446

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 125/244 (51%), Gaps = 14/244 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E EK + ++IL    + + +IM  RV +   ED  TV + +      G S +PVY   +D
Sbjct: 198 EDEKRMIHDILDLGDMTVHEIMTPRVDVMFAEDTDTVRQTVERMRGTGYSRLPVYHEDID 257

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
              G+VH +D+++ +  M  K +          +      +FVP +  +  LL  +Q +R
Sbjct: 258 RIVGIVHFKDLVAPL--MDGKEHE-------PVAEYAYEAMFVPETKDLFPLLAEMQTNR 308

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
            +MA+V+DE+GGTDGL++ EDIV  ++ +I  E   +   I   S+N ++VD R  +E+ 
Sbjct: 309 QQMAIVVDEYGGTDGLITVEDIVEEVVGEIVDETDRENPFIEQESENVWVVDGRFPVEDA 368

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           A++       ++   D +++ G + S+LD +P  GE  L   G+   I     R +  VR
Sbjct: 369 AEL----GWPVEDSADYETIAGWLMSMLDSVPQVGE-ELAFDGYRFKIQAMRRRRISTVR 423

Query: 312 IRRL 315
           + RL
Sbjct: 424 VERL 427


>gi|170782108|ref|YP_001710441.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156677|emb|CAQ01835.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 440

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 119/244 (48%), Gaps = 14/244 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  E ++E+ ++I  F    + ++MI R  +  VE  A V  A+ +F   G S  PV   
Sbjct: 178 VLEEDDRELIHSIFEFNDTVVREVMIPRTDMVVVEQTAHVGSALGLFLSRGISRAPVTGR 237

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D   G++++RD+   +     +     ++       L +  +FVP S     LL  +Q
Sbjct: 238 DSDEIEGVLYLRDLARMVYERPEEAERTTVD------QLARPAVFVPESQKADALLRQMQ 291

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
                +A+V+DE+GG  GLV+ ED++  L+ DI+ E+         + D  + V AR  +
Sbjct: 292 LESNHLAMVVDEYGGIAGLVTLEDLIEELVGDISDEYDRDVPEYEDLGDGVYRVSARLPI 351

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           +EL  + G + +    + DVDS GGL+   L R+P RG VV  + G    +L AD    R
Sbjct: 352 DELGDLFGLELD----DDDVDSAGGLLAKTLGRLPERGSVV-RVGGL---VLTADRVEGR 403

Query: 309 RVRI 312
           R RI
Sbjct: 404 RTRI 407


>gi|218133143|ref|ZP_03461947.1| hypothetical protein BACPEC_01005 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992016|gb|EEC58020.1| hypothetical protein BACPEC_01005 [Bacteroides pectinophilus ATCC
           43243]
          Length = 310

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 137/254 (53%), Gaps = 13/254 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMP 124
           +G   ++E E+  NI+ F      DIM  R +I A++   T+ +    ++ E Y R   P
Sbjct: 60  QGELLDSEAEMITNIIEFGDKEAHDIMTHRKNIVAIDADTTIKDCFEFVLGENYSR--FP 117

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+  +D+  G++H+RD++     +YA +   N  I   +  ++ +  F+P +  ++ L 
Sbjct: 118 VYEGDIDHIIGVMHLRDLLK----IYADSYKRNHTIYELKDEMLFDPHFIPETRNINALF 173

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
            ++Q  ++ MA+V+DE+G T G+V+ EDI+  ++ +I  E+  ++  I   SD ++I+D 
Sbjct: 174 KSMQSEKVHMAVVVDEYGQTTGIVTMEDILEEIVGNIMDEYDVEEQYIVRDSDGSYIMDG 233

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDAD 303
            T L+++  ++    N    ++D D+L G I S ++ +P   E   +   G+   +L+ D
Sbjct: 234 YTQLDDIEDML----NISFADEDSDTLSGFIISRMEHLPEDNEQFEVWYSGYRFSVLEVD 289

Query: 304 VRCVRRVRIRRLVH 317
            + V++VR+    H
Sbjct: 290 NKRVKKVRVTYEPH 303


>gi|326799016|ref|YP_004316835.1| hypothetical protein Sph21_1603 [Sphingobacterium sp. 21]
 gi|326549780|gb|ADZ78165.1| protein of unknown function DUF21 [Sphingobacterium sp. 21]
          Length = 439

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 134/269 (49%), Gaps = 16/269 (5%)

Query: 49  MKLSHHKGIRLPRI-DASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
           M  +HH    L  + D   E G  +  E E+  N+  F +  + +IM+ R  I  +E  +
Sbjct: 174 MHEAHHSTEELQYLLDQGKESGALNMIEHELIKNVFDFNERVVKNIMVPRTKIVGIELSS 233

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESN 166
              E +      G S +PVY  ++D   G+VH +D++  + +          N +     
Sbjct: 234 PKEELLQTIISEGYSRIPVYDETIDKIVGIVHAKDILPLMVN----------NKEFVLKT 283

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH 226
           +I+   F+  +  ++DL++  Q  RI++A+V+DE GGT G+V+ EDIV  L+ +I  E+ 
Sbjct: 284 IIRKPYFIAENKKINDLMSEFQLKRIQIAIVLDEFGGTAGMVTLEDIVEELVGEIQDEYD 343

Query: 227 SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            +K ++   SD  +IV+A   + ++ + +  +   L    D D+L GL+ +V D+IP  G
Sbjct: 344 EEKPIVEKASDTEYIVEAAASVHDVNEYLPYE---LPESSDYDTLSGLVITVFDKIPDVG 400

Query: 287 EVVLEIPGFEIVILDADVRCVRRVRIRRL 315
           E   E  G+   IL    + +  V++  L
Sbjct: 401 ERK-EFHGYIFTILKKTQQNIEYVKLESL 428


>gi|39995959|ref|NP_951910.1| CBS domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982724|gb|AAR34183.1| CBS domain protein [Geobacter sulfurreducens PCA]
 gi|298504972|gb|ADI83695.1| CorB-related transporter [Geobacter sulfurreducens KN400]
          Length = 444

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 130/253 (51%), Gaps = 29/253 (11%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISR---VSINAVEDKATVYEAML--MFEKYGRSW 122
           G+FS TE+E   NI  F    + ++M+ R   V+++    +  +   +L  M+ +Y    
Sbjct: 195 GVFSATEQEYIRNIFDFTHTCVREVMVPRTRMVALDLARPRMELVREVLDNMYSRY---- 250

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY+ S++N  G +H +D++               + + +  ++++   +VP    V++
Sbjct: 251 -PVYRESIENVVGFIHGKDLL----------GRTVTDPEFAMESIVRPPFYVPEGKKVNE 299

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFI 241
           LL  +Q  RI MALV+DE+GG  GLV+ ED++  L+ +I  EH   +   +  + D + +
Sbjct: 300 LLKEMQRLRIHMALVVDEYGGISGLVTTEDLLEELVGEIEDEHDIGEPGTVQRLPDGSLL 359

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDV--DSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           VDA   + +LA     D   +K E+DV  D+L GLI   L R P RGE V E   F ++ 
Sbjct: 360 VDALMSIGDLA-----DLLKIKLEEDVPYDTLAGLILDQLGRFPERGETV-EWDRFSLIC 413

Query: 300 LDADVRCVRRVRI 312
            +     + +VRI
Sbjct: 414 EEVKQTAIVKVRI 426


>gi|281425172|ref|ZP_06256085.1| CBS domain protein [Prevotella oris F0302]
 gi|281400638|gb|EFB31469.1| CBS domain protein [Prevotella oris F0302]
          Length = 415

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 131/248 (52%), Gaps = 14/248 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      ++M SR  I  +  +++  E +        S +P+Y+++ DN 
Sbjct: 181 EQSMLQGIIRFGDETAKEVMTSRQDIVNLNIRSSFTEVLKCVIDNNYSRIPIYQDNTDNI 240

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S   A              +LI+   FVP +  + DLL   QE+++ 
Sbjct: 241 RGILYIKDLLPHLSKSAA----------FRWQSLIRPPYFVPETKKIDDLLREFQENKVH 290

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT GL++ EDI+  ++ +I  E+  ++   S ++ NT++   +  L +  K
Sbjct: 291 IAIVVDEYGGTSGLITLEDILEEIVGEINDEYDEEEKFYSKLNYNTYVFKGKVLLTDFCK 350

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +     E D DSL GL+  +    P+  E + E   F   IL  + R + +V++
Sbjct: 351 ILNIDDDEFADVEGDADSLAGLLLELKGDFPSAHEKI-EFKNFTFEILSIEERRIAKVKV 409

Query: 313 RRLVHFKN 320
             +VH K+
Sbjct: 410 --IVHPKS 415


>gi|257452385|ref|ZP_05617684.1| integral membrane protein [Fusobacterium sp. 3_1_5R]
 gi|257465822|ref|ZP_05630133.1| integral membrane protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|315916979|ref|ZP_07913219.1| magnesium and cobalt efflux protein corC [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|317058928|ref|ZP_07923413.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 3_1_5R]
 gi|313684604|gb|EFS21439.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 3_1_5R]
 gi|313690854|gb|EFS27689.1| magnesium and cobalt efflux protein corC [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 427

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 138/247 (55%), Gaps = 14/247 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+ F +    ++M  R S+ A E   T+ +      + G S +PVY
Sbjct: 183 EGIIEEDEKEMIHSIVGFGETTAKEVMTPRTSMTAFEGSKTIEDIWDTLMEDGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++S +     K  NIN  I+     L++   FVP +  + ++L  
Sbjct: 243 EETIDNILGILYIKDIMSQV-----KNGNINQPIR----ELVRPAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GL++ ED++  ++ +I       ++  +  V D+++ VDA 
Sbjct: 294 FKVKKVHIAMVLDEYGGIGGLLTIEDLIEEIVGEIRDEFDEEEEEFVRKVGDHSYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            D+E L K +G     L   +D +SLGGLI + L R+  +G+  LE+   ++ +L+ D  
Sbjct: 354 IDIETLDKELGIQ---LPVSEDYESLGGLITTELGRVTEKGD-ELELENVKLQVLEMDKM 409

Query: 306 CVRRVRI 312
            + +V I
Sbjct: 410 RISKVLI 416


>gi|317010136|gb|ADU80716.1| hemolysin domain-containing protein [Helicobacter pylori India7]
          Length = 445

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 133/248 (53%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R+R  +
Sbjct: 434 IKRLRASK 441


>gi|120555652|ref|YP_960003.1| transporter-associated region [Marinobacter aquaeolei VT8]
 gi|120325501|gb|ABM19816.1| transporter-associated region [Marinobacter aquaeolei VT8]
          Length = 281

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 131/253 (51%), Gaps = 14/253 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA  + I       I    ++   +R+D+IMI R  +  V+      E +        S 
Sbjct: 39  DAESQSIIDADSMSIIEGAMQVIDMRVDEIMIPRSQMITVKASQEPKEFLPEIMSSAHSR 98

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV   S D+  G++  +D++       A  N++N N ++ E  +++   FVP S  ++ 
Sbjct: 99  FPVIGESQDDVIGVLLAKDLLPL-----ALNNDLNWN-RIRE--ILRPPTFVPESKRLNQ 150

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFI 241
           LL   +E+R  MA+V+DE+GGT GL++ ED++  ++ +I  EH   +++ I A  D TF 
Sbjct: 151 LLKEFKENRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFDEETHIKARGDGTFA 210

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           V A T +++  +   TD +    E++ D++GGL+      +P RGE V E  G +  I +
Sbjct: 211 VKAVTPIDDFNEFFETDMD----EEEFDTIGGLVLKEFGHLPRRGETV-EFGGLQFTIAN 265

Query: 302 ADVRCVRRVRIRR 314
           AD R +R +++ R
Sbjct: 266 ADNRVIRLLQVTR 278


>gi|229829045|ref|ZP_04455114.1| hypothetical protein GCWU000342_01130 [Shuttleworthia satelles DSM
           14600]
 gi|229792208|gb|EEP28322.1| hypothetical protein GCWU000342_01130 [Shuttleworthia satelles DSM
           14600]
          Length = 290

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 134/249 (53%), Gaps = 10/249 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+ S  E  +  NI  F    + DIM  R +I A++ ++T+ EA+    +   S  PVY
Sbjct: 41  QGVLSAREVTMIRNIFAFADKDVKDIMQHRSNIVAIDGESTMQEAVEQMIENHYSRYPVY 100

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             +LDN  G+VH++D + Y+    A+ +++++ ++  E  +++ ++FVP +  +  LL  
Sbjct: 101 IKNLDNIIGLVHIKDTLRYV----AEGHDMSVKLRDLEY-MVRRVIFVPQTHSIDTLLAQ 155

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  +  M LV DE+G T GL+S ED++  ++ +I  E+  +  +++ + D  +++   T
Sbjct: 156 MQHRKNHMILVQDEYGQTCGLLSMEDVIEEIVGNIQDEYDDEDELVARLGDGAYMMQGST 215

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDADVR 305
            L+ +A  +G D +    +++ ++L G +   L RIP   E   +   G+   ++D +  
Sbjct: 216 PLDTVADTLGIDLS----DEEAETLNGFLLEKLGRIPQDHESFDVTARGYHFHVIDVEHM 271

Query: 306 CVRRVRIRR 314
               VRI R
Sbjct: 272 VALGVRISR 280


>gi|302385987|ref|YP_003821809.1| protein of unknown function DUF21 [Clostridium saccharolyticum WM1]
 gi|302196615|gb|ADL04186.1| protein of unknown function DUF21 [Clostridium saccharolyticum WM1]
          Length = 467

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 128/252 (50%), Gaps = 16/252 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYG-RSWMPV 125
           +G+    E E+  NI         DIM  R ++ A++ + T+ EA+    K G  S  PV
Sbjct: 198 QGVLEAREAEMITNIFELNDKEAGDIMTHRKNLVALDGEITLREAVNFILKEGFNSRYPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSDLL 184
           YK  +D+  G++HM+D       + A  N  N + QL E   L++   F+P +  +  L 
Sbjct: 258 YKKDVDDIVGILHMKDA------LIAVENKRNASRQLWEIEGLLREAHFIPETRNIDTLF 311

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +I M +V+DE+G T G+V+ EDI+  ++ +I  E+   +  I    D +F V  
Sbjct: 312 KEMQSRKIHMVIVVDEYGQTAGIVTMEDILEEIVGNIMDEYDVDEEYIIPSEDGSFCVSG 371

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDS---LGGLIFSVLDRIPARG-EVVLEIPGFEIVIL 300
            T LEEL + +  + +    E+D DS   + GL+ S LDRIP  G E  + + G+   IL
Sbjct: 372 MTPLEELERALNIEFD----EEDYDSYDTINGLLISRLDRIPQEGEESEVSVLGYRFKIL 427

Query: 301 DADVRCVRRVRI 312
             + + +  +R+
Sbjct: 428 RVENKIIHTIRV 439


>gi|299140829|ref|ZP_07033967.1| CBS domain protein [Prevotella oris C735]
 gi|298577795|gb|EFI49663.1| CBS domain protein [Prevotella oris C735]
          Length = 415

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 120/242 (49%), Gaps = 18/242 (7%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E +IF N L F + ++ D MI R  INAVE   TV + M  F + G S + VY+  +D+ 
Sbjct: 192 EVKIFQNALEFSETKVRDCMIPRTEINAVEYDCTVADLMQKFIESGNSKIIVYRGDIDHI 251

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G +H  ++       + ++              ++ + FVP +M    L+    +S+  
Sbjct: 252 EGYIHSSEMFRTAGKDWHES--------------VRTMPFVPETMAAQKLMKTFLQSKKS 297

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           + +V+DE GGT G+VS EDIV  +  DI  EH S K +   +SDN +++ AR +++++  
Sbjct: 298 LGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDSNKYVAKKMSDNEYLLSARLEIDKVND 357

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +       L  + D  ++GG I +     P   EVV +I  F   I+ + +  +  V++ 
Sbjct: 358 MFNL---GLPEDDDYKTVGGFILNFYQSFPKLNEVV-KIGRFSFKIIKSTMTKIELVKLT 413

Query: 314 RL 315
            L
Sbjct: 414 VL 415


>gi|15646099|ref|NP_208281.1| hypothetical protein HP1490 [Helicobacter pylori 26695]
 gi|2314662|gb|AAD08525.1| conserved hypothetical protein [Helicobacter pylori 26695]
          Length = 449

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 131/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N   F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAXDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKGHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++ N         +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFN--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  I+ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGINKLEEGVFELEGML 377

Query: 247 DLE--ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE  E A  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEALHIEFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYSFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|281425606|ref|ZP_06256519.1| CBS domain protein [Prevotella oris F0302]
 gi|281400193|gb|EFB31024.1| CBS domain protein [Prevotella oris F0302]
          Length = 424

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 120/242 (49%), Gaps = 18/242 (7%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E +IF N L F + ++ D MI R  INAVE   TV + M  F + G S + VY+  +D+ 
Sbjct: 201 EVKIFQNALEFSETKVRDCMIPRTEINAVEYDCTVADLMQKFIESGNSKIIVYRGDIDHI 260

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G +H  ++       + ++              ++ + FVP +M    L+    +S+  
Sbjct: 261 EGYIHSSEMFRTAGKDWHES--------------VRTMPFVPETMAAQKLMKTFLQSKKS 306

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           + +V+DE GGT G+VS EDIV  +  DI  EH S K +   +SDN +++ AR +++++  
Sbjct: 307 LGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDSNKYVAKKMSDNEYLLSARLEIDKVND 366

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +       L  + D  ++GG I +     P   EVV +I  F   I+ + +  +  V++ 
Sbjct: 367 MFNL---GLPEDDDYKTVGGFILNFYQSFPKLNEVV-KIGRFSFKIIKSTMTKIELVKLT 422

Query: 314 RL 315
            L
Sbjct: 423 VL 424


>gi|162452562|ref|YP_001614929.1| hypothetical protein sce4286 [Sorangium cellulosum 'So ce 56']
 gi|161163144|emb|CAN94449.1| conserved hypothetical membrane protein [Sorangium cellulosum 'So
           ce 56']
          Length = 430

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 122/249 (48%), Gaps = 13/249 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+F     E+  N+L F  +   D+M+ R  + A+E    + + + +  + G S  PVYK
Sbjct: 183 GLFGREPAEMIRNVLEFADLTARDVMVPRSKVEAIEISTPLEKVLEIVTESGHSRYPVYK 242

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +  DN  G+++ +D+   +     K   +   I  S +N      FV  S  +S LL  +
Sbjct: 243 DQTDNIAGLLYAKDLFKVLEERRLKNTTLR-EITRSPAN------FVAESQPLSSLLREM 295

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK--KSMISAVSDNTFIVDAR 245
           +  R  +A+V+DE GG  G+V+ ED++  ++ DI  EH      + I  + D   + DA 
Sbjct: 296 KSRRQHLAIVVDEFGGMSGIVTLEDVLEEIVGDIRDEHDETDDGAAIQDLGDGRLVADAA 355

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             + +L+  +G +   L  E   DSLGG++   + ++P  G  V +  G   ++ D+D R
Sbjct: 356 VSMSDLSAYLGAE---LDREGKYDSLGGMLTQHVGKVPEVGTAVSKF-GLRFIVRDSDER 411

Query: 306 CVRRVRIRR 314
            + +V I R
Sbjct: 412 HIGKVEIVR 420


>gi|120602375|ref|YP_966775.1| CBS domain-containing protein [Desulfovibrio vulgaris DP4]
 gi|120562604|gb|ABM28348.1| CBS domain containing protein [Desulfovibrio vulgaris DP4]
 gi|311233774|gb|ADP86628.1| CBS domain containing protein [Desulfovibrio vulgaris RCH1]
          Length = 275

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 139/287 (48%), Gaps = 28/287 (9%)

Query: 30  SVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRI 89
           S  + W+R  R       L +  +   +    ++A  +G     E  +  +ILR  ++++
Sbjct: 7   STSSIWSRLTR-------LFQNRNGDTVEKAIMEAREDGELEAEEGSMLLSILRLDELQV 59

Query: 90  DDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHM 149
            DIM  R  ++  E    + E   +    G S +P+Y+ + DN  G+ + +D++ Y+   
Sbjct: 60  QDIMTPRTDMDCAESGTPLVEVAGLIISSGHSRIPIYQETRDNIVGIAYAKDLLPYLLDP 119

Query: 150 YAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVS 209
               + I+         L++   FVP + + SDLL   +  +  +A+ +DE+GGT GL +
Sbjct: 120 AKHQSPID--------TLMRPPFFVPETKIASDLLQEFRTRKTHLAIALDEYGGTSGLAT 171

Query: 210 YEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDART---DLEELAKIIGTDCNCLKGE 265
            E+I+  ++ DI  EH + ++  I  +    +++  R    DLEEL  I+ +D       
Sbjct: 172 IENILEEIVGDIEDEHDAPREDDIRVLDSERYMLSGRALLEDLEELGIILNSD------- 224

Query: 266 QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            +VD++GG +  +   +P +GE    + G    +++AD + +R +R+
Sbjct: 225 -EVDTIGGYLSQLAGHVPQQGE-SFTLAGRMFTVMEADAKQIRTIRV 269


>gi|17232588|ref|NP_489136.1| hypothetical protein all5096 [Nostoc sp. PCC 7120]
 gi|17134234|dbj|BAB76795.1| all5096 [Nostoc sp. PCC 7120]
          Length = 436

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 125/243 (51%), Gaps = 11/243 (4%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
            E+E+ NNI  F  +   D+MI R  I A+   A     +      G S  PV   SLD+
Sbjct: 204 AERELLNNIFEFGDVTAQDVMIPRNGIIALSKDANFQNLLQQMTATGHSRYPVIGESLDD 263

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            RG+V+ RD+ + ++        ++L  Q+     ++ + FVP    +S+LL  +Q+ + 
Sbjct: 264 IRGIVYFRDLANPLA-----IGKLSLETQIQP--WMRPVRFVPEHTPLSELLPMMQQEKP 316

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            M +V+DE GGT GLV+ +D+++ ++ +      S+  +I  +   TF+V A+ +LE+L 
Sbjct: 317 AMVIVVDEFGGTVGLVTIQDVIAEIIGNAGETSSSEDLLIQMLDQETFLVQAQVNLEDLN 376

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +++  +    +  Q   +L G +   L ++P +GE+       E  I+  D   + ++++
Sbjct: 377 EVLHLNLPLTRQYQ---TLAGFLLYQLQKMPIKGEIFC-YDNIEFTIVSVDGPRLHQIQL 432

Query: 313 RRL 315
           RRL
Sbjct: 433 RRL 435


>gi|327312391|ref|YP_004327828.1| hypothetical protein HMPREF9137_0080 [Prevotella denticola F0289]
 gi|326945730|gb|AEA21615.1| conserved hypothetical protein [Prevotella denticola F0289]
          Length = 421

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 123/242 (50%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  INAVE+  ++ E   MF + G S + VY++ +D
Sbjct: 194 EDEVKIFQNALDFQDTKVRDCMVPRTEINAVEENCSLMELQQMFIESGNSKIIVYQDDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H        S M+        +I        + + FVP +M    L+    + +
Sbjct: 254 HVKGYIHS-------SEMFRAPERWREHI--------RKMPFVPETMPAQKLMQVFLQQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +   ++DN +++ AR +++++
Sbjct: 299 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNTKYVAKQIADNEYVLSARLEIDKV 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   D   L    D  ++GGL+  V    P   E++  +  +E  I+   +  +  VR
Sbjct: 359 NEMFNLD---LPESDDYMTVGGLLLHVYQSFPKVNEII-TVGQYEFRIIKNTMTKIELVR 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|251781212|ref|ZP_04824128.1| putative membrane CBS domain protein [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243081659|gb|EES47720.1| putative membrane CBS domain protein [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 417

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 133/246 (54%), Gaps = 15/246 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+  N+  F  +++ D+M+ RV ++A++ +AT  + + + ++   S +P+Y
Sbjct: 182 EGVLENVEKEMIFNVFDFADLQVKDVMVQRVDVSALDSEATYDDVLKLIKEEQFSRIPIY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++D+  G+++++D++           N   N ++++   I+   +      + +L   
Sbjct: 242 NQTIDDIIGILNVKDLLML--------ENPRENFKMAK--YIREPYYTFEFKKIVELFKE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ R  +A+V+DE+GGT G+++ ED++  ++ DI  E+    + I  + DN +IVD   
Sbjct: 292 MKKERNHIAVVLDEYGGTVGIITIEDLIEEIVGDIEDEYDDANTSIEVIKDNEYIVDGSV 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L ++  +IG D        + DS+GGLI   L R+P   E + E    + ++ + D   
Sbjct: 352 RLHDIGDLIGIDMES----DEFDSVGGLIIGELGRMPEEKEEI-ECDSMKFIVENIDKNR 406

Query: 307 VRRVRI 312
           +++VRI
Sbjct: 407 IKKVRI 412


>gi|331091070|ref|ZP_08339912.1| hypothetical protein HMPREF9477_00555 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405292|gb|EGG84828.1| hypothetical protein HMPREF9477_00555 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 279

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 138/285 (48%), Gaps = 13/285 (4%)

Query: 33  AFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDI 92
           + W R +       K  +   H+ + L + +    G F+  E E+ +NI  + + + +DI
Sbjct: 6   SLWDRLMYNFSGEDKEQEDVEHEILSLIQ-EGRERGFFAGGEGEMISNIFSYNEKKAEDI 64

Query: 93  MISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAK 152
           M+ R  I A+  + TV EA+    +   S  PVY+  +D+  G+ H+RD +      Y K
Sbjct: 65  MVHRKHIIALGSEKTVEEALEFMLEQKNSRFPVYEEDIDSIIGIFHLRDAVK----CYFK 120

Query: 153 TNNINLNIQ-LSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYE 211
            N  N+ I+ L E   +    FVP +  +  L   ++  +  M +V+DE+G T G+++ E
Sbjct: 121 ENLRNVPIKHLKE--YMHPASFVPEAKSIDKLFKEMKLKKNHMVVVLDEYGQTAGIIAME 178

Query: 212 DIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSL 271
           DI+  ++ +I  E+   +  I  +S+  +I D  T+LE+L KI+          +D  +L
Sbjct: 179 DIIEEIVGNIQDEYDDDEESIQKISNGVYIADGMTELEDLEKILRISFE----NEDFGTL 234

Query: 272 GGLIFSVLDRIPA-RGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
            G +   L+ IP    E  +E  G+   I+      + +VRI ++
Sbjct: 235 NGYLVHCLEHIPTEEEECSVEYGGYRFYIISVSNNLIEKVRIEKI 279


>gi|325851981|ref|ZP_08171064.1| hypothetical protein HMPREF9303_2298 [Prevotella denticola CRIS
           18C-A]
 gi|325484537|gb|EGC87453.1| hypothetical protein HMPREF9303_2298 [Prevotella denticola CRIS
           18C-A]
          Length = 421

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 123/242 (50%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  INAVE+  ++ E   MF + G S + VY++ +D
Sbjct: 194 EDEVKIFQNALDFQDTKVRDCMVPRTEINAVEENCSLMELQQMFIESGNSKIIVYQDDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H        S M+        +I        + + FVP +M    L+    + +
Sbjct: 254 HVKGYIHS-------SEMFRAPERWREHI--------RKMPFVPETMPAQKLMQVFLQQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +   ++DN +++ AR +++++
Sbjct: 299 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNTKYVAKQIADNEYVLSARLEIDKV 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   D   L    D  ++GGL+  V    P   E++  +  +E  I+   +  +  VR
Sbjct: 359 NEMFNLD---LPESDDYMTVGGLLLHVYQSFPKVNEII-TVGQYEFRIIKNTMTKIELVR 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|256828466|ref|YP_003157194.1| CBS domain-containing protein [Desulfomicrobium baculatum DSM 4028]
 gi|256577642|gb|ACU88778.1| CBS domain containing protein [Desulfomicrobium baculatum DSM 4028]
          Length = 273

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 130/248 (52%), Gaps = 14/248 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E  +  N+L+    +  +IM+ R  I   E   T+ E    F + G S +P+YK
Sbjct: 36  GELQNDEMSMLLNVLQLDDKQAYEIMVPRTDIVCAEIDETITEVARKFFESGHSRLPIYK 95

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            + D   G++H ++++ +         ++        +++++   F+P +  V ++L + 
Sbjct: 96  ETKDQIVGVLHCKELLRFFVGDEEAPTDL--------ASVLRPPYFIPETKNVKNILLDF 147

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDART 246
           Q ++  MA+V+DE+GGT GLV+ ED++  ++ DI  E+   +   I  + + +F+V  RT
Sbjct: 148 QSNKQHMAIVLDEYGGTAGLVTLEDVLEEIVGDIEDEYDPIRPEDIQPIDEGSFLVSGRT 207

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            LE+L +    +C  L   + V+++GG I   L R+P   E  LE+ G+  +I +ADV+ 
Sbjct: 208 ILEDLHE----ECGILLESEQVETVGGYISEQLGRVPETDE-SLELQGYTFLIKEADVKQ 262

Query: 307 VRRVRIRR 314
           ++ V + +
Sbjct: 263 IQWVIVSK 270


>gi|225012327|ref|ZP_03702763.1| protein of unknown function DUF21 [Flavobacteria bacterium
           MS024-2A]
 gi|225003304|gb|EEG41278.1| protein of unknown function DUF21 [Flavobacteria bacterium
           MS024-2A]
          Length = 424

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 116/220 (52%), Gaps = 26/220 (11%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E EIF   L F +++  + M+ R  + AVE++ ++ +   +F   G S +PVYK ++D
Sbjct: 197 DSEIEIFQKALDFSEVKTREAMVPRAEVVAVEEQTSIEDVKALFITTGLSKIPVYKETID 256

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSMLVSDLLTNI 187
              G +H  ++I                    +  ++KNIL    +VP +MLV+D+L  +
Sbjct: 257 QILGYIHAFEIIK-------------------QPKVLKNILLPVAYVPETMLVNDVLKLL 297

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
                 +A+VIDE+GGT G+V+ EDIV  L  +I  EH +   +   + +N+++  AR +
Sbjct: 298 TRQHKSIAVVIDEYGGTSGIVTVEDIVEELFGEIEDEHDTIAHIEKQLDENSYLFSARLE 357

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           ++ L +    D   L   +  ++LGG+I      IPA+GE
Sbjct: 358 VDYLNEKYQLD---LPESEFYETLGGMIAYTTGEIPAKGE 394


>gi|86160257|ref|YP_467042.1| hypothetical protein Adeh_3839 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776768|gb|ABC83605.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 425

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 123/254 (48%), Gaps = 16/254 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G  SE  +E+ +N+  FR+    D+M+ R  + AVE    V E +    + G S M
Sbjct: 182 AGRAGAGSEGTRELIHNVFEFREKVARDVMVPRTDVVAVEIGTPVPEIIRTLSEEGHSRM 241

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+ SLD   G++H RD++  ++H       I L      +++++   FVP S  V  L
Sbjct: 242 PVYRESLDQIAGVLHARDLVPLLAH----PELIVL------ADILRPAHFVPWSKPVEQL 291

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS--KKSMISAVSDNTFI 241
           L  +Q   + MA V+DE GG  G+ + ED++  ++ DI  E     +   +   +D +F 
Sbjct: 292 LREMQRRHLHMAFVVDEFGGVMGICTIEDVLEQIVGDIQDEFEEDDEGREVEQHADGSFT 351

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           V     + E  +        +  ++  +++ G + S+   IPARG+      G+   + +
Sbjct: 352 VQGAAPVAEFNR---AAQAAVPEDEGFETMAGFVSSLAGAIPARGDRFF-WKGWVFTVAE 407

Query: 302 ADVRCVRRVRIRRL 315
           AD R V +VR  R+
Sbjct: 408 ADPRRVVKVRAARV 421


>gi|220917418|ref|YP_002492722.1| protein of unknown function DUF21 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955272|gb|ACL65656.1| protein of unknown function DUF21 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 464

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 124/271 (45%), Gaps = 32/271 (11%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E ++E+ N++L F      ++MI R  + AV+      E + +  +   S MPVY
Sbjct: 187 EGVLDEVKEELLNSVLEFADRVAKEVMIPRTRMVAVDRAVEPDELVRIVTENPYSRMPVY 246

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S+DN  G++ +RD+I  + H       I L+        +K   FVP  M +S LL  
Sbjct: 247 EGSIDNVVGILLVRDIIQELRH--GPLRRIALD------RYLKPAFFVPEQMKISRLLKE 298

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  R  +A+V+DE GGT GLV+ ED++  ++ +I  E   + + + AV+   ++ DA  
Sbjct: 299 MQRRRTHLAVVVDEFGGTSGLVTMEDVIEEIVGEIQDEADVESAPVKAVAPGVWLADAAI 358

Query: 247 DLEELAKII------------GTDCNC-----------LKGEQDVDSLGGLIFSVLDRIP 283
            L +L   +            G D                 + D ++LGG + +   R+P
Sbjct: 359 PLHDLQSFLNEQREEPAPRPAGDDAPEPEDGEPPPEIRFPEQGDYETLGGFVTATAGRVP 418

Query: 284 ARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             G   L   G    +   D R V RV I R
Sbjct: 419 PVG-ATLAWDGLTFTVRAGDERRVTRVEIAR 448


>gi|88601654|ref|YP_501832.1| hypothetical protein Mhun_0343 [Methanospirillum hungatei JF-1]
 gi|88187116|gb|ABD40113.1| protein of unknown function DUF21 [Methanospirillum hungatei JF-1]
          Length = 437

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 135/254 (53%), Gaps = 12/254 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           GI  ETE+++  ++  F   +I D+MI R  I A+     + +   + E+ G +  P+Y+
Sbjct: 194 GIIDETEQDMVESVFEFGDSQIADLMIPRPDIVALNLNDPITKNFEIIERTGHTRYPIYQ 253

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++LD+  G++ +RD +  I+H          N ++  S ++++IL VP +M   DL+   
Sbjct: 254 DTLDSIIGIISIRD-LWLIAHK---------NTEVDFSKIMQDILVVPDNMKALDLIRRF 303

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITS-EHHSKKSMISAVSDNTFIVDART 246
           + +   +A++IDE+G   GL++  D++  L+ D++  +   ++ +I+   D ++++D RT
Sbjct: 304 KTATSPLAVIIDEYGSVVGLITLHDLLEALVGDLSRVDQDDEEPLITRRHDGSWLIDGRT 363

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
             EEL +I G DC+    +    ++ G I   +  IPA G+      G E  ++D D   
Sbjct: 364 SPEELYEITGIDCSEESSKGAFRTMAGFILYKMGSIPATGD-YFSYDGNEYEVVDMDGHR 422

Query: 307 VRRVRIRRLVHFKN 320
           + ++ I RL   +N
Sbjct: 423 IDKILITRLPSPEN 436


>gi|212691241|ref|ZP_03299369.1| hypothetical protein BACDOR_00732 [Bacteroides dorei DSM 17855]
 gi|212666473|gb|EEB27045.1| hypothetical protein BACDOR_00732 [Bacteroides dorei DSM 17855]
          Length = 354

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      E +    +   S +PVY  S DN 
Sbjct: 111 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSEVLKCIVENAYSRIPVYAESRDNI 170

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 171 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 220

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 221 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 280

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 281 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 339


>gi|260655936|ref|ZP_05861405.1| CBS domain protein [Jonquetella anthropi E3_33 E1]
 gi|260629552|gb|EEX47746.1| CBS domain protein [Jonquetella anthropi E3_33 E1]
          Length = 422

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 121/222 (54%), Gaps = 14/222 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+ + + I+ F + R+ ++M+ R  ++ +E   ++ E +    + GRS +PVY+
Sbjct: 183 GVLEADERRMIDGIISFEETRVSEVMVPRTDMDLLEATDSIDEVVEFAGQCGRSRIPVYE 242

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++ DN  G+++++D+++ +     K   + L      + +++  LFVP +M + DL + +
Sbjct: 243 DTPDNIVGILYVKDLLALLH----KGEAVTL------AAIMRKPLFVPETMKLQDLFSIM 292

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +  R+ +A+ +DE+GGT GLV+ ED++  ++ +I  E+  +K+ +  + D  + V     
Sbjct: 293 RSQRVHLAIAVDEYGGTAGLVTLEDMLEEIVGEIQDEYDQEKTPVEKIGDGKYRVQGTVC 352

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           LE+  K +          ++VD++GG +       P +G+ +
Sbjct: 353 LEDFGKAVEYPFES----EEVDTVGGFVLDQFGNFPRQGDTI 390


>gi|187932719|ref|YP_001887627.1| membrane hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
 gi|187720872|gb|ACD22093.1| putative membrane CBS domain protein [Clostridium botulinum B str.
           Eklund 17B]
          Length = 417

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 133/246 (54%), Gaps = 15/246 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+  N+  F  +++ D+M+ RV + A++ ++T  + + + ++   S +P+Y
Sbjct: 182 EGVLENVEKEMIFNVFDFADLQVKDVMVQRVDVTALDSESTYDDVLKIIKEEQFSRIPIY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++D+  G+++++D++           N   N ++++   I+   +      + +L   
Sbjct: 242 NQTIDDVIGILNVKDLLML--------ENPRENFKMTK--YIREPFYTFEFKKIVELFKE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ R  +A+V+DE+GGT G+++ ED++  ++ DI  E+    + I  + +N +IVD   
Sbjct: 292 MKKERNHIAVVLDEYGGTVGIITIEDLIEEIVGDIEDEYDDANTSIEVIKENEYIVDGSV 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L ++  +IGTD        + DS+GGLI   L R+P   E + E    + ++ + D   
Sbjct: 352 RLHDIGDLIGTDMES----DEFDSVGGLIIGELGRMPEEKEEI-ECDNMKFIVENIDKNR 406

Query: 307 VRRVRI 312
           +++VRI
Sbjct: 407 IKKVRI 412


>gi|228471961|ref|ZP_04056729.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276573|gb|EEK15286.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
          Length = 430

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 132/250 (52%), Gaps = 24/250 (9%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E +I + I+ F    I  +M  R+ I+A+E+  T  E +   ++ G S +PVY+ ++
Sbjct: 194 TQEEHKILSGIVSFGNTDIRAVMHPRIDISAIEESMTYREVLTFIQENGYSRVPVYQENI 253

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D   G+++ +D++ Y+         I            +   FVP +  + DLLT  Q+ 
Sbjct: 254 DKITGIIYAKDLLPYLDEEDFDWRKIK-----------RKAFFVPENKKLDDLLTEFQQR 302

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +I +A+V+DE+GGT G+V+ EDI+  ++ +I+ E+  + +  + + D  F+ D +T L++
Sbjct: 303 KIHLAIVVDEYGGTLGVVTLEDIIEEIVGEISDEYDMEDTFYTKIDDRNFLFDGKTSLKD 362

Query: 251 LAKIIGT------DCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP--GFEIVILDA 302
             +++        D   ++GE   +++ G +  +++  P + +   EIP   +   I D 
Sbjct: 363 FYRVLSVEETDQEDFEKVRGES--ETIAGFLLELIESFPEKKQ---EIPYKHYIFTIEDI 417

Query: 303 DVRCVRRVRI 312
           D + ++++++
Sbjct: 418 DKKRIKQLKV 427


>gi|298528150|ref|ZP_07015554.1| CBS domain containing protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511802|gb|EFI35704.1| CBS domain containing protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 270

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 139/265 (52%), Gaps = 26/265 (9%)

Query: 61  RIDASLEGIFSET--EKEIFN-------NILRFRKIRIDDIMISRVSINAVEDKATVYEA 111
           R DA LE +  E   E EI N       NILR  + +  +IM+ R  +   E+  T+ + 
Sbjct: 20  RCDAPLEEVIREASEEGEIKNEEVRMLLNILRLHEKQAVEIMVPRTDLVCAEENDTLKDV 79

Query: 112 MLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNI 171
                + G S +PVY+ + D+  G++H +D++ +    + +  ++++N      +L++  
Sbjct: 80  AESILQSGHSRLPVYRENKDHIVGLIHAKDLLQH----FFENKDVSVN------SLMREP 129

Query: 172 LFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM 231
            F+P +  V  +L + Q  +I + +V+DE+GGT G+V+ ED++  ++ +I  E+   +  
Sbjct: 130 HFMPETKNVRQILMDFQNQKIHLGVVLDEYGGTSGIVTLEDVLEEIVGEIEDEYDPPRPQ 189

Query: 232 -ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
            +  + D T+ V  RT L+ELA     D       + V+++GG I  +  ++P +GE   
Sbjct: 190 EVQTMDDGTYYVAGRTSLDELA-----DIGIKIPTEQVETIGGYISHLAGKVPVKGEEFS 244

Query: 291 EIPGFEIVILDADVRCVRRVRIRRL 315
           +   F  V+ +A+ + ++ + IRRL
Sbjct: 245 D-EFFSYVVQEANTKNIQWLTIRRL 268


>gi|75908578|ref|YP_322874.1| hypothetical protein Ava_2361 [Anabaena variabilis ATCC 29413]
 gi|75702303|gb|ABA21979.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 432

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 124/243 (51%), Gaps = 11/243 (4%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
            E+E+ NNI  F  +   D+MI R  I A+   A     +      G S  PV   SLD+
Sbjct: 200 AERELLNNIFEFGDVTAQDVMIPRNGIIALSKDANFQSLLQQMTATGHSRYPVIGESLDD 259

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            RG+V+ RD+ + ++        ++L  Q+     ++   FVP    +S+LL  +Q+ + 
Sbjct: 260 IRGIVYFRDLANPLA-----VGKLSLETQIQP--WMRPARFVPEHTPLSELLPMMQQEKP 312

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            M +V+DE GGT GLV+ +D+++ ++ +      S+  +I  +   TF+V A+ +LE+L 
Sbjct: 313 AMVIVVDEFGGTVGLVTIQDVIAEIIGNAGETSSSEDLLIQMLDQETFLVQAQVNLEDLN 372

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           +++  +    K  Q   +L G +   L ++P +GE+       E  I+  D   + ++++
Sbjct: 373 EVLHLNLPLTKQYQ---TLAGFLLYQLQKMPIKGEIFC-YDNIEFTIVSVDGPRLHQIQL 428

Query: 313 RRL 315
           RRL
Sbjct: 429 RRL 431


>gi|261838764|gb|ACX98530.1| integral membrane protein [Helicobacter pylori 51]
 gi|332674260|gb|AEE71077.1| CBS domain protein [Helicobacter pylori 83]
          Length = 449

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDIIIS-HGYLFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|317011625|gb|ADU85372.1| hypothetical protein HPSA_07090 [Helicobacter pylori SouthAfrica7]
          Length = 449

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SLFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|288925037|ref|ZP_06418973.1| CBS domain protein [Prevotella buccae D17]
 gi|288338227|gb|EFC76577.1| CBS domain protein [Prevotella buccae D17]
          Length = 419

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 132/245 (53%), Gaps = 14/245 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ I   I+RF      ++M SR  I  ++ +++  + +    +   S +PVY+N+ DN 
Sbjct: 176 EQSILQGIIRFGDETAKEVMTSRQDIVDLDIRSSFTDVLKCIVENNYSRIPVYQNNTDNI 235

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S   +              +LI+   FVP +  + DLL   QE+R+ 
Sbjct: 236 RGVLYIKDLLPHLSKPAS----------FRWQSLIRPPYFVPETKKIDDLLREFQENRVH 285

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++   S ++ NT+I + +T L +  K
Sbjct: 286 IAIVVDEFGGTSGLVTLEDILEEIVGEINDEYDEEEKNYSKLNYNTYIFEGKTLLSDFCK 345

Query: 254 IIGT-DCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+   D    + E D D+L GL+  +    P+  E  L    +   I++ + R + +V++
Sbjct: 346 ILNIGDEEFSEVEGDADTLAGLLLEIKGDFPSVYE-KLNYKNYSFEIMEVEDRRISKVKV 404

Query: 313 RRLVH 317
             +VH
Sbjct: 405 --IVH 407


>gi|154151431|ref|YP_001405049.1| hypothetical protein Mboo_1891 [Candidatus Methanoregula boonei
           6A8]
 gi|153999983|gb|ABS56406.1| protein of unknown function DUF21 [Methanoregula boonei 6A8]
          Length = 425

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 139/250 (55%), Gaps = 12/250 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG   + E+++  ++L F      +IM  RV    +ED  T+ EA+ +F + G S +PVY
Sbjct: 177 EGTIEQDEQDMLYSVLEFGDTTAREIMTPRVDAIVMEDTTTLGEAIRLFNETGFSRIPVY 236

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
            + +DN  G+++++DV S +      +N  +L+I+     ++ +  FVP +  + DLL  
Sbjct: 237 HDQIDNITGVLNVKDVFSAMV-----SNRKDLSIK----EIMYDPTFVPETKKIDDLLKE 287

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q  R+++A++IDE+ G  G+V+ EDI+  L+ DI  E+  ++  +  +++  +I+DA+ 
Sbjct: 288 LQVHRVQIAIIIDEYSGFVGIVTVEDILEELVGDIRDEYDREEPDVQKIAEGVYILDAQM 347

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            +++  + +G     L  ++  +++GGL+   L  +P      +EI G  I ++   +  
Sbjct: 348 WVDDANEELGL---ALPMDESYETIGGLLIDRLGHLPQHPGEKVEIEGGRITLVVMQMHG 404

Query: 307 VRRVRIRRLV 316
            R V+I+ +V
Sbjct: 405 RRIVKIKCVV 414


>gi|289450446|ref|YP_003474520.1| hypothetical protein HMPREF0868_0178 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184993|gb|ADC91418.1| conserved hypothetical protein [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 625

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 130/237 (54%), Gaps = 21/237 (8%)

Query: 57  IRLPRIDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF 115
           IRL  +DAS E G    TEKE+ +N+  F    + +IM  R ++ A+   A + + + + 
Sbjct: 205 IRL-MVDASNETGNIENTEKELIDNVFEFNDTEVSEIMTHRTNVEALPLDADIEQTLKVC 263

Query: 116 --EKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILF 173
             E++ R  +PVY  ++D+  G++H++D++S+++    K  +  L       +LI+    
Sbjct: 264 CDERFSR--IPVYDENIDDIVGILHVKDMLSFMAKH--KKQDFAL------KDLIRQPFV 313

Query: 174 VPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMIS 233
            P    +  L   +Q++ ++MA+VIDE+GGT G+++ EDI+  L+ +I  E+  + + I 
Sbjct: 314 TPEKKSIDALFREMQKNHVQMAIVIDEYGGTAGIITIEDILEELVGNIQDEYDEEDAEIV 373

Query: 234 AVSDNTFIVD---ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           A +D ++ VD   A  D+ E       D +    E D D++GG + ++LDRIP   E
Sbjct: 374 ANADGSYTVDGLAAPDDVSEQIPWFKLDNS----EDDCDTMGGYVINLLDRIPDEDE 426


>gi|109948217|ref|YP_665445.1| hemolysin domain-containing protein [Helicobacter acinonychis str.
           Sheeba]
 gi|109715438|emb|CAK00446.1| putative integral membrane protein with haemolysin domain
           [Helicobacter acinonychis str. Sheeba]
          Length = 439

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 199 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 258

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 259 KGSKDNIIGMVHIRDLLSR-SLFTPKMHDFK--------QIVRKMIIVPESASISQILIK 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 310 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 369

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 370 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIIS-HGYAFEVLSVDG 423

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 424 ARIKRLK 430


>gi|226356118|ref|YP_002785858.1| hemolysin [Deinococcus deserti VCD115]
 gi|226318108|gb|ACO46104.1| putative CBS domain-containing protein; putative membrane protein
           [Deinococcus deserti VCD115]
          Length = 446

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 133/258 (51%), Gaps = 19/258 (7%)

Query: 52  SHHKG-----IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
            HH       IR+    +S EG+  ++EKE+  N+       + +IM  RV +   +   
Sbjct: 175 GHHTAYSEEEIRMIVSASSQEGVLEDSEKELVYNVFDLSDTTVREIMTPRVDMVVTDSAL 234

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESN 166
            +   + +   +G S +PVY+++ DN  G+VH  DV+S++  +   T           ++
Sbjct: 235 PLRRLLELRADHGYSRVPVYQDTADNIVGIVHTSDVLSHLDALDTTTL----------AD 284

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH 226
           +++ + FVP SM ++DLL  ++E +  +++V+DE GGT GLV+ ED +  ++ +I  E  
Sbjct: 285 IMRPVFFVPESMKINDLLAKMREKKSHLSIVVDEFGGTSGLVTLEDALEEIVGEIYDETD 344

Query: 227 SKK-SMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPAR 285
            ++ S I  + +  +++DA   + E+ + I +D     GE + D+L G + S    IP  
Sbjct: 345 EEELSRIEVLGEGIYLMDASLTVHEVEERINSDIE--DGEGEFDTLSGFMTSHFGDIPEI 402

Query: 286 GEVVLEIPGFEIVILDAD 303
           G+  +   G+   + DAD
Sbjct: 403 GQNFVH-NGWSFTVEDAD 419


>gi|332298759|ref|YP_004440681.1| protein of unknown function DUF21 [Treponema brennaborense DSM
           12168]
 gi|332181862|gb|AEE17550.1| protein of unknown function DUF21 [Treponema brennaborense DSM
           12168]
          Length = 427

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 18/255 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG   +TEK++   I  F  +R  DI   R  + AV   A+  EA  +F   G S +PVY
Sbjct: 180 EGTLEKTEKDMLYKIFEFTDLRTRDITRHRSLVKAVSADASYTEAAAVFCSTGYSRLPVY 239

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI----KNILFVPSSMLVSD 182
             + D   G++H +D++      Y +T      +  +++  +    K +LFVP +     
Sbjct: 240 AGNEDEYVGLLHYKDLL-----FYYETQPAARRLDAAQAGFVRSCMKPVLFVPETKSAVS 294

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS----MISAVSDN 238
           LL   +  R+  A+V+DEHG   G+V+ +DI++ +M  IT E+ S+++     I  +S  
Sbjct: 295 LLHVFKTERVNFAVVVDEHGTNSGIVTMDDILNAVMGRITDEYASRETPPEERIKILSGT 354

Query: 239 TFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIV 298
            F++     L +L  I    C       D D+LGG +      +P+ GE V +   +  V
Sbjct: 355 DFLLPGDLRLSDLNGIFSLRCT----SDDFDTLGGWLLEQFGYLPSIGE-VFKSGKYVFV 409

Query: 299 ILDADVRCVRRVRIR 313
           I D   R ++ VR++
Sbjct: 410 IEDQAQRRIQSVRLK 424


>gi|295106291|emb|CBL03834.1| Hemolysins and related proteins containing CBS domains
           [Gordonibacter pamelaeae 7-10-1-b]
          Length = 460

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 127/247 (51%), Gaps = 14/247 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EK + ++IL    + + +IM  RV +  VED  TV +A+      G S +PV+   +D  
Sbjct: 200 EKRMIHDILDLGDMTVHEIMQPRVDMILVEDTETVRQAVDRMRGTGYSRLPVFHEDIDRI 259

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+VH +D++  +  M  K N          ++     LFVP +  +  LL+ +Q +R +
Sbjct: 260 VGIVHYKDLVGPL--MDGKENE-------PVADYAYEALFVPETKDLFPLLSEMQTNRQQ 310

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE+GGTDGL++ EDIV  ++ +I  E   +   I+ +SD T++VD R  +E+  K
Sbjct: 311 MAIVVDEYGGTDGLITVEDIVEEIVGEIIDESDIENKFITPLSDGTWLVDGRFPVEDALK 370

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +       +    D +++ G +  ++D +P  G+   E  G+   I     R +  +R+ 
Sbjct: 371 L----GWPVTESDDYETMAGWLMGMIDFVPQVGD-EFEFGGYRFKIQAMRRRRISNIRVT 425

Query: 314 RLVHFKN 320
           R V   N
Sbjct: 426 REVGADN 432


>gi|108563848|ref|YP_628164.1| hemolysin domain-containing protein [Helicobacter pylori HPAG1]
 gi|107837621|gb|ABF85490.1| putative integral membrane protein with a TlyC-like hemolysin
           domain [Helicobacter pylori HPAG1]
          Length = 445

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 133/250 (53%), Gaps = 17/250 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKGHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  I+ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGINKLEEGVFELEGML 377

Query: 247 DLE--ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE  E A  I  D  C   EQ   +LGG +FS+L+R+P  G++++   G+   +L  D 
Sbjct: 378 DLESVEEALHIEFDKEC---EQ--VTLGGYVFSLLERMPMEGDIIVS-HGYAFEVLSVDG 431

Query: 305 RCVRRVRIRR 314
             ++R++  +
Sbjct: 432 ARIKRLKASK 441


>gi|296126704|ref|YP_003633956.1| CBS domain containing protein [Brachyspira murdochii DSM 12563]
 gi|296018520|gb|ADG71757.1| CBS domain containing protein [Brachyspira murdochii DSM 12563]
          Length = 273

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 136/248 (54%), Gaps = 20/248 (8%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            +E E+EI  N +  +   + +IM+ RV +  +  +++  + +  F K   S +P+YK+ 
Sbjct: 29  LTEPEREIIINTIELKSKSVREIMVPRVDVIMLPIESSYDKVIKAFNKDRNSRIPIYKDG 88

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +D+  G+++++D+I         T++ N +++     ++   LFVP S+ + +LL N +E
Sbjct: 89  IDDIIGVLYVKDLID--------TDDKNFSLK----KILHKPLFVPISISLMELLKNFRE 136

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
            +I +A+V+DE+GG  G+VS ED++  ++ DI  E+  +   + +  D T++VDAR  ++
Sbjct: 137 KQIHIAMVVDEYGGFSGIVSMEDVLEQIIGDIRDEYDEEDEEVKSNDDGTYLVDARARID 196

Query: 250 ELAKIIGTDCNCLK--GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +  K        L    + + D++GG +FS L R+P R E + E   +   ++      V
Sbjct: 197 DFNK-----YGILPPIPDDEADTVGGFLFSYLGRLPKRNEAI-EYKDYSFTVVGKSGNIV 250

Query: 308 RRVRIRRL 315
            ++RI +L
Sbjct: 251 TKIRIEKL 258


>gi|210623668|ref|ZP_03293977.1| hypothetical protein CLOHIR_01927 [Clostridium hiranonis DSM 13275]
 gi|210153433|gb|EEA84439.1| hypothetical protein CLOHIR_01927 [Clostridium hiranonis DSM 13275]
          Length = 399

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 128/223 (57%), Gaps = 13/223 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+EI NN+  F  ++  D M+ R+ +  VE   T  E + +F +   S +PVY
Sbjct: 166 EGVLEVEEREIINNVFEFGDMQAKDAMVQRMDMVTVEVDDTYEEIIEVFREEKLSRLPVY 225

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++S+D+  G+++++D+I ++S    +          S  N +++  F      ++ LL +
Sbjct: 226 EDSVDDIIGIINIKDMI-FLSDEEKE--------YFSVKNYMRDPFFTYEFKKITQLLED 276

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++++ ++A+V+DE+GGT GL++ ED+V V++ DI  E+   +  I  + ++ +IVD  T
Sbjct: 277 MKKAKTQIAIVLDEYGGTSGLLTVEDLVEVIVGDIEDEYDEDEDDIIVIKEDEYIVDGST 336

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            + E+ ++IGT        ++ DS+GG +   LDR+P   EV+
Sbjct: 337 RISEVNELIGTSIET----EEFDSIGGYLIGYLDRLPEEKEVI 375


>gi|203283985|ref|YP_002221725.1| hemolysin [Borrelia duttonii Ly]
 gi|203287528|ref|YP_002222543.1| hemolysin [Borrelia recurrentis A1]
 gi|201083428|gb|ACH93019.1| hemolysin [Borrelia duttonii Ly]
 gi|201084748|gb|ACH94322.1| hemolysin [Borrelia recurrentis A1]
          Length = 259

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 121/218 (55%), Gaps = 14/218 (6%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  + NN    ++  + +IM+ R+S+  ++   +  + + +      S  PVYK ++
Sbjct: 25  SRFETSLLNNFNSLKETIVKEIMVPRISVIFIDYSVSKDDILKVVTSSNHSRFPVYKETI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKT-NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           D+  G++H +D++    HM+ K   +I+L       ++++ ++FVP S  +  LL   QE
Sbjct: 85  DDIIGIIHTKDILL---HMWKKDFYDIDL------KDIMRKVMFVPESKKIDSLLKEFQE 135

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           + + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++  AR  +E
Sbjct: 136 NHVHIAIVVDEYGGISGLVTLEDILEEIVGDIQDEFDNEVDEIVPLDDGSYLCTARVLIE 195

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +L + +G    CL  + D D+LGG ++ +  RIP + E
Sbjct: 196 DLNEKLGL---CLP-DGDFDTLGGFVYDLFGRIPLKNE 229


>gi|323359832|ref|YP_004226228.1| hemolysins [Microbacterium testaceum StLB037]
 gi|323276203|dbj|BAJ76348.1| hemolysins [Microbacterium testaceum StLB037]
          Length = 434

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 119/218 (54%), Gaps = 10/218 (4%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  + ++E+ +++  F    + ++M+ R  +  V+  AT  EA+ +F + G S +P+  +
Sbjct: 179 LIEQDDRELIHSVFDFTDRYVREVMVPRTDMVTVDATATSREALALFLEKGVSRVPLADD 238

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D+  GM++++D++ +     A   +  +        + +  +FVP SM    LL  ++
Sbjct: 239 EADDVVGMLYLKDLVQFGFRDEAGWRDAPIR------RIARPAVFVPESMKAETLLQQMK 292

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
              + + L +DE+GG  GLV+ ED++  L+ +I+ E+ +  + + A+ D  + V+AR  L
Sbjct: 293 RDAVHVCLAVDEYGGISGLVTLEDLIEELVGEISDEYDAPSTEVVALDDGRYRVNARLGL 352

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
           +E+  + G + +    ++DVDS+GGL+   L RIP  G
Sbjct: 353 DEVGDLFGLELD----DEDVDSIGGLLGKALGRIPQPG 386


>gi|77163775|ref|YP_342300.1| Mg2+/Co2+ transporter [Nitrosococcus oceani ATCC 19707]
 gi|254435987|ref|ZP_05049494.1| CBS domain pair protein [Nitrosococcus oceani AFC27]
 gi|76882089|gb|ABA56770.1| Putative Mg2+ and Co2+ transporter CorC [Nitrosococcus oceani ATCC
           19707]
 gi|207089098|gb|EDZ66370.1| CBS domain pair protein [Nitrosococcus oceani AFC27]
          Length = 291

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 121/221 (54%), Gaps = 14/221 (6%)

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           ++++ DIM+ R  +  VE  A   + + +  +   S  PV   S D   G++  +D++ Y
Sbjct: 62  EMQVRDIMVPRSQMVVVERDAPPEDTLEVITRSAHSRFPVIGESRDGIVGILLAKDMLLY 121

Query: 146 ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTD 205
                A+T NI         ++++ ++F+P S  ++ LL   + SR  MA+V+DE+GGT 
Sbjct: 122 CRQQEARTFNIR--------DILRPVVFIPESKRLNVLLREFRASRNHMAIVVDEYGGTA 173

Query: 206 GLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           GLV+ ED++  ++ +I  EH  ++ + I    ++ + V A T +E+  +  GTD +    
Sbjct: 174 GLVTIEDVLEQIVGEIEDEHDVAEDAFIFRRREDNYTVKALTPIEDFNEYFGTDFS---- 229

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           +++ D++GGL+ +   R+P RGE +  I  FE  +L AD R
Sbjct: 230 DEEFDTIGGLVLNGFGRMPERGETIA-IGSFEFKVLRADSR 269


>gi|265752038|ref|ZP_06087831.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           3_1_33FAA]
 gi|263236830|gb|EEZ22300.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           3_1_33FAA]
          Length = 417

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      E +    +   S +PVY  S DN 
Sbjct: 174 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSEVLKCIVENAYSRIPVYAESRDNI 233

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 234 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 283

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 284 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 343

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 344 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 402


>gi|302346445|ref|YP_003814743.1| hypothetical protein HMPREF0659_A6699 [Prevotella melaninogenica
           ATCC 25845]
 gi|302150846|gb|ADK97107.1| conserved hypothetical protein [Prevotella melaninogenica ATCC
           25845]
          Length = 421

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 121/242 (50%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  I AVE+  ++ E   MF + G S + VY+  +D
Sbjct: 194 EDEVKIFQNALEFQDTKVRDCMVPRTEIKAVEENCSLEELQQMFIESGNSKIVVYEGDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H        S M+    N          + I+ + FVP +M    L+      +
Sbjct: 254 HIKGYIHS-------SEMFRSPKNW--------KDHIRQMPFVPETMAAHKLMQVFLLQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +   ++DN +++ AR +++++
Sbjct: 299 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNTKYIAKQINDNEYVLSARLEIDKV 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   D   L    D  ++GGL+  V    P   E++  +  +E  I+   +  +  VR
Sbjct: 359 NEMFNLD---LPENDDYMTVGGLLLHVYQSFPKLNEII-TVGQYEFKIIKNTMTKIELVR 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|315608075|ref|ZP_07883068.1| CBS domain protein [Prevotella buccae ATCC 33574]
 gi|315250544|gb|EFU30540.1| CBS domain protein [Prevotella buccae ATCC 33574]
          Length = 428

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 132/245 (53%), Gaps = 14/245 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ I   I+RF      ++M SR  I  ++ +++  + +    +   S +PVY+N+ DN 
Sbjct: 185 EQSILQGIIRFGDETAKEVMTSRQDIVDLDIRSSYTDVLKCIVENNYSRIPVYQNNTDNI 244

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S   +              +LI+   FVP +  + DLL   QE+R+ 
Sbjct: 245 RGVLYIKDLLPHLSKPAS----------FRWQSLIRPPYFVPETKKIDDLLREFQENRVH 294

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  ++   S ++ NT+I + +T L +  K
Sbjct: 295 IAIVVDEFGGTSGLVTLEDILEEIVGEINDEYDEEEKNYSKLNYNTYIFEGKTLLSDFCK 354

Query: 254 IIGT-DCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+   D    + E D D+L GL+  +    P+  E  L    +   I++ + R + +V++
Sbjct: 355 ILNIGDEEFSEVEGDADTLAGLLLEIKGDFPSVYE-KLNYKNYSFEIMEVEDRRISKVKV 413

Query: 313 RRLVH 317
             +VH
Sbjct: 414 --IVH 416


>gi|77919806|ref|YP_357621.1| CBS domain-containing protein [Pelobacter carbinolicus DSM 2380]
 gi|77545889|gb|ABA89451.1| uncharacterized CBS domain-containing protein [Pelobacter
           carbinolicus DSM 2380]
          Length = 417

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 116/220 (52%), Gaps = 14/220 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  + ++++ + I    +I + D+MI R  I A++   +  E + + ++   S  P+Y+
Sbjct: 179 GVVGKDKRKMLDGIFDLSQICVRDVMIPRTEIAALDVSFSFAEVLRLVQQSSHSRFPIYE 238

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLDN  G++H +D++ Y+          +++ + S   L +   FVP S  ++ LL   
Sbjct: 239 GSLDNVIGIIHSKDILRYV----------HISEEFSLEKLARKPYFVPESKRINTLLPAF 288

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  ++ MA+V+DE+GG +GLV+ ED+V  ++ +I  E+   + M+  +    +++DA   
Sbjct: 289 QRRQVHMAVVVDEYGGVEGLVTLEDVVEEIVGEIRDEYDIDEDMVCELRPGRYLLDASIS 348

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           L  + +  G + +    E+   +L G +  VL  IP  G+
Sbjct: 349 LRAVNQRFGLELS----EEHASTLAGFLLGVLGSIPRVGD 384


>gi|326792027|ref|YP_004309848.1| hypothetical protein Clole_2953 [Clostridium lentocellum DSM 5427]
 gi|326542791|gb|ADZ84650.1| protein of unknown function DUF21 [Clostridium lentocellum DSM
           5427]
          Length = 427

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 118/222 (53%), Gaps = 16/222 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EK++  N+  F +    DIM+ R  +  V+  AT  E + ++++   S MPVY
Sbjct: 186 EGVLETDEKQMIYNVFDFGQSCAKDIMVPRTDMICVDLDATYEEILTLYKEEQFSRMPVY 245

Query: 127 KNSLDNPRGMVHMRDVI-SYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           + + D+  G++H++D+I + +S  + K            S+ ++   FV      ++L  
Sbjct: 246 QETHDHIVGILHIKDLILNVVSPQHFKV-----------SDYLREAYFVHEFKNNNELFK 294

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            ++  +I +A+V+DE+GGT GLVS ED++  +M DI  E+ S +     VS+  ++VD  
Sbjct: 295 EMRLQKIGLAIVLDEYGGTAGLVSMEDLIEEIMGDINDEYDSVQDDFVKVSEEEYVVDGT 354

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           + + E+ + +G D        D DS+GG +  + DR P  GE
Sbjct: 355 SRISEVNEELGLDIIS----NDFDSIGGFVIGLFDRFPTEGE 392


>gi|188589005|ref|YP_001922597.1| putative membrane CBS domain protein [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188499286|gb|ACD52422.1| putative membrane CBS domain protein [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 417

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 132/246 (53%), Gaps = 15/246 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+  N+  F  +++ D+M+ RV ++A++ +AT  + + + ++   S +P+Y
Sbjct: 182 EGVLENVEKEMIFNVFDFADLQVKDVMVQRVDVSALDSEATYDDVLKLIKEEQFSRIPIY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++D+  G+++++D++           N   N ++ +   I+   +      + +L   
Sbjct: 242 NQTIDDIIGILNVKDLLML--------ENPRENFKMEK--YIREPYYTFEFKKIVELFKE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ R  +A+V+DE+GGT G+++ ED++  ++ DI  E+    + I  + DN +IVD   
Sbjct: 292 MKKERNHIAVVLDEYGGTVGIITIEDLIEEIVGDIEDEYDDANTSIEVIKDNEYIVDGSV 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L ++  +IG D        + DS+GGLI   L R+P   E + E    + ++ + D   
Sbjct: 352 RLHDIGDLIGIDMES----DEFDSVGGLIIGELGRMPEEKEEI-ECDSMKFIVENIDKNR 406

Query: 307 VRRVRI 312
           +++VRI
Sbjct: 407 IKKVRI 412


>gi|307638146|gb|ADN80596.1| Hemolysin like protein [Helicobacter pylori 908]
 gi|325998339|gb|ADZ50547.1| putative hemolysin like protein [Helicobacter pylori 2017]
          Length = 433

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 191 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 250

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 251 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 301

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 302 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 361

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 362 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 415

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 416 ARIKRLK 422


>gi|283850200|ref|ZP_06367489.1| CBS domain containing protein [Desulfovibrio sp. FW1012B]
 gi|283574226|gb|EFC22197.1| CBS domain containing protein [Desulfovibrio sp. FW1012B]
          Length = 271

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 131/252 (51%), Gaps = 14/252 (5%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           ++A  +G   + +  +  NILR  K ++ DIMI R  I   E    +     + + +G S
Sbjct: 29  LEARADGSLIQEDASMLLNILRLEKKQVFDIMIPRPDIVCAEADDGIPAICDLIKAHGHS 88

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +P+Y+ + DN  G+V+ +D+++++     +  +          ++++  LF+P ++ + 
Sbjct: 89  RIPIYEGNRDNILGVVYAKDLLAHLVGACGEYPD--------PRSIMRAPLFIPETLNLK 140

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTF 240
            +L   +  +  MA+ +DE+GGT GLV+ ED++  ++ +I  EH  SK   I       F
Sbjct: 141 KMLLEFRSQKKHMAVALDEYGGTSGLVTLEDVLEEIVGEIEDEHDPSKPEEIQETKPGVF 200

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           +V  R  LE+L   +G D   L+ EQ V+++GG +  +  R+P +G+    + G    I 
Sbjct: 201 LVSGRFPLEDLNASLGLD---LESEQ-VETIGGFLTELAGRVPRQGD-AFTLAGRRFTIR 255

Query: 301 DADVRCVRRVRI 312
           +AD R +R + I
Sbjct: 256 EADRRQIRWIVI 267


>gi|317014905|gb|ADU82341.1| hypothetical protein HPGAM_07840 [Helicobacter pylori Gambia94/24]
          Length = 449

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|291460899|ref|ZP_06025787.2| CBS/transporter associated domain protein [Fusobacterium
           periodonticum ATCC 33693]
 gi|291380149|gb|EFE87667.1| CBS/transporter associated domain protein [Fusobacterium
           periodonticum ATCC 33693]
          Length = 421

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 137/250 (54%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 177 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEATKTINEVWDDIIDNGFSRIPIY 236

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +NL I+      ++   FVP +  + ++L  
Sbjct: 237 EETIDNIIGILYVKDLMEHI-----KNNELNLPIK----QFVRAAYFVPETKSIIEILKE 287

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  + +S    VSD  + VDA 
Sbjct: 288 FRTLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEDESFFKKVSDTEYEVDAM 347

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  D   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 348 TDIETINKELELD---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 403

Query: 306 CVRRVRIRRL 315
            V +V I+ L
Sbjct: 404 RVSKVFIKIL 413


>gi|237712327|ref|ZP_04542808.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237726463|ref|ZP_04556944.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           D4]
 gi|229434989|gb|EEO45066.1| CorC/HlyC family transporter associated protein [Bacteroides dorei
           5_1_36/D4]
 gi|229453648|gb|EEO59369.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 452

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      E +    +   S +PVY  S DN 
Sbjct: 209 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSEVLKCIVENAYSRIPVYAESRDNI 268

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 269 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 318

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 319 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 378

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 379 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 437


>gi|254495143|ref|ZP_05108067.1| transmembrane CBS domain transporter [Polaribacter sp. MED152]
 gi|213690648|gb|EAQ40650.2| transmembrane CBS domain transporter [Polaribacter sp. MED152]
          Length = 421

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 122/233 (52%), Gaps = 27/233 (11%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F+ ++  ++M+ R  I +VE   TV     +F + G S + VYK SLD
Sbjct: 193 DSEIQIFQNALIFQNVKAREVMVPRTEIISVEIHETVTNLKKLFIETGLSKVLVYKTSLD 252

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILF----VPSSMLVSDLLTNI 187
           +  G V+  ++                     +   IK+IL     VP SM+++D+L  +
Sbjct: 253 DVLGYVNAFEL-------------------FKKPKTIKSILLPLEIVPESMMINDILNTL 293

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            + R  +A+V+DE+GGT G+++ EDIV  L  +I  EH S++ +   + D+ F   AR +
Sbjct: 294 MKKRKSVAVVVDEYGGTSGMITVEDIVEELFGEIEDEHDSQEFLEEKLKDDHFNFSARIE 353

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           ++ L +    D N  K E   ++LGG I    + IP   E VLEI  FEI IL
Sbjct: 354 VDYLNE--EYDLNIPKSEA-YETLGGFIIEHTENIPEEKE-VLEIDNFEITIL 402


>gi|325996745|gb|ADZ52150.1| Hemolysin like protein [Helicobacter pylori 2018]
          Length = 441

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 199 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 258

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 259 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 310 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 369

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 370 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 423

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 424 ARIKRLK 430


>gi|15612448|ref|NP_224101.1| hypothetical protein jhp1383 [Helicobacter pylori J99]
 gi|4155992|gb|AAD06954.1| putative [Helicobacter pylori J99]
          Length = 441

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 199 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSHFTRYPYC 258

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 259 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 310 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 369

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 370 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPIEGDTIVS-HGYAFEVLSVDG 423

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 424 ARIKRLK 430


>gi|294085154|ref|YP_003551914.1| CBS domain-containing protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664729|gb|ADE39830.1| CBS domain protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 281

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 128/252 (50%), Gaps = 20/252 (7%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +F   E  +  N+L  R     D+MI R  I +V  +    +      +   S +PVY+ 
Sbjct: 36  LFDRHEGTLLRNLLGLRDKIASDVMIPRADIVSVSMRNEFSQISKQISQVRHSRIPVYRE 95

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE----SNLIKNILFVPSSMLVSDLL 184
           +LD+  G +H++D+ +              ++Q  E     +L++  LFV  ++ + DLL
Sbjct: 96  TLDDVAGFIHVKDIFA--------------SLQAGEVPPVKSLLRPALFVAPTIRLLDLL 141

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV-SDNTFIVD 243
             ++  R  +ALV+DE GG DGL++ ED++  ++ DI  E+    ++   +  D T I D
Sbjct: 142 HEMRLKRRHLALVVDEFGGVDGLITIEDLIEEIVGDIEDEYDETIALRFDINGDGTAIAD 201

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR ++E L  + G   +      ++D+LGGL+ +   R+P RGE+V    G +  +L+ D
Sbjct: 202 ARLEIETLETVTGILLDDDD-RDEIDTLGGLVCAEAGRVPTRGEIVRHAKGLQFEVLEGD 260

Query: 304 VRCVRRVRIRRL 315
            R +  V+IR L
Sbjct: 261 PRRITLVKIRGL 272


>gi|284036359|ref|YP_003386289.1| transporter-associated region [Spirosoma linguale DSM 74]
 gi|283815652|gb|ADB37490.1| transporter-associated region [Spirosoma linguale DSM 74]
          Length = 427

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 130/268 (48%), Gaps = 23/268 (8%)

Query: 46  WKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDK 105
           + L  L+H+      + DA  E    E + +IFNN + FR +R+ D ++ R  I AV   
Sbjct: 177 FGLTDLNHYLQQLNQKADAEKE---VEVDTQIFNNAIEFRDVRVRDCLVPRTEITAVAVD 233

Query: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165
            TV E    F+  G S + VY++++D+  G  H          ++ K   +         
Sbjct: 234 DTVEELRQAFQGSGHSKIVVYRDTIDDVIGYCHAL-------ALFKKPATVE-------- 278

Query: 166 NLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH 225
            +I  I+ VP +M   DLL      R  +ALV+DE GGT G+VS ED+V  +  +I  E+
Sbjct: 279 EIITPIIVVPETMPAQDLLLRFLSERKSLALVVDEFGGTAGIVSVEDMVEQIFGEIQDEY 338

Query: 226 HSKKSMISAVSDNT-FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPA 284
            + +  +    D T +++ AR ++E+L K    D    +  Q  D+LGGLI +  + +P 
Sbjct: 339 DTNEDWVEQQLDETNWLLSARHEIEDLNKTY--DWTIPESPQ-YDTLGGLILATHEDVPQ 395

Query: 285 RGEVVLEIPGFEIVILDADVRCVRRVRI 312
            GEV+ E   F   I+  D   +  V++
Sbjct: 396 VGEVI-EFSPFTFTIVSMDGTRIDTVKV 422


>gi|150017059|ref|YP_001309313.1| hypothetical protein Cbei_2190 [Clostridium beijerinckii NCIMB
           8052]
 gi|149903524|gb|ABR34357.1| protein of unknown function DUF21 [Clostridium beijerinckii NCIMB
           8052]
          Length = 429

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 145/293 (49%), Gaps = 23/293 (7%)

Query: 30  SVPAFW--TRTIRALCKTWKLMKLSHHKG------IRLPRIDASLEGIFSETEKEIFNNI 81
           + P  W    T   + K + L ++  H+       I+L   ++   G+  +TE    +NI
Sbjct: 150 TYPIMWLFNHTTNFILKIFGLSQVDEHEAAHTDEEIKLLVEESYKHGLIDKTELTFVDNI 209

Query: 82  LRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRD 141
             F +  + +IMI R  +  +  + +  E +        +  PV  +S DN  G +H++D
Sbjct: 210 FDFSEKTVKEIMIPRTDMACIFLEGSFDEIIEYALAEQLTRYPVCTDSKDNISGFIHIKD 269

Query: 142 VISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEH 201
           +  Y   +    NNI         N+I+ I FVP SM +S+LL   ++ +I+MA+VIDE+
Sbjct: 270 L--YKLKIEGNDNNI--------KNIIREIKFVPESMSISELLKIFKKEKIQMAIVIDEY 319

Query: 202 GGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNC 261
           GGT GLV+ EDI+  ++ +I  E   +   I  + D  +IVD +  +E++ +++  +   
Sbjct: 320 GGTFGLVTIEDILEEIVGEIQDEFDEEMEEIKKIEDGKYIVDGKVHIEDINELVDAEIEV 379

Query: 262 LKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
               +++D++GG ++S L   P   + +      E VIL  D + + ++ I +
Sbjct: 380 ----ENIDTIGGWVYSQLKSYPQVNDKI-NYKECEFVILKCDSKRINKILIVK 427


>gi|238060557|ref|ZP_04605266.1| CBS domain-containing protein [Micromonospora sp. ATCC 39149]
 gi|237882368|gb|EEP71196.1| CBS domain-containing protein [Micromonospora sp. ATCC 39149]
          Length = 465

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 131/249 (52%), Gaps = 14/249 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+    E+++ +++         ++M+ R  +  +E++  + +A+ +F + G S +
Sbjct: 190 AEQRGVVEHGERQMIHSVFALGDTIAREVMVPRTEMVWIEERKNLSQALALFLRSGFSRI 249

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S+D+  G+++++D+I          +      +L  S+L++   FVP S  V DL
Sbjct: 250 PVIGESVDDVLGVLYLKDLIRRTQGGEPAAS------RLPVSDLMRPATFVPESKPVDDL 303

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L+ +Q +R  + +V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  +  ++D    V 
Sbjct: 304 LSEMQAARNHLVIVVDEYGGTGGLVTIEDILEEIVGEITDEYDVERPPVERLADGAVRVA 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +E L ++   +        +V+++GGL+   L R+P  G    E+ G  +V   A+
Sbjct: 364 ARLPVETLGELFDVELPA----DEVETVGGLLAQALGRVPIPGAEA-EVAGLRLV---AE 415

Query: 304 VRCVRRVRI 312
               RR RI
Sbjct: 416 GTTGRRNRI 424


>gi|306820881|ref|ZP_07454501.1| CBS-domain protein [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550995|gb|EFM38966.1| CBS-domain protein [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 432

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 135/255 (52%), Gaps = 22/255 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRS 121
           AS +G+F++ EKE+ N+I  F  I   DIMISR     ++    + E +  L+   Y R 
Sbjct: 180 ASEKGVFNDIEKEMINSIFSFDDITAKDIMISRKDTYKIDIDEPLNEYIDELLESYYTR- 238

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINL-NIQLSESNLIKNILFVPSSMLV 180
            +PVYK ++D+  G+++++D+I        +  N+   NI + +  LI+   FVP    +
Sbjct: 239 -IPVYKENIDDIIGILNIKDLI-------LEARNVGFENIDIEK--LIQKPYFVPEMKNI 288

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
            +L   +Q++R  MA+++DE+GG  G+V+ ED++  +M DI  EH  ++  I  +SDN +
Sbjct: 289 DELFKEMQKNRNHMAILVDEYGGFSGIVTIEDLIEQIMGDINDEHDDEEESIQKLSDNVY 348

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           +++  T++ E+ K +  +       ++ D++  L+   L  IP  GE     P   I  L
Sbjct: 349 LINGTTEIREVNKELDLELE----NENYDTISALVIENLGYIPEEGEK----PSVTIDNL 400

Query: 301 DADVRCVRRVRIRRL 315
              V  V   RI +L
Sbjct: 401 LFKVELVSDNRIEKL 415


>gi|254303917|ref|ZP_04971275.1| possible HCC HlyC/CorC family transporter [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148324109|gb|EDK89359.1| possible HCC HlyC/CorC family transporter [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 426

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 140/254 (55%), Gaps = 14/254 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEGAKTINEVWDEIVDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +++ I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDIPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFFKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELN---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 409

Query: 306 CVRRVRIRRLVHFK 319
            V +V IR L   K
Sbjct: 410 RVSKVFIRILEEVK 423


>gi|322379103|ref|ZP_08053505.1| Putative integral membrane protein with hemolysin domain
           [Helicobacter suis HS1]
 gi|321148475|gb|EFX42973.1| Putative integral membrane protein with hemolysin domain
           [Helicobacter suis HS1]
          Length = 435

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 133/250 (53%), Gaps = 19/250 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+EI  N + F      +IM  R  +  ++ + +  E M    K+  +  P  +
Sbjct: 199 GVIDYVEEEIIKNAVDFSDTSAKEIMTPRNDMVCLDVQHSYEENMRTILKHPFTRYPCCE 258

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
              DN  GMVH+RD++S +S    K  ++          ++K +L VP S  +S +L  +
Sbjct: 259 EHKDNILGMVHIRDILS-VSLADQKEPDLRC--------MLKEMLIVPESASISQILIKM 309

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            + +   ALV+DE+GGT GL++ +DI+  +M +I  EH   K  I  + ++TF  D   D
Sbjct: 310 NQQQRHTALVVDEYGGTSGLLTMDDIIEEIMGNIYEEHDLSKEGIKRLDEHTFECDGMVD 369

Query: 248 LEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVVLEIPG-FEIVILDADV 304
           LE++ +++G      + +Q+    +LGG +FS+L+R+P  G+VV +    FE  +LD D 
Sbjct: 370 LEDIEELLG-----FRFDQNYKQVTLGGYVFSLLERLPEVGDVVGDAKCIFE--VLDMDK 422

Query: 305 RCVRRVRIRR 314
             +R++++ +
Sbjct: 423 ARIRKLKLMK 432


>gi|167766284|ref|ZP_02438337.1| hypothetical protein CLOSS21_00788 [Clostridium sp. SS2/1]
 gi|167712003|gb|EDS22582.1| hypothetical protein CLOSS21_00788 [Clostridium sp. SS2/1]
 gi|291559084|emb|CBL37884.1| Hemolysins and related proteins containing CBS domains
           [butyrate-producing bacterium SSC/2]
          Length = 416

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 123/222 (55%), Gaps = 13/222 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E+EK++ NN+  F++    DIMI R+ +  V   A+  E + +F + G S +PVY
Sbjct: 178 EGVIEESEKDMLNNVFDFKESLAKDIMIPRIDVTFVSVDASYDEVLDIFREAGYSRLPVY 237

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S D+  G+V+ +DV  Y S    +  ++         ++++   F   +  VS LL  
Sbjct: 238 EGSKDHVVGIVYFKDVYFYRSQHRGEIFHLK--------DVLRKPFFTYETQKVSSLLAQ 289

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
           ++E  +  ++V+DE+G T GL++ EDIV  +  ++  E+  S++     +SD +++V A 
Sbjct: 290 MREKSVSFSIVLDEYGVTAGLITLEDIVEEIFGELRDEYDDSEEETFKKLSDGSYMVSAS 349

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
             L++L  ++  D +     +D DSLGG I  +LD +P+ GE
Sbjct: 350 LKLDDLDDLLDVDLDS----EDYDSLGGYIIELLDHLPSEGE 387


>gi|308183593|ref|YP_003927720.1| putative TlyC-like hemolysin; putative membrane protein
           [Helicobacter pylori PeCan4]
 gi|308065778|gb|ADO07670.1| putative TlyC-like hemolysin; putative membrane protein
           [Helicobacter pylori PeCan4]
          Length = 449

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKGHFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKI--IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE + ++  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEVLHIQFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|208435358|ref|YP_002267024.1| putative integral membrane protein with a TlyC-like hemolysin
           domain [Helicobacter pylori G27]
 gi|208433287|gb|ACI28158.1| putative integral membrane protein with a TlyC-like hemolysin
           domain [Helicobacter pylori G27]
          Length = 433

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 132/245 (53%), Gaps = 13/245 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 191 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKGHFTRYPYC 250

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 251 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 301

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 302 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 361

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 362 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIVS-HGYSFEVLSVDGAR 417

Query: 307 VRRVR 311
           ++R++
Sbjct: 418 IKRLK 422


>gi|218781456|ref|YP_002432774.1| hypothetical protein Dalk_3618 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762840|gb|ACL05306.1| protein of unknown function DUF21 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 412

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           + +NI RF  +   +IM  R +I +   + TV +        G S +P+Y+N  DN  G+
Sbjct: 187 MIHNIFRFSDLEAYEIMTDRTAIFSAPAEFTVEKVAKEVVLRGYSRIPIYENKRDNIVGI 246

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           ++ +D+++ +         I+   + +   L + ++FVP ++L+ DLL   Q+ R+ MA+
Sbjct: 247 LYAKDMLNAL---------ISGKEKAALKELARPVMFVPETILLDDLLKQFQKERVHMAM 297

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           V+DEHGG  GL++ ED++  ++ DI  E   ++ MI        +V  +T++EE+ +++ 
Sbjct: 298 VVDEHGGVGGLITIEDLLEEIVGDIVDETDKEQVMIHKTGKKKALVKGQTEVEEVNRVLH 357

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
              +     +D +++ G I S + +IP  GE  L I    I I  AD R +  V I ++
Sbjct: 358 LGISE---HEDFETISGFILSKMRKIPEPGE-ELNIGDIVIRITKADNRHIEEVEIEKV 412


>gi|297162261|gb|ADI11973.1| putative integral membrane protein [Streptomyces bingchenggensis
           BCW-1]
          Length = 445

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 131/260 (50%), Gaps = 22/260 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG       E+F   L  R++  +++M  RV + A++ +AT  +        G S  PVY
Sbjct: 195 EGALEADTAELFVRTLNLRELTAENVMTPRVQVIALDVRATTEDIANATRATGLSRFPVY 254

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + SLD   G  H++DV++  +            ++   S L++  LFVP+S+ V  +L  
Sbjct: 255 RGSLDTVVGTAHIKDVLAIPAEQ---------RLRHPVSELMREPLFVPASLTVDRVLDR 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSM--ISAVSDNTFIV 242
           +   R  MA+VIDE+GGT G+V+ EDIV  ++ ++  EH  H K  +  + A ++   + 
Sbjct: 306 LSGER-SMAVVIDEYGGTAGVVTLEDIVEEVVGEVRDEHDPHEKPDLAPVGAGAEGRMLY 364

Query: 243 DA--RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           DA     +++LA +         G    ++L GL+ + L RIP RG+  LE+ G+ I ++
Sbjct: 365 DADGAARVDQLAAV---GMRVPHGPY--ETLAGLVATELGRIPVRGD-ALEVAGWGIEVV 418

Query: 301 DADVRCVRRVRIRRLVHFKN 320
           D       RVR+R  + +  
Sbjct: 419 DDSGHRAARVRLRAPLPYAG 438


>gi|262195778|ref|YP_003266987.1| hypothetical protein Hoch_2560 [Haliangium ochraceum DSM 14365]
 gi|262079125|gb|ACY15094.1| protein of unknown function DUF21 [Haliangium ochraceum DSM 14365]
          Length = 420

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 124/245 (50%), Gaps = 12/245 (4%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            ++ E+++  N+L   +    D+M+    + A+ +   + +A L       S MPVY+  
Sbjct: 184 ITQEERQMIANVLELSQAGAVDVMVPLSEVTALPESTPLADAALEVADKQHSRMPVYEGR 243

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +DN  G+VH+ D++   +   A T  +        + + +   FVP +M   DLL  +Q+
Sbjct: 244 VDNVIGVVHVFDLLQASTESAAGTRTV--------AEVARPATFVPETMPAGDLLVELQK 295

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           +   MA+V+DE+GG  G+V+ ED++  ++ +I  EH    ++I       + V ART +E
Sbjct: 296 TGRHMAIVVDEYGGAVGIVTVEDLLEEVVGEIDDEHDRPPALIRPERPGVWWVAARTPVE 355

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
            L + +      L   +D +++ GL+     RIP +GE ++ I    I +L+A  R V  
Sbjct: 356 RLNEELSL---SLPESEDYETVAGLLLDHFKRIPEQGESMV-IEQVTIRVLEASERAVEA 411

Query: 310 VRIRR 314
           V+I R
Sbjct: 412 VQILR 416


>gi|167748927|ref|ZP_02421054.1| hypothetical protein ANACAC_03708 [Anaerostipes caccae DSM 14662]
 gi|167651549|gb|EDR95678.1| hypothetical protein ANACAC_03708 [Anaerostipes caccae DSM 14662]
          Length = 382

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 122/228 (53%), Gaps = 14/228 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +DAS E G+  + EKE+  N+  F+     DIMI R+ I  V   A+  E M +F     
Sbjct: 136 VDASHEDGVIEKDEKEMIYNVFDFKDSIAKDIMIPRIDITFVSADASYDEVMELFMATQY 195

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S +PVY+ + D   G+V+++D+  Y +    +  +I         ++++   F   +  +
Sbjct: 196 SRLPVYEETKDKVIGIVYLKDIYFYRTLHRGEIFHIR--------DVLRKPFFTYETQKI 247

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNT 239
           S LL  +Q+  +  ++V+DE+G T GL++ EDI+  L+ +I  E+   +S     + D +
Sbjct: 248 SSLLAQMQQENVSFSIVLDEYGITAGLITLEDILEELVGEIRDEYDDNESESFQELEDGS 307

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           ++V+A   L++L  +I T+       +D DS+GG +  +LD +P+ GE
Sbjct: 308 YLVNASLKLDDLNDLIDTEIES----EDYDSVGGYVIELLDHLPSEGE 351


>gi|317179667|dbj|BAJ57455.1| hypothetical protein HPF30_1358 [Helicobacter pylori F30]
          Length = 441

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 199 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 258

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    + ++           +++ ++ VP S  +S +L  
Sbjct: 259 KGSKDNIIGMVHIRDLLSR-SIFTPEMHDFK--------QIVRKMIIVPESASISQILIK 309

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 310 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 369

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 370 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDIIIS-HGYAFEVLSVDGAR 425

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 426 IKRLKASK 433


>gi|257458355|ref|ZP_05623503.1| hemolysin C [Treponema vincentii ATCC 35580]
 gi|257444290|gb|EEV19385.1| hemolysin C [Treponema vincentii ATCC 35580]
          Length = 257

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 127/247 (51%), Gaps = 15/247 (6%)

Query: 66  LEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPV 125
           L+   +E ++++   ++      + ++MI R+ ++ +         +    + G S  PV
Sbjct: 17  LQDSLNEEKEDMIRGVVDLSDTSVKEVMIPRIDVDFIPLDMETEALLKRVAESGHSRFPV 76

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y  S+DN  G+++++D+I+     +AK   I+L        +I+   FVP S  +  LL 
Sbjct: 77  YAESIDNVVGILYVKDLINS----FAKNEPIDL------EKIIRKPFFVPESKRIDGLLR 126

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
             +   + +A+ +DE+GG  G+V  EDI+  ++ DI  E  ++   I+++ D  ++ DAR
Sbjct: 127 EFKRRHVHIAIAVDEYGGISGIVCMEDIIEEIVGDIQDEFDNEGEDIASIGDGLWLCDAR 186

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            D+++LA+ + TD        + ++LGG +F +  +IP R E V     F+ ++ D D  
Sbjct: 187 VDMDDLAECLHTDLPS----DEFETLGGFVFDLFGKIPVRYEKV-RWKNFDFIVQDMDGH 241

Query: 306 CVRRVRI 312
            +  V+I
Sbjct: 242 KINTVKI 248


>gi|149280554|ref|ZP_01886670.1| hypothetical protein PBAL39_05668 [Pedobacter sp. BAL39]
 gi|149228669|gb|EDM34072.1| hypothetical protein PBAL39_05668 [Pedobacter sp. BAL39]
          Length = 438

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 131/249 (52%), Gaps = 14/249 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E E+  N+  F +  + +IM+ R  I+ +E      E + M    G S +PVY 
Sbjct: 195 GALDTNEHELIRNVFDFNERVVKNIMVPRTKISGIELSTPTEEVIAMIIGEGYSRLPVYD 254

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           + +D   G++H +DV+  ++             + +  ++I+   FVP +  ++DLL+ +
Sbjct: 255 DIIDKIIGIIHAKDVLPLLAE----------KKEWTLKDIIRKPYFVPETKKINDLLSEL 304

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q+ RI++A+VIDE GGT G+V+ EDIV  ++ +I  E+  +K  +  +SD  FI++A   
Sbjct: 305 QQKRIQIAIVIDEFGGTAGMVTLEDIVEEIVGEIQDEYDEEKPTVEKISDTEFIINAYAT 364

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + ++ + +  D   L  ++D D++GGL+     +IP  G+   E  G+   IL    + +
Sbjct: 365 VYDVNEHLPHD---LPEDEDFDTVGGLVSHAFGKIPEVGDSE-ECYGYLFTILKKTEQNI 420

Query: 308 RRVRIRRLV 316
             +++  ++
Sbjct: 421 ETIKLELVI 429


>gi|317496975|ref|ZP_07955305.1| hypothetical protein HMPREF0996_00284 [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895987|gb|EFV18139.1| hypothetical protein HMPREF0996_00284 [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 416

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 123/222 (55%), Gaps = 13/222 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E+EK++ NN+  F++    DIMI R+ +  V   A+  E + +F + G S +PVY
Sbjct: 178 EGVIEESEKDMLNNVFDFKESLAKDIMIPRIDVTFVSVDASYDEVLDIFREAGYSRLPVY 237

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + S D+  G+V+ +DV  Y S    +  ++         ++++   F   +  VS LL  
Sbjct: 238 EGSKDHIVGIVYFKDVYFYRSQHRGEIFHLK--------DVLRKPFFTYETQKVSSLLAQ 289

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
           ++E  +  ++V+DE+G T GL++ EDIV  +  ++  E+  S++     +SD +++V A 
Sbjct: 290 MREKSVSFSIVLDEYGVTAGLITLEDIVEEIFGELRDEYDDSEEETFKKLSDGSYMVSAS 349

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
             L++L  ++  D +     +D DSLGG I  +LD +P+ GE
Sbjct: 350 LKLDDLDDLLDVDLDS----EDYDSLGGYIIELLDHLPSEGE 387


>gi|299142701|ref|ZP_07035831.1| CBS domain protein [Prevotella oris C735]
 gi|298575916|gb|EFI47792.1| CBS domain protein [Prevotella oris C735]
          Length = 415

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 131/248 (52%), Gaps = 14/248 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      ++M SR  I  ++ +++  E +        S +P+Y+++ DN 
Sbjct: 181 EQSMLQGIIRFGDETAKEVMTSRQDIVNLDIRSSFTEVLKCVIDNNYSRIPIYQDNTDNI 240

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S   A              +LI+   FVP +  + DLL   QE+++ 
Sbjct: 241 RGILYIKDLLPHLSKSAA----------FRWQSLIRAPYFVPETKKIDDLLREFQENKVH 290

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT GL++ EDI+  ++ +I  E+  ++   S ++ N ++   +  L +  K
Sbjct: 291 IAIVVDEYGGTSGLITLEDILEEIVGEINDEYDEEEKFYSKLNYNIYVFKGKVLLTDFCK 350

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +     E D DSL GL+  +    P+  E + E   F   IL  + R + +V++
Sbjct: 351 ILNIDDDEFADVEGDADSLAGLLLELKGDFPSAHEKI-EFKNFTFEILSIEERRITKVKV 409

Query: 313 RRLVHFKN 320
             +VH K+
Sbjct: 410 --IVHPKS 415


>gi|163753440|ref|ZP_02160564.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Kordia algicida OT-1]
 gi|161327172|gb|EDP98497.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Kordia algicida OT-1]
          Length = 434

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 113/217 (52%), Gaps = 17/217 (7%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E++I   I+ F       +M  R+ + A+++       +    K G S +PVYK SL
Sbjct: 199 TKEEQKILQGIVSFGNTDTKQVMQPRMDVFALKEDMKFEVVLSEITKKGYSRIPVYKESL 258

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D   G+++++D+I +I                + + L++N  FVP +  + DLL   Q+ 
Sbjct: 259 DEISGILYVKDLIPHIDKK-----------SFAWTTLLRNAYFVPENKKLDDLLREFQDK 307

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +I +A+V+DE+GGT GLVS ED++  ++ DI+ E   +    S + D  ++ + +T+L++
Sbjct: 308 KIHLAIVVDEYGGTSGLVSLEDVIEEIVGDISDEFDDEDVHYSKIDDRNYVFEGKTNLKD 367

Query: 251 LAKIIGTDCN----CLKGEQDVDSLGGLIFSVLDRIP 283
             KIIG + N      KGE   +++ G +  +    P
Sbjct: 368 FYKIIGVEDNSEFEAHKGES--ETIAGFVLEIFRGFP 402


>gi|311895961|dbj|BAJ28369.1| putative transporter [Kitasatospora setae KM-6054]
          Length = 442

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 140/254 (55%), Gaps = 19/254 (7%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  + E+ + +++       + ++M+ R  +  +E   TV + + +  + G S +PV  +
Sbjct: 183 LIEDEERRMVHSVFELGDTIVREVMVPRTDLVMIERHKTVRQTLTLALRSGFSRIPVVGD 242

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSDLLTNI 187
           + D+  G+V+++D++        +  +IN + +  +  ++++  +FVP S   +DLL  +
Sbjct: 243 NEDDVVGIVYLKDLV--------RRTHINRDAESEQVDSVMRPAVFVPDSKPAADLLREM 294

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q+ R  +A+VIDE+GGT GLV+ EDI+  ++ +IT E+  + + +  + D ++ + AR  
Sbjct: 295 QQMRSHVAIVIDEYGGTAGLVTIEDILEEIVGEITDEYDREIAPVEDLGDGSYRITARLT 354

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP-----GFEIVILDA 302
           +E+L ++ G + +    ++DV+++GGL+   L R+P  G    E+P     G   + L A
Sbjct: 355 VEDLGELFGIELD----DEDVETVGGLLAKCLGRVPIPGSSC-EVPVPEGSGLAAISLTA 409

Query: 303 DVRCVRRVRIRRLV 316
           +    RR RI  +V
Sbjct: 410 ESSAGRRNRIGTVV 423


>gi|117927999|ref|YP_872550.1| CBS domain-containing protein [Acidothermus cellulolyticus 11B]
 gi|117648462|gb|ABK52564.1| CBS domain containing protein [Acidothermus cellulolyticus 11B]
          Length = 483

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 135/249 (54%), Gaps = 11/249 (4%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +    E+++ +++       + ++M+ R  I  +E   T+ +AM +  + G S +PV   
Sbjct: 181 VIEHGERQMIHSVFELGDTLVREVMVPRTDIVFIEKTKTLRQAMSLALRSGFSRIPVVGE 240

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           + D+  G+V++RD+   I + Y +   +         ++++  +FVP S  + +LL  +Q
Sbjct: 241 NEDDVVGIVYLRDLAKRI-YEYREAETLE-----RVESIMRPPVFVPDSKPIDELLREMQ 294

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
            +R  +A+V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  +  + D T  V AR  +
Sbjct: 295 AARNHVAIVVDEYGGTAGLVTIEDILEEIVGEITDEYDLERPRVEPLEDGTVRVTARLSI 354

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR--C 306
           +EL ++ G   +  + + +V+++GGL+  VL R+P  G     + G E++   A  R   
Sbjct: 355 DELEELFGVQID--RTDHEVETVGGLLAQVLGRVPIPGARA-AVAGLELIAEGAAGRRNK 411

Query: 307 VRRVRIRRL 315
           +  V +RRL
Sbjct: 412 IATVLVRRL 420


>gi|186684590|ref|YP_001867786.1| hypothetical protein Npun_R4476 [Nostoc punctiforme PCC 73102]
 gi|186467042|gb|ACC82843.1| protein of unknown function DUF21 [Nostoc punctiforme PCC 73102]
          Length = 465

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 113/215 (52%), Gaps = 10/215 (4%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
            E+E+ NN+  F  +   D+MI R SI  +   AT    +      G S  PV   SLD+
Sbjct: 226 AERELLNNVFEFGDVMAQDVMIPRTSIIVLPKDATFQTLLKEMAATGYSRYPVIGESLDD 285

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            RG+V+ +D+   ++        ++L  Q+     ++   FVP    +S+LL  +Q+ + 
Sbjct: 286 VRGIVYFKDLAQPLA-----VGKLSLETQIQP--WMRPARFVPEHTPLSELLPMMQQEKP 338

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            M +V++E GGT GLV+ +D+++ ++ D +    S   +I  + +  F+V A+ +LE+L 
Sbjct: 339 AMVMVVNEFGGTVGLVTIKDVIAEIIGDASEPESSDDLLIQMLDEQKFLVQAQINLEDLN 398

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +++  +    +   +  +LGG +   L +IPA+GE
Sbjct: 399 EVLHLNLPLTR---EYQTLGGFLLYQLQKIPAKGE 430


>gi|315585877|gb|ADU40258.1| CBS domain protein [Helicobacter pylori 35A]
          Length = 449

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 133/248 (53%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIIS-HGYLFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|217031835|ref|ZP_03437338.1| hypothetical protein HPB128_199g43 [Helicobacter pylori B128]
 gi|298735540|ref|YP_003728061.1| hypothetical protein HPB8_40 [Helicobacter pylori B8]
 gi|216946487|gb|EEC25089.1| hypothetical protein HPB128_199g43 [Helicobacter pylori B128]
 gi|298354725|emb|CBI65597.1| conserved hypothetical protein [Helicobacter pylori B8]
          Length = 449

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 131/247 (53%), Gaps = 17/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  I+ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGINKLEEGVFELEGML 377

Query: 247 DLE--ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           DLE  E A  I  D  C   EQ   +LGG +FS+L+R+P  G+ ++   G+   +L  D 
Sbjct: 378 DLESVEEALHIEFDKEC---EQ--VTLGGYVFSLLERMPMEGDTIVS-HGYAFEVLSVDG 431

Query: 305 RCVRRVR 311
             ++R++
Sbjct: 432 ARIKRLK 438


>gi|108763307|ref|YP_629558.1| CBS/transporter associated domain-containing protein [Myxococcus
           xanthus DK 1622]
 gi|108467187|gb|ABF92372.1| CBS/transporter associated domain protein [Myxococcus xanthus DK
           1622]
          Length = 455

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 126/244 (51%), Gaps = 15/244 (6%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++  ++  +I      R  D+M+ R  +  V+   T  E + +  +   S +PVY++ +D
Sbjct: 196 KSAPQLIRSIFELSDKRCRDVMVPRTEVVTVDVTITPDELLRLLAEENHSRIPVYRDDVD 255

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G++H RD+I  + H       I L       ++I+   FVP    + DLL ++Q+ +
Sbjct: 256 HVIGVLHARDIIPLLQH----PELIVLQ------DIIRPAHFVPWMKPIGDLLRDMQKQK 305

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
           I MA+V+DE+GG  G+V+ EDI+  ++ DI  E   ++  +  ++D +F+VDA  +++  
Sbjct: 306 IHMAIVVDEYGGFMGVVTLEDILREIVGDIGDEFEVEEKQVEKLADGSFLVDAALEVDAF 365

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +  G        E D D+LGG + S+   +P  GE      G++ V+   +   + RVR
Sbjct: 366 TQTFGFPLP----EGDFDTLGGFLSSMAGHLPDVGE-RFAYSGWQFVVASKEGPRIDRVR 420

Query: 312 IRRL 315
           + R+
Sbjct: 421 MSRV 424


>gi|239932632|ref|ZP_04689585.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291440991|ref|ZP_06580381.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291343886|gb|EFE70842.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 471

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG       E+F   L    +  +++M  RV + A+E  AT  +   +    G S  PVY
Sbjct: 195 EGALEPDTAELFVRTLNLADLTAENVMTPRVQVIALEAGATCEDVANVTRATGLSRFPVY 254

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + +LD+  G  H++DV++  S   A+       + +SE  +++  L VP S+ V  LL  
Sbjct: 255 RGTLDSVVGTAHVKDVLAVPSERRAR-------VPVSE--MMREPLLVPESLTVDRLLDR 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNT----F 240
           + E R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH  H    ++   +D      F
Sbjct: 306 LSERRT-MAVVIDEYGGTAGVATLEDIVEEVVGEVRDEHDPHETPDLVRTGTDEEGRALF 364

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
             D    +++LA++          E   ++L GL+ + L RIPA G+ +L++ G+ + +L
Sbjct: 365 SADGSARVDQLAQV-----GLRVPEGPYETLAGLVATALGRIPAAGD-ILQVAGWRLEVL 418

Query: 301 DADVRCVRRV 310
           ++      RV
Sbjct: 419 ESTGHRAARV 428


>gi|256419981|ref|YP_003120634.1| CBS domain containing protein [Chitinophaga pinensis DSM 2588]
 gi|256034889|gb|ACU58433.1| CBS domain containing protein [Chitinophaga pinensis DSM 2588]
          Length = 464

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 122/233 (52%), Gaps = 19/233 (8%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVE--DKATVYEAMLMFEKYG 119
           I+ S++   S+ EK I   IL+F  I +  IM +R+ ++ +E  D   +    +    Y 
Sbjct: 214 IEMSVDPTASQEEKNILKGILKFGNITVKQIMHTRLDVSGIEYDDNFDIVVKRVADLHYS 273

Query: 120 RSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSML 179
           R  +PVYK +LDN  G++H +D++ ++     K  + + +       +++   FV    L
Sbjct: 274 R--LPVYKGNLDNIVGVIHTKDLLPHLD----KGKSFDWH------TVMRQPFFVHGHKL 321

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
           + DLL   Q  R+  A+V+DE GGT G+V+ EDIV  ++ DI  E   ++   S V +NT
Sbjct: 322 IEDLLAEFQNRRMHFAVVVDEFGGTSGIVTLEDIVEEVIGDIKDEFDEEEFNYSKVDNNT 381

Query: 240 FIVDARTDLEELAKIIGTDCNCL---KGEQDVDSLGGLIFSVLDRIPARGEVV 289
           ++ + +T L ++ +I+    +     KGE   DS+GGLI  +  + P    V+
Sbjct: 382 YVFEGKTMLNDVCRIMNVPPDTFEVVKGES--DSIGGLILELAGKFPEENSVI 432


>gi|188528261|ref|YP_001910948.1| hypothetical protein HPSH_07635 [Helicobacter pylori Shi470]
 gi|188144501|gb|ACD48918.1| hypothetical protein HPSH_07635 [Helicobacter pylori Shi470]
 gi|308064250|gb|ADO06137.1| hypothetical protein HPSAT_07175 [Helicobacter pylori Sat464]
          Length = 449

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH++D++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIKDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDIIIS-HGYLFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|15894701|ref|NP_348050.1| hypothetical protein CA_C1422 [Clostridium acetobutylicum ATCC 824]
 gi|15024362|gb|AAK79390.1|AE007653_11 Uncharacterized CBS domain-containing protein, YUGS B.subtilis
           ortholog [Clostridium acetobutylicum ATCC 824]
 gi|325508839|gb|ADZ20475.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 428

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 139/261 (53%), Gaps = 19/261 (7%)

Query: 57  IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINA--VEDKATVYEAMLM 114
           IR+   ++   G+  +TE    +N+  F +  + +IM+ R  +    VED       + +
Sbjct: 185 IRMLVEESYKHGLIDKTELTFVDNVFDFSEKTVKEIMVPRTDMKCIFVEDSFDDIVGVTI 244

Query: 115 FEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFV 174
            E + R   PV + S DN  G++H++D+         K N  +  I+    ++I+ I FV
Sbjct: 245 DEHFTR--YPVCEESKDNIIGLIHIKDLYK------LKINKEDEKIE----SIIREIKFV 292

Query: 175 PSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISA 234
           P SM +S+L    Q+ R++MA+VIDE+GGT GLV+ EDI+  ++ +I  E   +   I  
Sbjct: 293 PESMSISELFRMFQKERMQMAIVIDEYGGTFGLVTIEDILEEIVGEIQDEFDEEMEEIIK 352

Query: 235 VSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPG 294
             + +++VD +  +E++ +++  +      E+++D++GG I+S L + P   E +     
Sbjct: 353 TENGSYVVDGKVLIEDINELLDIEIY----EENIDTIGGWIYSKLKKYPKTNEKI-NYGN 407

Query: 295 FEIVILDADVRCVRRVRIRRL 315
           ++ +IL  D R + ++ I+ L
Sbjct: 408 YQFIILKCDRRRIEKILIKNL 428


>gi|225010081|ref|ZP_03700553.1| CBS domain containing protein [Flavobacteria bacterium MS024-3C]
 gi|225005560|gb|EEG43510.1| CBS domain containing protein [Flavobacteria bacterium MS024-3C]
          Length = 409

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 120/224 (53%), Gaps = 20/224 (8%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F  ++  D+M+ R  + AVE   +    + +F + G S + VYK+++D
Sbjct: 182 DSEIQIFQNALEFSAVKARDVMVPRTDLCAVEIHESPKNLVKIFTETGFSKLLVYKDTID 241

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           N  G VH     SY   ++ K   I         +++  I +VP +ML++D+L  + + R
Sbjct: 242 NIIGYVH-----SY--ELFKKPQTIK--------SMLLPIEYVPETMLINDILNVLTKKR 286

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             +A+V+DE+GGT G+V+ EDIV  L  +I  EH S   +   +S+NT+   AR +++ L
Sbjct: 287 KSIAIVLDEYGGTSGMVTVEDIVEELFGEIEDEHDSTDLIEEQLSENTYKFSARLEVDYL 346

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGF 295
            +    D   L+   +  +LGGLI  V   IP   E +  I GF
Sbjct: 347 NETYHLD---LEERDEYGTLGGLIVHVTGEIPTLNESI--IIGF 385


>gi|317178195|dbj|BAJ55984.1| hypothetical protein HPF16_1387 [Helicobacter pylori F16]
          Length = 449

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 133/248 (53%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K +++          +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDLK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ +    G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPVEGDTITS-HGYLFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|332296320|ref|YP_004438243.1| protein of unknown function DUF21 [Thermodesulfobium narugense DSM
           14796]
 gi|332179423|gb|AEE15112.1| protein of unknown function DUF21 [Thermodesulfobium narugense DSM
           14796]
          Length = 434

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 126/239 (52%), Gaps = 14/239 (5%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVH 138
           + +  F+   + +IM+ R+ +  ++   T+ E + +    G S  PVY   +DN  G+++
Sbjct: 197 SGVFEFKDKVVREIMVPRIDMVCIKKGTTLSETLEIIRNEGHSRYPVYDKDIDNIVGILY 256

Query: 139 MRDVISYI--SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           ++D++  +  S  Y+K+ + +L          +   FVP    +S+L   +Q  R+ MA+
Sbjct: 257 VKDILMNLGPSTDYSKSIDSSL----------REAYFVPEGKNISELFRELQAKRLYMAI 306

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAKII 255
           VIDE GGT GL++ ED+V  ++ +I  E+   +++++   ++N+FI + R  L E A  +
Sbjct: 307 VIDEFGGTAGLLTVEDLVEEIVGEIRDEYDFDEEALVKDFNENSFIANGRLSLREFAAKV 366

Query: 256 GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             D        + ++L GL+F++  +IP  G+ +    G E  IL  D R +R V + +
Sbjct: 367 ELDFEDFIDGYNEETLAGLLFALFGKIPKEGDKI-SFKGIEFKILKVDGRRIRDVLVTK 424


>gi|317181173|dbj|BAJ58959.1| hypothetical protein HPF32_1377 [Helicobacter pylori F32]
          Length = 468

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 226 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 285

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 286 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 336

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 337 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 396

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G++++   G+   +L  D   
Sbjct: 397 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDMIIS-HGYLFEVLSVDGAR 452

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 453 IKRLKASK 460


>gi|53712849|ref|YP_098841.1| hemolysin-related protein [Bacteroides fragilis YCH46]
 gi|52215714|dbj|BAD48307.1| hemolysin-related protein [Bacteroides fragilis YCH46]
          Length = 350

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +        S +P+Y  + DN 
Sbjct: 110 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNI 169

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 170 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 219

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 220 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 279

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 280 ITKVDEDDFDKVDGDADTLAGLLLEIKGEFPALHEKVL-YHRYEFEVLAMDSRRILKVKF 338


>gi|317182695|dbj|BAJ60479.1| hypothetical protein HPF57_1405 [Helicobacter pylori F57]
          Length = 449

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 132/248 (53%), Gaps = 13/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K S DN  GMVH+RD++S  S    K ++           +++ ++ VP S  +S +L  
Sbjct: 267 KGSKDNIIGMVHIRDLLSR-SIFTPKMHDFK--------QIVRKMIIVPESASISQILIK 317

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++   
Sbjct: 318 MKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELEGML 377

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ +    G+   +L  D   
Sbjct: 378 DLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTITS-HGYAFEVLSVDGAR 433

Query: 307 VRRVRIRR 314
           ++R++  +
Sbjct: 434 IKRLKASK 441


>gi|307718664|ref|YP_003874196.1| hypothetical protein STHERM_c09770 [Spirochaeta thermophila DSM
           6192]
 gi|306532389|gb|ADN01923.1| hypothetical protein STHERM_c09770 [Spirochaeta thermophila DSM
           6192]
          Length = 237

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 122/224 (54%), Gaps = 15/224 (6%)

Query: 89  IDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISH 148
           + ++M+ R+ +  V+ ++ + E +      G S +P Y+ ++DN  G+++++D++     
Sbjct: 13  VKEVMVPRIDVVFVDIESPLEELLERVADSGHSRLPAYEKTIDNVVGILYVKDLLK---- 68

Query: 149 MYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLV 208
           +  K   I +        L++   F+P S  + DLL  ++  R+ +A+V+DE+GG  G+V
Sbjct: 69  LLVKNQPIEIG------KLVRPAYFIPESKRLDDLLREMKRRRVHIAIVVDEYGGVSGIV 122

Query: 209 SYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDV 268
             EDI+  ++ DI  E  +++  +  + + TF+ DAR  LEEL  I+G +        + 
Sbjct: 123 CLEDIIEEIVGDIQDEFDNEEEEVVQLDERTFLCDARILLEELGDILGIELES----PET 178

Query: 269 DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           D+LGG +F +L +IP   E V+     E ++ D +   +++V++
Sbjct: 179 DTLGGFVFELLGKIPVCYERVI-YNDIEFIVQDLEGHKIKKVKV 221


>gi|300113054|ref|YP_003759629.1| CBS domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299538991|gb|ADJ27308.1| CBS domain containing protein [Nitrosococcus watsonii C-113]
          Length = 291

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 121/219 (55%), Gaps = 14/219 (6%)

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           ++++ DIM+ R  +  VE  A   + + +  +   S  PV   S D   G++  +D++ Y
Sbjct: 62  EMQVRDIMVPRSQMVVVERDAPPEDTLEVITRSAHSRFPVIGESRDGIVGILLAKDMLLY 121

Query: 146 ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTD 205
                A+T NI         ++++ ++F+P S  ++ LL   + SR  MA+V+DE+GGT 
Sbjct: 122 CRQREARTFNIR--------DILRPVVFIPESKRLNVLLREFRASRNHMAIVVDEYGGTA 173

Query: 206 GLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           GLV+ ED++  ++ +I  EH  ++ + I    ++ + V A T +E+  +  GTD +    
Sbjct: 174 GLVTIEDVLEQIVGEIEDEHDVAEDAFIFRRREDNYTVKALTPIEDFNEYFGTDFS---- 229

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           +++ D++GGL+ +   R+P RGE ++ I  FE  +L AD
Sbjct: 230 DEEFDTIGGLVLNGFGRMPERGETIV-IGSFEFKVLRAD 267


>gi|237739497|ref|ZP_04569978.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 2_1_31]
 gi|229423105|gb|EEO38152.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 2_1_31]
          Length = 427

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 142/250 (56%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ ++E + T+ E      + G S +PVY
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMFSLEGEKTINEIWDEITENGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ ++     K N +++ I+      +++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHV-----KNNELDIPIK----QFVRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 294 FRTLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSFFKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKELELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V I+ L
Sbjct: 410 RVSKVFIKIL 419


>gi|237743931|ref|ZP_04574412.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 7_1]
 gi|229432962|gb|EEO43174.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 7_1]
          Length = 426

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 138/248 (55%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETNAKEVMTPRTSMLAFEGTKTINEVWDEIIDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N ++L I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDLPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSYYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIR 313
            V +V IR
Sbjct: 410 RVSKVFIR 417


>gi|149177589|ref|ZP_01856191.1| hemolysin protein [Planctomyces maris DSM 8797]
 gi|148843569|gb|EDL57930.1| hemolysin protein [Planctomyces maris DSM 8797]
          Length = 436

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 147/300 (49%), Gaps = 27/300 (9%)

Query: 31  VPAFWTRTIRALCKTWKLMKLSH-------HKGIRLPRI---------DASLEGIFSETE 74
           +P F +  I  LC  WK+ + SH       +K  R   I         + +  GI     
Sbjct: 134 LPVFLSPVI-WLC--WKIDEFSHRLAGKEDNKNGREANISEEILSVVEEGARGGILESEA 190

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
            ++   ++  +   +  IM  R+ +  +   AT+ EA+L F   G S +PV   S D+  
Sbjct: 191 GKMIQRVMELQDEDVGAIMTQRMDMEYISVNATLDEALLKFIDVGHSRIPVIGESTDDIV 250

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+++ R+++    H   +  N     +L+   L+ +  ++P +  +  LL  +Q+  + M
Sbjct: 251 GILYARELLK---HFSKENQNSESPEELTIQKLMFSPFYIPETTGIDSLLETMQKEHVHM 307

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTDLEELAK 253
           A+VIDE+GG  GLV+ ED++  ++ DI  E    ++ MI     NT  VDAR  +++L +
Sbjct: 308 AIVIDEYGGVAGLVTMEDVLEEIVGDIVDEFDEEEEQMIFETGQNTLEVDARVHIDDLNE 367

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
               + N  +G +D D++GG + + + ++P  GE  L      I +L++D R + ++RI 
Sbjct: 368 --QYNYNLPEG-KDFDTIGGFVITQIGKVPQPGE-TLTWQQLRIEVLESDERRINKLRIE 423


>gi|254230582|ref|ZP_04923946.1| CBS domain pair protein [Vibrio sp. Ex25]
 gi|262394983|ref|YP_003286837.1| magnesium and cobalt efflux protein CorC [Vibrio sp. Ex25]
 gi|269965466|ref|ZP_06179585.1| hemolysin, putative [Vibrio alginolyticus 40B]
 gi|151936898|gb|EDN55792.1| CBS domain pair protein [Vibrio sp. Ex25]
 gi|262338577|gb|ACY52372.1| magnesium and cobalt efflux protein CorC [Vibrio sp. Ex25]
 gi|269829945|gb|EEZ84175.1| hemolysin, putative [Vibrio alginolyticus 40B]
          Length = 299

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 156/313 (49%), Gaps = 29/313 (9%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           M  D   +S+E  KEK EG          S  +F+ R    L + ++       + + + 
Sbjct: 1   MNEDNSPSSNEDKKEKAEG---------PSRKSFFER----LGQLFQGEPKDRQELVDVI 47

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           R D+ +  +     +++   ++   ++R+ DIMI R  +  VE    +   + +      
Sbjct: 48  R-DSEVNDLIDHDTRDMLEGVMEISEMRVRDIMIPRSQMVTVERTHDLDTLVALITDAQH 106

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S  PV     D+  G++  +D++ Y+    + +N  ++        +I+  + VP S  V
Sbjct: 107 SRYPVISEDKDHVEGILLAKDLLKYLG---SGSNPFDI------EEVIRPAVVVPESKRV 157

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNT 239
             LL   +E R  MA+V+DE GG  GLV+ EDI+  ++ DI  E   S+++ I  +S +T
Sbjct: 158 DRLLKEFREERYHMAIVVDEFGGVSGLVTIEDILEEIVGDIEDEFDESEETDIRKLSKHT 217

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F V A T +EE  +  GT+ +    +++VD++GG++ +    +P+RGE+V EI G+   +
Sbjct: 218 FAVRALTTIEEFNETFGTNFS----DEEVDTVGGMVMTAFGHLPSRGELV-EIEGYNFKV 272

Query: 300 LDADVRCVRRVRI 312
             AD R V ++++
Sbjct: 273 TAADNRRVIQLQV 285


>gi|326203235|ref|ZP_08193100.1| protein of unknown function DUF21 [Clostridium papyrosolvens DSM
           2782]
 gi|325986493|gb|EGD47324.1| protein of unknown function DUF21 [Clostridium papyrosolvens DSM
           2782]
          Length = 434

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 116/216 (53%), Gaps = 13/216 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  ++EKE+ +NI  F    + +IM  R  I+ +   + +   + +  +   + +PVY 
Sbjct: 196 GVIQDSEKEMIDNIFEFDNKHVSEIMTHRTDIDGIPVDSDLEYVLYVMNRDKYTRVPVYS 255

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            +LDN  G++H++D++ Y        NN       S   + ++  FVP S    +L   +
Sbjct: 256 ENLDNIVGILHVKDLLEYTQ------NNAK---DFSLEKITRSAYFVPESKRTDELFKEM 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q++++ +A+VIDE+GGT G+V+ ED++  ++ +I  E+  ++  I  + ++T++ D    
Sbjct: 307 QKNKVHLAVVIDEYGGTAGIVTIEDLLEEIVGNIFDEYDIEQKDIEYLENDTYVFDGAIS 366

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIP 283
           L+ + +++  +        D D+LGG I  +L RIP
Sbjct: 367 LDRVEEVLDEELPV----DDFDTLGGFILKLLGRIP 398


>gi|297160577|gb|ADI10289.1| transport protein [Streptomyces bingchenggensis BCW-1]
          Length = 438

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 126/227 (55%), Gaps = 19/227 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + A+E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEDEERRMVHSVFELGDTLVREVMVPRTDLVAIERFKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D+        A+  +IN   + +ES L+   +    FVP +  
Sbjct: 235 PVTGENEDDIVGIVYLKDL--------ARKTHIN---REAESELVSTAMRPATFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+V+DE+GGT G+V+ EDI+  ++ +IT E+  +   I  + D +
Sbjct: 284 AGDLLREMQQERNHVAVVVDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPIQDLGDGS 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
             V AR  L++L ++ GTD +    ++DV+++GGL+   L R+P  G
Sbjct: 344 HRVTARLGLDDLGELYGTDLD----DEDVETVGGLLAKSLGRVPIAG 386


>gi|307327297|ref|ZP_07606484.1| protein of unknown function DUF21 [Streptomyces violaceusniger Tu
           4113]
 gi|306886976|gb|EFN17975.1| protein of unknown function DUF21 [Streptomyces violaceusniger Tu
           4113]
          Length = 480

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 125/246 (50%), Gaps = 17/246 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   +   E+F   L   ++  +++M  RV + A+E  AT  +A  +    GRS  PVY+
Sbjct: 196 GALEQDAAELFVRTLHLSELTAENVMTPRVDVQALEAHATAADAANLTLATGRSRFPVYR 255

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           ++LD   G VH+RDV++  +   A T           ++L    L VP S+ V  LL  +
Sbjct: 256 DTLDEVVGTVHIRDVLALDAADRATTPV---------TDLATPPLLVPDSLPVDRLLDRL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDART 246
           + +   MA+VIDE+GGT G+ + EDIV  ++ D+  EH + ++  +  +    +  D   
Sbjct: 307 RRAHT-MAVVIDEYGGTAGVATLEDIVEEIVGDVRDEHDTDETPGLMPLGPGAWEADGGV 365

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L+EL     T       E   +++ GL+ + L+RIPA G+ + E  G+++ +L  D   
Sbjct: 366 RLDEL-----TGIGMTAPEGPYETVAGLLATALERIPAAGDTI-ETDGWQLTVLKVDHHR 419

Query: 307 VRRVRI 312
             RVRI
Sbjct: 420 ADRVRI 425


>gi|315453825|ref|YP_004074095.1| Magnesium and cobalt efflux protein [Helicobacter felis ATCC 49179]
 gi|315132877|emb|CBY83505.1| Magnesium and cobalt efflux protein [Helicobacter felis ATCC 49179]
          Length = 437

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 116/224 (51%), Gaps = 15/224 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+EI  N + F      ++M  R  +  ++ K +  + +    K+  +  P   
Sbjct: 200 GVIDFVEEEIIKNAVDFSDTSAREVMTPRNDMVCIDLKCSYKDNIQTMLKHPFTRYPCCD 259

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            + DN  GM+H++DV+S        T N          NL+K +L VP S  +S +L  +
Sbjct: 260 GNKDNVLGMIHIKDVLSASLLDPQDTQNFK--------NLLKEMLIVPESASISQILLKM 311

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
              R+  ALV+DE+GGT GL++ +DI+  +M +I+      K  I  + +NTF  D   D
Sbjct: 312 NNKRVYTALVVDEYGGTSGLLTMDDIIKEIMGNISDAQDLSKEGIKRLDENTFECDGMVD 371

Query: 248 LEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVV 289
           LE +A+++      +K + D +  +LGG +FS+L+R+P  G+VV
Sbjct: 372 LENMAELLK-----VKFDPDYEQVTLGGYVFSLLERLPEVGDVV 410


>gi|260495172|ref|ZP_05815300.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 3_1_33]
 gi|260197229|gb|EEW94748.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 3_1_33]
          Length = 426

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 138/248 (55%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETNAKEVMTPRTSMLAFEGTKTINEVWDEIIDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N ++L I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDLPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSYYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIR 313
            V +V IR
Sbjct: 410 RVSKVFIR 417


>gi|158319720|ref|YP_001512227.1| hypothetical protein Clos_0671 [Alkaliphilus oremlandii OhILAs]
 gi|158139919|gb|ABW18231.1| protein of unknown function DUF21 [Alkaliphilus oremlandii OhILAs]
          Length = 414

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 120/223 (53%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EKE+  N+  F  ++I D+M+ R  + A++      E + M +    S  P+Y
Sbjct: 182 EGVLQTEEKEMIQNVFEFGDMQIQDVMVQRTDMIAIDIATPFNEIIDMVKSEQFSRYPIY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K+ +DN  G++++RD+I      +   +  + NI+      I+   F      +SD    
Sbjct: 242 KDGIDNIVGVLNVRDLI------FLNNDEGDFNIE----KYIRKPYFTFEFKKISDTFKE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++++RI +A+V+DE+GGT G+++ ED++  ++ DI  E+   +  I  V D  +IV+  T
Sbjct: 292 MKKNRIHIAIVLDEYGGTAGIITMEDLIEEIVGDIDDEYDEIEDEIQFVKDGEYIVNGST 351

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            +  + +++GTD       +D DS+GGLI   L R+P  GE V
Sbjct: 352 KISTVNEMLGTDFES----EDFDSIGGLIIEALGRLPKYGEKV 390


>gi|86739976|ref|YP_480376.1| CBS domain-containing protein [Frankia sp. CcI3]
 gi|86566838|gb|ABD10647.1| CBS [Frankia sp. CcI3]
          Length = 454

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 131/255 (51%), Gaps = 26/255 (10%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++  ++       + ++M+ R  +  +E   TV +A+ +  + G S +PV   S+D+  
Sbjct: 189 RDMIASVFELGDTLVREVMVPRPDMVFIESTKTVRQALALALRSGFSRIPVIGESVDDVV 248

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+  ++D       M  +      +  ++E  ++++   VP S    DLL  +Q SR  M
Sbjct: 249 GIAFLKD-------MVRREREGGEDGAIAE--IMRSPALVPESKPADDLLREMQASRTHM 299

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+VIDE+GGT GLV+ EDI+  ++ +IT E+ ++   +  +  NT  V AR D+++LAK+
Sbjct: 300 AIVIDEYGGTAGLVTIEDILEEIVGEITDEYDNEVPPVEWIDANTARVTARLDVDDLAKL 359

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI----LDADVRCVRR- 309
              D + L G  D  ++GGL+ + L R+P        IPG  + +    L A+    RR 
Sbjct: 360 FDFDVDDLPGADDSLTVGGLLATALGRVP--------IPGATVTVGGLRLSAERAAGRRN 411

Query: 310 ----VRIRRLVHFKN 320
               V ++RL H  N
Sbjct: 412 QIGTVVVQRLPHPSN 426


>gi|28897504|ref|NP_797109.1| putative hemolysin [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363861|ref|ZP_05776613.1| hemolysin [Vibrio parahaemolyticus K5030]
 gi|260878354|ref|ZP_05890709.1| hemolysin [Vibrio parahaemolyticus AN-5034]
 gi|260898988|ref|ZP_05907429.1| hemolysin [Vibrio parahaemolyticus Peru-466]
 gi|260900742|ref|ZP_05909137.1| hemolysin [Vibrio parahaemolyticus AQ4037]
 gi|28805716|dbj|BAC58993.1| putative hemolysin [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087474|gb|EFO37169.1| hemolysin [Vibrio parahaemolyticus Peru-466]
 gi|308090266|gb|EFO39961.1| hemolysin [Vibrio parahaemolyticus AN-5034]
 gi|308108993|gb|EFO46533.1| hemolysin [Vibrio parahaemolyticus AQ4037]
 gi|308114635|gb|EFO52175.1| hemolysin [Vibrio parahaemolyticus K5030]
 gi|328472487|gb|EGF43350.1| putative hemolysin [Vibrio parahaemolyticus 10329]
          Length = 299

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 156/313 (49%), Gaps = 29/313 (9%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           M  D   +S+E  KEK EG          S  +F+ R    L + ++       + + + 
Sbjct: 1   MNEDNSPSSNEGKKEKAEG---------PSRKSFFER----LGQLFQGEPKDRQELVDVI 47

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           R D+ +  +     +++   ++   ++R+ DIMI R  +  VE    +   + +      
Sbjct: 48  R-DSEVNDLIDHDTRDMLEGVMEISEMRVRDIMIPRSQMVTVERTDDLDTLIALITDAQH 106

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S  PV     D+  G++  +D++ Y+    + +N  ++        +I+  + VP S  V
Sbjct: 107 SRYPVISEDKDHVEGILLAKDLLKYLG---SGSNPFDI------EEVIRPAVVVPESKRV 157

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNT 239
             LL   +E R  MA+V+DE GG  GLV+ EDI+  ++ DI  E   S+++ I  +S +T
Sbjct: 158 DRLLKEFREERYHMAIVVDEFGGVSGLVTIEDILEEIVGDIEDEFDESEETDIRKLSKHT 217

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F V A T +EE  +  GT+ +    +++VD++GG++ +    +P+RGE+V EI G+   +
Sbjct: 218 FAVRALTTIEEFNETFGTNFS----DEEVDTVGGMVMTAFGHLPSRGELV-EIEGYNFKV 272

Query: 300 LDADVRCVRRVRI 312
             AD R V ++++
Sbjct: 273 TAADNRRVIQLQV 285


>gi|154503790|ref|ZP_02040850.1| hypothetical protein RUMGNA_01614 [Ruminococcus gnavus ATCC 29149]
 gi|153795890|gb|EDN78310.1| hypothetical protein RUMGNA_01614 [Ruminococcus gnavus ATCC 29149]
          Length = 399

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 129/228 (56%), Gaps = 17/228 (7%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EKE+  N+     ++  ++M+ RV +   +  ++  E + +F++Y  
Sbjct: 147 VDVSHEDGVIESEEKEMIYNVFDLGDVKAKEVMVPRVHVAFADVNSSYRELIEIFKEYKF 206

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +PVY+++ DN  G ++M+D++ +        +  N  ++    N+++   F      +
Sbjct: 207 TRLPVYEDTTDNVIGTINMKDLLLF-------EDKANFQVR----NILREAYFTYEYKNI 255

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S+LL  +++++  +A+V+DE+G T G+++ ED++  ++ +I  E+  +++ +I  V+D  
Sbjct: 256 SELLVEMRDAKFNIAIVLDEYGETAGIITLEDVLEEIVGEIRDEYDEAEEELIQKVNDQE 315

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +IV+   +L++L   +GT+       +D DSLGG I   LDR+P  G+
Sbjct: 316 YIVEGSMNLDDLNDNLGTELES----EDYDSLGGFIIEHLDRLPEVGD 359


>gi|289765421|ref|ZP_06524799.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. D11]
 gi|289716976|gb|EFD80988.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. D11]
          Length = 426

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 138/248 (55%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETNAKEVMTPRTSMLAFEGTKTINEVWDEIIDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N ++L I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDLPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSYYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIR 313
            V +V IR
Sbjct: 410 RVSKVFIR 417


>gi|225851136|ref|YP_002731370.1| CBS/transporter-associated domain protein [Persephonella marina
           EX-H1]
 gi|225646500|gb|ACO04686.1| CBS/transporter-associated domain protein [Persephonella marina
           EX-H1]
          Length = 429

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 116/219 (52%), Gaps = 13/219 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           IF+E EKEI    L+  +  + +IM  R  I A+    TV E + + ++   S +PVY+ 
Sbjct: 185 IFTEEEKEIIEATLQLHETAVSEIMTPRRDIFAIPKGLTVREVLELIKEKDYSRIPVYEG 244

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           +LDN  G+++++D+I        K   I+          ++   FVP    + +L+   +
Sbjct: 245 NLDNIIGILYIKDII--FLKFEGKEEKID--------RFLREPYFVPEFTPLLNLMKKFE 294

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
           E +  MA+V+DEHG   GLV+++DI+  ++ DI  E+  ++  I  +S N + V  + ++
Sbjct: 295 EKKNHMAIVVDEHGTVVGLVTFQDILEFIVGDIPEEYEPEEPFIKQISMNKWEVSGKIEV 354

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           E L +++G     L  + + D++GG I  VL R P  GE
Sbjct: 355 EILEEVVGIK---LPDDYEFDTVGGFILDVLKRFPEEGE 390


>gi|170755576|ref|YP_001782566.1| CBS/transporter associated domain-containing protein [Clostridium
           botulinum B1 str. Okra]
 gi|169120788|gb|ACA44624.1| CBS/transporter-associated domain protein [Clostridium botulinum B1
           str. Okra]
          Length = 439

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 119/223 (53%), Gaps = 18/223 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+ +E EKE+ N+I  F     D++M  R  +  ++ +  + E +  L+ E+Y R  +PV
Sbjct: 200 GVINEKEKEMINSIFEFDDKLADEVMTPRTEVYLIDIEKPLKEYLDELIEERYSR--IPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           Y+ S+DN  G+++M+D +     H +      N++I+    ++++   FVP +  + DL 
Sbjct: 258 YEGSIDNIIGILYMKDFLGEARKHGFE-----NVDIR----SILRPAYFVPETKNIDDLF 308

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +  MA++IDE+GG  G+VS ED++  +M +I  E+   +  I  + ++TFI+D 
Sbjct: 309 KELQAFKKHMAILIDEYGGFSGIVSIEDLIEEVMGNIEDEYDEDEPAIKKIDNDTFIIDG 368

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              +++       D       QD D++ G +  +L RIP   E
Sbjct: 369 MVSIDDFNDYFNIDIES----QDYDTINGFLIDLLGRIPMSAE 407


>gi|91228823|ref|ZP_01262730.1| putative hemolysin [Vibrio alginolyticus 12G01]
 gi|91187628|gb|EAS73953.1| putative hemolysin [Vibrio alginolyticus 12G01]
          Length = 299

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 156/313 (49%), Gaps = 29/313 (9%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           M  D   +S+E  KEK EG          S  +F+ R    L + ++       + + + 
Sbjct: 1   MNEDNSPSSNEDKKEKAEG---------PSRKSFFER----LGQLFQGEPKDRQELVDVI 47

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           R D+ +  +     +++   ++   ++R+ DIMI R  +  VE    +   + +      
Sbjct: 48  R-DSEVNDLIDHDTRDMLEGVMEISEMRVRDIMIPRSQMVTVERTHDLDTLVALITDAQH 106

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S  PV     D+  G++  +D++ Y+    + +N  ++        +I+  + VP S  V
Sbjct: 107 SRYPVISEDKDHVEGILLAKDLLKYLG---SGSNPFDI------EEVIRPAVVVPESKRV 157

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNT 239
             LL   +E R  MA+V+DE GG  GLV+ EDI+  ++ DI  E   S+++ I  +S +T
Sbjct: 158 DRLLKEFREERYHMAIVVDEFGGVSGLVTIEDILEEIVGDIEDEFDESEETDIRKLSKHT 217

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F V A T +EE  +  GT+ +    +++VD++GG++ +    +P+RGE+V EI G+   +
Sbjct: 218 FAVRALTTIEEFNEAFGTNFS----DEEVDTVGGMVMTAFGHLPSRGELV-EIEGYNFKV 272

Query: 300 LDADVRCVRRVRI 312
             AD R V ++++
Sbjct: 273 TAADNRRVIQLQV 285


>gi|320355126|ref|YP_004196465.1| CBS domain-containing protein [Desulfobulbus propionicus DSM 2032]
 gi|320123628|gb|ADW19174.1| CBS domain containing protein [Desulfobulbus propionicus DSM 2032]
          Length = 299

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 130/241 (53%), Gaps = 13/241 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ + N+I  FR+    +IM     +   +  +++ E + +  + G + +P+YK++ D  
Sbjct: 64  EERLINSIFDFRETIASEIMTPSAEMVCADLTSSMPELIRLINEQGYTRIPIYKDNPDQI 123

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G++H +D++S    + A+ N+   +++     ++    F+P S  +++LL   Q  +I 
Sbjct: 124 VGILHAKDLLS----LCARGNDAEFDLK----EVLNPATFIPESKPITELLREFQSKKIH 175

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GG  GLV+ ED++  ++ +I  EH  + S +  V + T IVDA+ D+EE+  
Sbjct: 176 MAIVVDEFGGVRGLVTLEDVIEEIVGEIDDEHDDEDSELRVVDERTVIVDAKIDIEEVEA 235

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
               +      E   +S+GG I   L ++P  G VV+E  G    +L AD R ++ VRI 
Sbjct: 236 HFRLNLP----EGPYESVGGFIIHRLGKVPPPG-VVVEENGLSFKVLGADPRRIKSVRIV 290

Query: 314 R 314
           R
Sbjct: 291 R 291


>gi|237742594|ref|ZP_04573075.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 4_1_13]
 gi|229430242|gb|EEO40454.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. 4_1_13]
          Length = 426

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETNAKEVMTPRTSMLAFEGAKTINEVWDEIVDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +++ I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDIPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELN---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V IR L
Sbjct: 410 RVSKVFIRIL 419


>gi|328948520|ref|YP_004365857.1| hypothetical protein Tresu_1663 [Treponema succinifaciens DSM 2489]
 gi|328448844|gb|AEB14560.1| CBS domain containing protein [Treponema succinifaciens DSM 2489]
          Length = 260

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 120/230 (52%), Gaps = 14/230 (6%)

Query: 58  RLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEK 117
           ++   + + + I +E + ++   +       + ++M+ R+ ++ +  +    E +    +
Sbjct: 15  KISAAEEAQQEILAEEKNDMIQGVEELAVTTVKEVMVPRIDVDFISMETPEEELLKKVTE 74

Query: 118 YGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSS 177
            G S +PVY  S+DN  G+++++D+I  ++          L I L    +I+   FVP S
Sbjct: 75  SGHSRIPVYSGSIDNVVGILYVKDLIKTLAE--------KLPIDLE--KIIRKPYFVPES 124

Query: 178 MLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSD 237
             +  LL   +   + +A+ IDE+GG  G+V  EDI+  ++ DI  E  ++   I ++S+
Sbjct: 125 KHIDSLLREFKRRHVHIAVSIDEYGGVSGIVCMEDIIEEIVGDIQDEFDNEHEDIISLSE 184

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           N +I DAR DL+ L + IG+D       +D D+LGG +F +  +IP + E
Sbjct: 185 NAWICDARVDLDTLNEEIGSDFPT----EDFDTLGGFVFDLFGKIPVKFE 230


>gi|294628165|ref|ZP_06706725.1| integral membrane transporter with CBS domains [Streptomyces sp.
           e14]
 gi|292831498|gb|EFF89847.1| integral membrane transporter with CBS domains [Streptomyces sp.
           e14]
          Length = 446

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 129/251 (51%), Gaps = 24/251 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG       E+F   L    +  +++M  RV + A++ +AT  +        G S  PVY
Sbjct: 169 EGALEADTAELFVRTLNLADLTAENVMTPRVQVVALDAQATCEDVANATRATGLSRFPVY 228

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + SLD+  G  H++DV++  +          L++++SE  +++  L VP S+ V  LL  
Sbjct: 229 RGSLDSVVGTAHVKDVLAVPA-------GRRLHLRVSE--IMREPLLVPESLTVDRLLDR 279

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNT----F 240
           +   R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH  H    +  A +D      +
Sbjct: 280 LSGRRT-MAVVIDEYGGTAGVATLEDIVEEVVGEVRDEHDPHETPDLAPAGADAEGRALY 338

Query: 241 IVDARTDLEELAKIIGTDCNCLK-GEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
             D    +++LA++       LK  +   ++L GLI + L RIPA G+ VLE+ G+ + +
Sbjct: 339 SADGSARVDQLARV------GLKVPDGPYETLAGLIAAELGRIPATGD-VLEVAGWRLDV 391

Query: 300 LDADVRCVRRV 310
           +DA  R   RV
Sbjct: 392 VDAGGRRAARV 402


>gi|239917733|ref|YP_002957291.1| CBS domain-containing protein [Micrococcus luteus NCTC 2665]
 gi|281413772|ref|ZP_06245514.1| CBS domain-containing protein [Micrococcus luteus NCTC 2665]
 gi|239838940|gb|ACS30737.1| CBS domain-containing protein [Micrococcus luteus NCTC 2665]
          Length = 441

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 129/248 (52%), Gaps = 14/248 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           + +++E E+  ++       +  +M+ R  +  ++   T+ +AM +F + G S +PV   
Sbjct: 178 VLADSEAELIQSVFSMNDTIVRSVMVPRTDVVTIDADHTLGQAMALFLRSGNSRIPVIGE 237

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D+ RGM+H++DV   + H  A T+          + +++++ FVP S  V+ LL  +Q
Sbjct: 238 DADDIRGMLHLKDVTRALHHDGAATDT-------PVTEVMRDVRFVPESKSVATLLQELQ 290

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNTFIVDARTD 247
                +A+V+DE+GGT GLV+ ED++  ++ +I  E  H  +  +  V+   + VDAR  
Sbjct: 291 RESTHVAVVVDEYGGTAGLVTLEDLIEEIVGEIYDEDDHPDRPEVEFVAPGVYSVDARMG 350

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + +  +             DVD++GGL+   L R+P +G  V+ + G E+V   AD    
Sbjct: 351 IHDFREEFELPEEDED--DDVDTVGGLLAKELGRVPIQGSRVV-VQGIEVV---ADTLEP 404

Query: 308 RRVRIRRL 315
           RR R+ RL
Sbjct: 405 RRNRVARL 412


>gi|119486081|ref|ZP_01620143.1| hypothetical protein L8106_06155 [Lyngbya sp. PCC 8106]
 gi|119456856|gb|EAW37984.1| hypothetical protein L8106_06155 [Lyngbya sp. PCC 8106]
          Length = 507

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 127/242 (52%), Gaps = 11/242 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+EI NN+  F  +  +++MI R ++ A+   A     +      G S  PV + SLD+ 
Sbjct: 181 EREILNNVFEFGDVLAEEVMIPRTNVIAISSTANFQNLLNEMTVSGHSRYPVMRESLDDI 240

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G++  RD+   ++          L+ + S  + I+   FV   ML+S+LL  +Q S + 
Sbjct: 241 LGIIDFRDLAKPLAEGL-------LSPETSLESWIRPARFVSEQMLLSELLPLMQRSHLE 293

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +++DE GGT GLV+  D+++ ++ D +    +++  +  + + TF+V A+ D+EE+ +
Sbjct: 294 MVIIVDEFGGTAGLVTINDLIAEIIGDSSESTETEEIKLQYIDEQTFLVQAQLDIEEVNE 353

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++  D   L   ++  +LGG +   L +IP  GE  L     E  ++ A+   + +++I 
Sbjct: 354 LVDLD---LPITEEYQTLGGFLIYQLQKIPIVGE-TLRYQNLEFTVILAEGPRIDQIQIH 409

Query: 314 RL 315
           +L
Sbjct: 410 QL 411


>gi|323697940|ref|ZP_08109852.1| CBS domain containing protein [Desulfovibrio sp. ND132]
 gi|323457872|gb|EGB13737.1| CBS domain containing protein [Desulfovibrio desulfuricans ND132]
          Length = 273

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 135/258 (52%), Gaps = 20/258 (7%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE-AMLMFEKYGR 120
           ++A  +G     E  +  N+L   +  +++IM+ R  +   +  +TV + A L+  +   
Sbjct: 29  LEAKADGELESHEVSMLLNVLGLDQKLVEEIMVPRTDMVCADASSTVKDVAELIVNQGAH 88

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES--NLIKNILFVPSSM 178
           S +P+Y+++ D+  G+VH +D++  +           LN Q   S   L++   FV    
Sbjct: 89  SRIPIYQDNKDHIFGLVHAKDLLEPL-----------LNGQADRSVVELLRPAFFVAEDK 137

Query: 179 LVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSD 237
            + ++L   ++ ++ MA+V DE+GGT G+V+ ED++  ++ DI+ E+  ++   I   SD
Sbjct: 138 PLDEVLAYFKKEKLHMAVVQDEYGGTSGMVTMEDVLEEIVGDISDEYDEQRPDEIQDYSD 197

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
            TF+V  R  LE++ +  G D       ++VDS+GG + ++  RIP  G  +    G+  
Sbjct: 198 GTFVVSGRAPLEDVNRKFGLDLES----EEVDSIGGYMAALAGRIPDPG-TLYTFSGWRF 252

Query: 298 VILDADVRCVRRVRIRRL 315
            +++AD R +  +++  L
Sbjct: 253 TVMEADERQIWTIKVEPL 270


>gi|304382038|ref|ZP_07364590.1| CBS domain protein [Prevotella marshii DSM 16973]
 gi|304336792|gb|EFM03016.1| CBS domain protein [Prevotella marshii DSM 16973]
          Length = 446

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 129/241 (53%), Gaps = 12/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ I + I+ F      ++M SR  +  ++ ++T  + +    +   S +PVY+ + DN 
Sbjct: 205 ERSILHGIIHFGDETAKEVMTSRQDVVDLDIRSTFADVLRCIVENNYSRIPVYQENTDNI 264

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S    K  N          +LI+   FVP +  + DLL   Q+++I 
Sbjct: 265 RGVLYIKDLLPHLS----KPANFRWQ------SLIRAPYFVPETKKIDDLLREFQDNKIH 314

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++ + + ++D T+I + +  L +  K
Sbjct: 315 IAIVVDEFGGTSGIVTLEDILEEIVGEINDEYDEEEKLYAKINDTTYIFEGKVLLSDFYK 374

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+    +  +  E D DSL GL+  +    PA  E +     F   IL  + R + RV++
Sbjct: 375 ILQLPDDTFEEIEGDADSLAGLLLEMKGDFPAIHEQI-TYKNFSFEILKIEDRRISRVKV 433

Query: 313 R 313
           R
Sbjct: 434 R 434


>gi|42526752|ref|NP_971850.1| hemolysin C [Treponema denticola ATCC 35405]
 gi|41817067|gb|AAS11761.1| hemolysin C [Treponema denticola ATCC 35405]
          Length = 258

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 134/254 (52%), Gaps = 18/254 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ +E ++++   ++      + ++MI R+ ++ +       E +    + G S  PVY
Sbjct: 19  EGL-NEEKRDMIRGVVDLSDTAVKEVMIPRIDVDFLALDTPSDEILDRISESGHSRFPVY 77

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G+++++D+I  ++         N  I+L +  +++   FVP S  +  LL  
Sbjct: 78  DESIDNVIGILYVKDIIKLLTK--------NQKIELDK--IVRRAFFVPESKRIDALLAE 127

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            +   I +A+ +DE+GG  G+V  EDI+  ++ DI  E  ++   I+ ++   ++ DAR 
Sbjct: 128 FKRRHIHIAVAVDEYGGVSGIVCMEDIIEEIVGDIQDEFDNEGEDITEIAPGVWLCDARV 187

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DL++LA+ I +D   +    + ++LGG +F +  +IPA+ E       F+ ++ D D   
Sbjct: 188 DLDDLAETIKSDDLPV---DEFETLGGFVFDLFGKIPAKYEKTA-WNDFDFIVQDMDGHK 243

Query: 307 VRRVRIRRLVHFKN 320
           V+ V+I   VH KN
Sbjct: 244 VKTVKI---VHNKN 254


>gi|283769588|ref|ZP_06342484.1| CBS domain protein [Bulleidia extructa W1219]
 gi|283103856|gb|EFC05242.1| CBS domain protein [Bulleidia extructa W1219]
          Length = 421

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 127/251 (50%), Gaps = 13/251 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  EG   E E  + +  + FR + + D+   RV I AV+    + E    F     S 
Sbjct: 174 EAEKEGDLQEHESSLISAAIEFRDLEVKDVFTPRVDIVAVDVNEDLKEIEETFRINSYSR 233

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY+ ++D+  G++H +D   +   +Y K N+++        ++I  ++    +  + +
Sbjct: 234 LPVYEETIDHIIGVIHEKD---FYDLLYHKKNDLH--------SIITKVINTSPNTHIYE 282

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           L+  +Q  ++ MA+V+DE GGTDGL++ EDIV  L+ +I  EH   +   + +SDN ++V
Sbjct: 283 LMQILQREKLHMAVVLDEWGGTDGLITLEDIVEELVGEIWDEHDVVEEFYTKISDNEYLV 342

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
               ++++L +    +    + E D +S+ G   + L  IP  GE   +     + I  A
Sbjct: 343 KGEAEVDDLFERFDIEVKE-EEEDDYNSVSGWAIAQLGHIPEVGE-SFQFENLFVQITKA 400

Query: 303 DVRCVRRVRIR 313
           D R V  VRIR
Sbjct: 401 DNRKVNEVRIR 411


>gi|239929881|ref|ZP_04686834.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291438216|ref|ZP_06577606.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291341111|gb|EFE68067.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 445

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 125/255 (49%), Gaps = 22/255 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           ++ EG       E+F   L   ++  +++M  RV + A+E  AT  +A  +    G S  
Sbjct: 191 SAAEGALEADSAELFVRTLHLGELTAENVMTPRVDVKALEVHATAADAANLSHATGLSCF 250

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY++SLD   G VH+RDV++        T           ++L    L VP S+    L
Sbjct: 251 PVYRDSLDEVVGTVHIRDVLALEPEKRGVTPV---------TDLTSPPLLVPDSLTADRL 301

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDN--- 238
           L  ++E R  +A+VIDE+GGT G+ S EDIV  ++ ++  EH  H    ++SA +     
Sbjct: 302 LERLREHRT-LAVVIDEYGGTAGVASMEDIVEEVVGEVRDEHDPHQVPDLVSAAATQDGR 360

Query: 239 -TFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
             +  D    ++ L     TD      E   +++ GLI + L RIP +G+ V E+ G+ +
Sbjct: 361 AVWEADGSVRVDRL-----TDMGLTAPEGPYETVAGLIATRLARIPVKGDSV-ELDGWRL 414

Query: 298 VILDADVRCVRRVRI 312
            +L+ +     R+RI
Sbjct: 415 DVLEVEHHRAGRIRI 429


>gi|145595963|ref|YP_001160260.1| CBS domain-containing protein [Salinispora tropica CNB-440]
 gi|145305300|gb|ABP55882.1| CBS domain containing protein [Salinispora tropica CNB-440]
          Length = 464

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 132/249 (53%), Gaps = 14/249 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+    E+++ +++       + ++M+ R  +  +E    + +A+ +F + G S +
Sbjct: 190 AEQRGVVEHGERQMIHSVFALGDTIVREVMVPRTEMVWIERHKMLSQALALFLRSGFSRI 249

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S+D+  G+++++D+I        +   + +      + L++   FVP S  V DL
Sbjct: 250 PVIGESVDDVLGVLYLKDLIRRTQGGAPEDRRLQV------AELMRPATFVPESKPVDDL 303

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L+ +Q +R  + +V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  +  + D+   V 
Sbjct: 304 LSEMQAARNHLVIVVDEYGGTGGLVTIEDILEEIVGEITDEYDVERPPVEHLDDDAVRVT 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +E+L ++  T+        +V+++GGL+   L R+P  G  V E+ G  ++   A+
Sbjct: 364 ARLPVEDLGELFDTELPS----DEVETVGGLLAQSLGRVPIPGAQV-EVAGLRLL---AE 415

Query: 304 VRCVRRVRI 312
               RR RI
Sbjct: 416 GTTGRRNRI 424


>gi|265762950|ref|ZP_06091518.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           2_1_16]
 gi|263255558|gb|EEZ26904.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           2_1_16]
          Length = 448

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +        S +P+Y  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 378 ITKVDEDDFDKVDGDADTLAGLLLEIKGEFPALHEKVL-YHRYEFEVLAMDSRRILKVKF 436


>gi|322380562|ref|ZP_08054728.1| integral membrane protein [Helicobacter suis HS5]
 gi|321147024|gb|EFX41758.1| integral membrane protein [Helicobacter suis HS5]
          Length = 435

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 133/250 (53%), Gaps = 19/250 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+EI  N + F      +IM  R  +  ++ + +  + M    K+  +  P  +
Sbjct: 199 GVIDYVEEEIIKNAVDFSDTSAKEIMTPRNDMVCLDVQHSYEDNMRTILKHPFTRYPCCE 258

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
              DN  GMVH+RD++S +S    K  ++          ++K +L VP S  +S +L  +
Sbjct: 259 EHKDNILGMVHIRDILS-VSLADQKEPDLRC--------MLKEMLIVPESASISQILIKM 309

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            + +   ALV+DE+GGT GL++ +DI+  +M +I  EH   K  I  + ++TF  D   D
Sbjct: 310 NQQQRHTALVVDEYGGTSGLLTMDDIIEEIMGNIYEEHDLSKEGIKRLDEHTFECDGMVD 369

Query: 248 LEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVVLEIPG-FEIVILDADV 304
           LE++ +++G      + +Q+    +LGG +FS+L+R+P  G+VV +    FE  +LD D 
Sbjct: 370 LEDIEELLG-----FRFDQNYKQVTLGGYVFSLLERLPEVGDVVGDAKCIFE--VLDMDK 422

Query: 305 RCVRRVRIRR 314
             +R++++ +
Sbjct: 423 ARIRKLKLMK 432


>gi|256845989|ref|ZP_05551447.1| magnesium and cobalt efflux protein corC [Fusobacterium sp.
           3_1_36A2]
 gi|294784887|ref|ZP_06750175.1| putative transporter [Fusobacterium sp. 3_1_27]
 gi|256719548|gb|EEU33103.1| magnesium and cobalt efflux protein corC [Fusobacterium sp.
           3_1_36A2]
 gi|294486601|gb|EFG33963.1| putative transporter [Fusobacterium sp. 3_1_27]
          Length = 426

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEGAKTINEVWDEIVDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +++ I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDIPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELN---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V IR L
Sbjct: 410 RVSKVFIRIL 419


>gi|34762471|ref|ZP_00143470.1| Magnesium and cobalt efflux protein corC [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27887870|gb|EAA24939.1| Magnesium and cobalt efflux protein corC [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 426

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMLAFEGAKTINEVWDEIVDNGFSRIPIY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N +++ I+      I++  FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHI-----KNNELDIPIK----QFIRSAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+   ++S    ++DN + VDA 
Sbjct: 294 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEESFYKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKDLELN---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V IR L
Sbjct: 410 RVSKVFIRIL 419


>gi|301162558|emb|CBW22105.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Bacteroides fragilis 638R]
          Length = 439

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +        S +P+Y  + DN 
Sbjct: 199 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNI 258

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 259 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 308

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 309 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 368

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 369 ITKVDEDDFDKVDGDADTLAGLLLEIKGEFPALHEKVL-YHRYEFEVLAMDSRRILKVKF 427


>gi|253563166|ref|ZP_04840623.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           3_2_5]
 gi|251946942|gb|EES87224.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           3_2_5]
          Length = 448

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +        S +P+Y  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 378 ITKVDEDDFDKVDGDADTLAGLLLEIKGEFPALHEKVL-YHRYEFEVLAMDSRRILKVKF 436


>gi|294783441|ref|ZP_06748765.1| hypothetical protein HMPREF0400_01434 [Fusobacterium sp. 1_1_41FAA]
 gi|294480319|gb|EFG28096.1| hypothetical protein HMPREF0400_01434 [Fusobacterium sp. 1_1_41FAA]
          Length = 427

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 141/250 (56%), Gaps = 14/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A+E + T+ E      + G S +PVY
Sbjct: 183 EGIIEEDEKEMIHSIVTLGETSAKEVMTPRTSMFALEGEKTINEIWDEITENGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ ++     K N + + I+     +++   FVP +  + ++L  
Sbjct: 243 EETIDNIIGILYVKDLMEHV-----KNNELEIPIK----QIVRLAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 294 FRTLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSFFKKIADNEYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 354 TDIETINKELELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNIYLKVLEVDKM 409

Query: 306 CVRRVRIRRL 315
            V +V I+ L
Sbjct: 410 RVSKVFIKIL 419


>gi|294775460|ref|ZP_06740973.1| gliding motility-associated protein GldE [Bacteroides vulgatus
           PC510]
 gi|294450701|gb|EFG19188.1| gliding motility-associated protein GldE [Bacteroides vulgatus
           PC510]
          Length = 450

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      + +    +   S +PVY  S DN 
Sbjct: 209 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSDVLKCIVENAYSRIPVYAESRDNI 268

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 269 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 318

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 319 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 378

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 379 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 437


>gi|60681073|ref|YP_211217.1| CorC/HlyC family transporter associated protein [Bacteroides
           fragilis NCTC 9343]
 gi|60492507|emb|CAH07277.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Bacteroides fragilis NCTC 9343]
          Length = 439

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +        S +P+Y  + DN 
Sbjct: 199 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNI 258

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 259 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 308

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 309 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 368

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 369 ITKVDEDDFDKVDGDADTLAGLLLEIKGEFPALHEKVL-YHRYEFEVLAMDSRRILKVKF 427


>gi|242309515|ref|ZP_04808670.1| magnesium and cobalt efflux protein CorC [Helicobacter pullorum MIT
           98-5489]
 gi|239524086|gb|EEQ63952.1| magnesium and cobalt efflux protein CorC [Helicobacter pullorum MIT
           98-5489]
          Length = 441

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 121/231 (52%), Gaps = 17/231 (7%)

Query: 62  IDASLEGIFSET-EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +  SL+G + +T E EI  N + F      +IM  R  +  + D  +  E M +      
Sbjct: 193 VGESLKGGYLDTIENEIIQNAVSFSDTMAKEIMTPRKDMICLYDDNSYEENMQIVTTTKH 252

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           +  P  K   DN  GMVH+RD++  +         ++ N       L++ ++ VP S  +
Sbjct: 253 TRYPYCKEGKDNIIGMVHLRDLLETM---------LSENPSRELEKLVREMIIVPESASI 303

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           S++L  +   +I  ALV+DE+GGT GL++ EDI+  ++ DI+ EH  K      + ++T+
Sbjct: 304 SNILLQMNRRQIHTALVVDEYGGTAGLLTMEDILEEVIGDISDEHDKKSEDYHKIDEDTY 363

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVV 289
             D   DLE +A ++G     +  E+D +  ++GG +F++L+R+P  G+V+
Sbjct: 364 SFDGMLDLERVADVLG-----ISFEEDTEQVTIGGYVFNLLERMPVVGDVI 409


>gi|256027459|ref|ZP_05441293.1| integral membrane protein [Fusobacterium sp. D11]
          Length = 417

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 138/248 (55%), Gaps = 14/248 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+   +    ++M  R S+ A E   T+ E        G S +P+Y
Sbjct: 174 EGIIEEDEKEMIHSIVTLGETNAKEVMTPRTSMLAFEGTKTINEVWDEIIDNGFSRIPIY 233

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++ +I     K N ++L I+      I++  FVP +  + ++L  
Sbjct: 234 EETIDNIIGILYVKDLMEHI-----KNNELDLPIK----QFIRSAYFVPETKSIIEILKE 284

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GLV+ ED++  ++ +I  E+  ++ S    ++DN + VDA 
Sbjct: 285 FRGLKVHIAMVLDEYGGVVGLVTIEDLIEEIVGEIRDEYDDEEDSYYKKIADNEYEVDAM 344

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
           TD+E + K +  +   L   +D +SLGGLI +   +I   G+ V +I    + +L+ D  
Sbjct: 345 TDIETINKDLELE---LPISEDYESLGGLIVTTTGKICEVGDEV-QIDNVYLKVLEVDKM 400

Query: 306 CVRRVRIR 313
            V +V IR
Sbjct: 401 RVSKVFIR 408


>gi|254881519|ref|ZP_05254229.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           4_3_47FAA]
 gi|254834312|gb|EET14621.1| CorC/HlyC family transporter associated protein [Bacteroides sp.
           4_3_47FAA]
          Length = 441

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      + +    +   S +PVY  S DN 
Sbjct: 200 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSDVLKCIVENAYSRIPVYAESRDNI 259

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 260 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 309

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 310 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 369

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 370 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 428


>gi|319642904|ref|ZP_07997540.1| transmembrane CorC/HlyC family transporter associated protein
           [Bacteroides sp. 3_1_40A]
 gi|317385452|gb|EFV66395.1| transmembrane CorC/HlyC family transporter associated protein
           [Bacteroides sp. 3_1_40A]
          Length = 427

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      + +    +   S +PVY  S DN 
Sbjct: 186 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSDVLKCIVENAYSRIPVYAESRDNI 245

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 246 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 295

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 296 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 355

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 356 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 414


>gi|289705006|ref|ZP_06501419.1| hypothetical protein HMPREF0569_2391 [Micrococcus luteus SK58]
 gi|289558265|gb|EFD51543.1| hypothetical protein HMPREF0569_2391 [Micrococcus luteus SK58]
          Length = 441

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 129/248 (52%), Gaps = 14/248 (5%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           + +++E E+  ++       +  +M+ R  +  ++   T+ +AM +F + G S +PV   
Sbjct: 178 VLADSEAELIQSVFSMNDTIVRSVMVPRTDVVTIDADHTLGQAMALFLRSGNSRIPVIGE 237

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D+ RGM+H++DV   + H  A T+          + +++++ FVP S  V+ LL  +Q
Sbjct: 238 DADDIRGMLHLKDVTRALHHDGAATDT-------PVTEVMRDVRFVPESKSVATLLQELQ 290

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE-HHSKKSMISAVSDNTFIVDARTD 247
                +A+V+DE+GGT GLV+ ED++  ++ +I  E  H  +  +  V+   + VDAR  
Sbjct: 291 RESTHVAVVVDEYGGTAGLVTLEDLIEEIVGEIYDEDDHPDRPEVEFVAPGVYSVDARMG 350

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + +  +             DVD++GGL+   L R+P +G  V+ + G E+V   AD    
Sbjct: 351 IHDFREEFELPEEDED--DDVDTVGGLLAKELGRVPIQGSRVV-VQGIELV---ADTLEP 404

Query: 308 RRVRIRRL 315
           RR R+ RL
Sbjct: 405 RRNRVARL 412


>gi|149181890|ref|ZP_01860379.1| hypothetical protein BSG1_07776 [Bacillus sp. SG-1]
 gi|148850429|gb|EDL64590.1| hypothetical protein BSG1_07776 [Bacillus sp. SG-1]
          Length = 412

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 132/247 (53%), Gaps = 15/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  + E+E+ +  + F  I + +++  R+ + AVE   +V E   MF +   S +PVY
Sbjct: 173 EGVIDKEERELIHRSMDFDDIMVSEVLTPRIDVKAVEVNQSVDEIKEMFFEERFSRIPVY 232

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++ +DN  G++  ++   + +H+  K   +N+        LI+  +FV  S  +S LLT 
Sbjct: 233 EDHIDNVIGILSEKE---FFTHLL-KFGEVNIR------ALIREPMFVFESAKISTLLTK 282

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q+ ++ MA+V+DE GGT GL++ EDI+  ++ +I  E       ++ VSDN +  D++ 
Sbjct: 283 LQKDKVHMAIVVDEFGGTTGLITLEDILEEIVGEIWDEQDETIHSMTKVSDNVYKFDSQF 342

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            L+E   ++    N  + +    ++GG +    + IP+ GE   +    ++ + + D R 
Sbjct: 343 QLDEFTDLL----NLPEPDSSYHTVGGWVVESFEEIPSEGE-SFDYENVKVTVEEVDNRR 397

Query: 307 VRRVRIR 313
           +R +++ 
Sbjct: 398 IRTIKVE 404


>gi|256372049|ref|YP_003109873.1| CBS domain containing protein [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008633|gb|ACU54200.1| CBS domain containing protein [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 420

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 136/253 (53%), Gaps = 14/253 (5%)

Query: 38  TIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSET-EKEIFNNILRFRKIRIDDIMISR 96
           ++ AL   W+    +  +   L   DA+ +G   ET E+E+ ++++ F      ++M+ R
Sbjct: 149 SLSALLTPWRAPGATVSEAELLAMADAAEQGDVIETDERELIHSVISFGDTIAREVMVPR 208

Query: 97  VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNI 156
             + AV  + TV  A+ +  + GRS +PVY++SLDN  G+V  +D+++ + H   +   +
Sbjct: 209 PDVVAVPAETTVAGAIEVVIEVGRSRLPVYESSLDNVLGIVLAKDLLA-LEHTGLRDVPV 267

Query: 157 NLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV 216
             ++        + I FVP +  V+DLL  +++ +  +A+V+DE+G T G+V+ ED++  
Sbjct: 268 GQHM--------RPIHFVPETKPVADLLKEMRDGKFHLAVVVDEYGSTAGIVTLEDLIEE 319

Query: 217 LMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIF 276
           L+ +I  E  +    +  + +  + V     +++L++ IG +      E + DS+GGLI 
Sbjct: 320 LVGEIHDEFDAGGEGVVELGEGRWEVRGSVSIDDLSERIGEELP----EGEWDSVGGLIM 375

Query: 277 SVLDRIPARGEVV 289
            +L  +P  GE V
Sbjct: 376 GLLGHLPRVGEEV 388


>gi|150006579|ref|YP_001301323.1| CorC/HlyC family transporter associated protein [Bacteroides
           vulgatus ATCC 8482]
 gi|149935003|gb|ABR41701.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Bacteroides vulgatus ATCC 8482]
          Length = 427

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 126/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF +    ++M SR+ +  +E      + +    +   S +PVY  S DN 
Sbjct: 186 ESNILEGIIRFGEETAKEVMTSRLDMVDLEINTPYSDVLKCIVENAYSRIPVYAESRDNI 245

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++     K +N           L++   FVP + ++ DLL + Q ++I 
Sbjct: 246 KGILYIKDLLPHL----GKGDNFRWQ------TLVRPAYFVPETKMIDDLLRDFQANKIH 295

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++     ++D T+I +A+T L +  K
Sbjct: 296 IAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDDEERTYVKLNDRTYIFEAKTLLSDFYK 355

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D     K E D D+L GL+  +    P   E  L+   +   +L+ + R + +V++
Sbjct: 356 IMKADPALFEKVEGDADTLAGLLLEIKGEFPVLHE-RLDYGNYHFEVLEMNTRRILKVKV 414


>gi|110800603|ref|YP_694503.1| putative transporter [Clostridium perfringens ATCC 13124]
 gi|110675250|gb|ABG84237.1| putative transporter [Clostridium perfringens ATCC 13124]
          Length = 421

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F  +++ DIM+ RV++ AV   AT  E + + ++   S +PVY  S+D+  G++++
Sbjct: 194 NVFEFGDLQVKDIMVQRVNVIAVNVTATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNV 253

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+I         ++  N N+        +   F      +++L   ++ +R  +A+V+D
Sbjct: 254 KDLI------LLDSDEENFNVTEYMREPFRTFEFKK----ITELFAEMKTTRNHIAVVLD 303

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT G+V+ ED++  ++ DI  E+  +   I  + +N F+VD  T L +L+ +IG + 
Sbjct: 304 EYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIKENEFVVDGSTRLSDLSDMIGFEI 363

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 ++ DS+GG +   L R+P  GE + +   F +++ + D   V++VR+
Sbjct: 364 ES----EEFDSIGGYVIGYLGRMPKVGEEI-KTNDFRVIVEELDRNRVKKVRV 411


>gi|292493858|ref|YP_003529297.1| CBS domain containing protein [Nitrosococcus halophilus Nc4]
 gi|291582453|gb|ADE16910.1| CBS domain containing protein [Nitrosococcus halophilus Nc4]
          Length = 294

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 121/223 (54%), Gaps = 14/223 (6%)

Query: 86  KIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISY 145
           ++++ DIM+ R  +  VE      E + +  +   S  PV   S D+  G++  +D++ Y
Sbjct: 62  EMQVRDIMVPRSQMVVVERDNPPEETLEVITQSAHSRFPVIGESRDDIVGILLAKDMLLY 121

Query: 146 ISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTD 205
                A++ NI         ++++  +F+P S  ++ LL   + SR  MA+V+DE+GGT 
Sbjct: 122 CQQREARSFNIR--------DILRPAVFIPESKRLNVLLREFRASRNHMAIVVDEYGGTA 173

Query: 206 GLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKG 264
           GLV+ ED++  ++ +I  EH  ++ + I    D+ + + A T +E+  +  GTD +    
Sbjct: 174 GLVTIEDVLEQIVGEIEDEHDIAEDAFIFHRGDDNYTIKALTPIEDFNEYFGTDFS---- 229

Query: 265 EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +++ D++GGL+ +   R+P RGE +  I  FE  +L AD R +
Sbjct: 230 DEEFDTIGGLVLNGFGRVPERGEAI-SISDFEFKVLRADSRRI 271


>gi|160903258|ref|YP_001568839.1| hypothetical protein Pmob_1827 [Petrotoga mobilis SJ95]
 gi|160360902|gb|ABX32516.1| protein of unknown function DUF21 [Petrotoga mobilis SJ95]
          Length = 448

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 127/248 (51%), Gaps = 11/248 (4%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  ++EK +    L  +   + +IM  RV I A+ED  T+ E + +  + G S +PV+
Sbjct: 190 EGVIEKSEKYLMQRSLEMKDTSVKEIMTPRVDILAIEDTKTMEELIKIINEEGYSRIPVF 249

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K +LDN  G+V+ +D+   +  +   T    L +      ++    FVP +M + D+   
Sbjct: 250 KETLDNVIGIVYAKDIFKKLDEVKDFTKLQKLRV----VEIMHKPFFVPITMKIRDVFRL 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNTFIVDA 244
              +   MA+V+DE+GGT GLV+ EDI+  +  +I  E+  +S ++ I  V++N  +VD 
Sbjct: 306 FLNNHTHMAIVVDEYGGTAGLVTLEDIIEEMTGEIFDEYDDYSDETNIIRVAENVILVDG 365

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
            T + ++ +    + +    E + +++GG +     R P  GE+   I   E  I+   +
Sbjct: 366 TTPINDVER----ELDIEFPETEFETIGGFLLERFKRFPKPGEIYY-IENIEFEIVSVTI 420

Query: 305 RCVRRVRI 312
             + +V+I
Sbjct: 421 NKIDKVKI 428


>gi|257386949|ref|YP_003176722.1| hypothetical protein Hmuk_0885 [Halomicrobium mukohataei DSM 12286]
 gi|257169256|gb|ACV47015.1| protein of unknown function DUF21 [Halomicrobium mukohataei DSM
           12286]
          Length = 470

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 129/249 (51%), Gaps = 15/249 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E E+E+    LRF      ++M  R+ + A+   A+V EA+    + G + +PVY
Sbjct: 214 EGVLDEEEREMLQRTLRFNNTIAKEVMTPRLDMEAISKDASVEEAIQQCVQSGHARVPVY 273

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + SLDN  G+ H+RD++    +  A+T         + ++LI+  L VP S  V DLLT 
Sbjct: 274 EGSLDNVIGIAHLRDLVRDRDYSDAET---------ALADLIEPTLHVPESKNVDDLLTE 324

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++  R+ M +VIDE G T+GLV+ ED+   ++ +I      +      V D   +V    
Sbjct: 325 MRRERLHMVIVIDEFGTTEGLVTMEDLTEEIVGEILEGEEEEPIEF--VGDGEVVVKGEV 382

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           ++EE+ + +  D    +GE+  +++ G IF+   R+   GE + E    EIV+   +   
Sbjct: 383 NIEEVNEAM--DLELPEGEE-FETIAGFIFNRAGRLVEEGERI-EFDSVEIVVERVENTR 438

Query: 307 VRRVRIRRL 315
           + + R+ R+
Sbjct: 439 IMKARLSRI 447


>gi|284163344|ref|YP_003401623.1| hypothetical protein Htur_0049 [Haloterrigena turkmenica DSM 5511]
 gi|284012999|gb|ADB58950.1| protein of unknown function DUF21 [Haloterrigena turkmenica DSM
           5511]
          Length = 467

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 129/239 (53%), Gaps = 12/239 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +   I RF    + ++M  R+ + AV   A + EA+    + G + +PVY+ SLDN  G+
Sbjct: 217 MLQRIFRFNNTIVKEVMTPRLDMTAVPKDAGIDEAIETCIQSGHARVPVYEGSLDNVLGV 276

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           VH+RD++  +++   + +++ L       +LI+  L VP S  V +LLT ++E+R+ MA+
Sbjct: 277 VHIRDLVRDLNYGETEADDLELE------DLIQPTLHVPESKNVDELLTEMRENRMHMAI 330

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           VIDE G T+GLV+ ED++  ++ +I      +   I  + D T IV    ++E++ + + 
Sbjct: 331 VIDEFGTTEGLVTVEDMIEEIVGEILKSGEDEP--IEQLDDRTVIVRGEVNIEDVNEALE 388

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
            D   L   ++ +++ G IF+   R+   GE +    G  I +   +   + + R+R+L
Sbjct: 389 ID---LPEGEEFETIAGFIFNRAGRLVEEGEEIT-YDGVRITVETVENTRIMKARLRKL 443


>gi|297617686|ref|YP_003702845.1| hypothetical protein Slip_1517 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145523|gb|ADI02280.1| protein of unknown function DUF21 [Syntrophothermus lipocalidus DSM
           12680]
          Length = 439

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G     E  + + +  F      ++M+ R  I  +    T  E + +  ++G +  P+ 
Sbjct: 191 QGYLDIVEGNLLSKVFTFSDRVAREVMVPRQDIICLYTDDTYEEVLELIRQHGHTRYPLC 250

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +   D+  G++H+RD++          + + LNI    ++L ++IL VP  ML+++L+  
Sbjct: 251 EGDKDHVIGLIHIRDILELAG------SPLPLNI----ADLKRDILIVPEGMLIAELMQK 300

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++SR  MA+V DE GGT GL++ EDI+  L+ +I  E       I    +  +++  R 
Sbjct: 301 MRQSRTHMAIVADEFGGTAGLITMEDILEELVGEIYDEFDLTPPEIVKNEEGEYVISGRV 360

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            LEEL   +  D +    + +VD++GGLIFS+L R P  G+ V +I  +   I + D   
Sbjct: 361 LLEELEDFLDIDFD---EDDEVDTIGGLIFSLLGRKPQAGDYV-DIGKYRFEISEVDGMR 416

Query: 307 VRRVRI 312
           + +VR+
Sbjct: 417 ILKVRV 422


>gi|302520627|ref|ZP_07272969.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302429522|gb|EFL01338.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 453

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 126/261 (48%), Gaps = 27/261 (10%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           ++ EG       E+F   L    +  +++M  RV + A+ + A+  +A  +    G S  
Sbjct: 192 SAAEGALEPDSAELFIRTLHLNDLTAENVMTPRVEVQALAEGASALDAANLAHATGLSRF 251

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+  LD   G VH+RDV++      A+T           ++L    L VP S+    L
Sbjct: 252 PVYREHLDEVTGTVHIRDVLALEPAARARTRV---------TDLATPPLLVPDSLPADTL 302

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS------MISAVSD 237
           L  ++ +R  MA+VIDE+GGT G+V+ EDIV  ++ ++  EH  +++        SA   
Sbjct: 303 LARMRAART-MAVVIDEYGGTAGVVTVEDIVEEVVGEVRDEHDPEETEDLVPGAPSADGR 361

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV------LE 291
            T+  D    L++L ++IG D      E   +++ GL+ + L RIP  G+VV        
Sbjct: 362 ETWEADGSLRLDQL-RLIGLDAP----EGPYETVAGLLATRLGRIPGAGDVVELGELDAT 416

Query: 292 IPGFEIVILDADVRCVRRVRI 312
             G+E  +L  +     RVR+
Sbjct: 417 ARGWEFTVLSVEHHRAERVRV 437


>gi|257068879|ref|YP_003155134.1| CBS domain-containing protein [Brachybacterium faecium DSM 4810]
 gi|256559697|gb|ACU85544.1| CBS domain-containing protein [Brachybacterium faecium DSM 4810]
          Length = 444

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 124/245 (50%), Gaps = 22/245 (8%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E+++   +   R   + ++M+ R  +  +   A+  +AM +F + G S +PV  +S+D
Sbjct: 193 EGERDMIQGVFDLRGTMVRELMVPRPDMVTLSADASAEKAMRLFVRSGYSRIPVIGDSVD 252

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + RGM++++DV+  I   +      +   Q     +++   F P  +    +L  +Q S 
Sbjct: 253 DLRGMLYVKDVMRAIHSPW------DPRPQRPVHEIMRAARFAPEFLAADAVLAQMQTSH 306

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
           + + +++DE+GG  G+V+ EDI+  ++ DI  EH  ++  I  + +  + V AR  L E+
Sbjct: 307 VHITVLVDEYGGVAGIVTIEDILEEIVGDIADEHDRREPEIEDLGEGRYRVPARAGLSEV 366

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI----LDADVRCV 307
             + G + +    + D+DS+GGL+  V  R+P        IPG   +     L+A+    
Sbjct: 367 GDLFGLELD----DDDIDSVGGLLAKVTGRVP--------IPGTHAITHGLELEAEKSTG 414

Query: 308 RRVRI 312
           RR R+
Sbjct: 415 RRKRL 419


>gi|222054872|ref|YP_002537234.1| protein of unknown function DUF21 [Geobacter sp. FRC-32]
 gi|221564161|gb|ACM20133.1| protein of unknown function DUF21 [Geobacter sp. FRC-32]
          Length = 433

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 115/222 (51%), Gaps = 17/222 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+FS  E E   NI  F    + ++M+ R  + A++   +  E +    +   +  PV+ 
Sbjct: 197 GVFSAAESEYIRNIFDFTHTSVREVMVPRTRMAALDLDLSRKEMLDFVLENEYTRYPVFH 256

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            S++N  G+VH++D++  I        + ++N       +I+   +VP    V+DLL  +
Sbjct: 257 GSVENIAGVVHLKDLLGRI----VTEPDFDIN------TIIRPPFYVPEGKRVNDLLKEM 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q  R  MALV+DE+GG +GLV+ ED++  L+ +I  EH      +  + D + +VDA   
Sbjct: 307 QRKRTHMALVVDEYGGLNGLVTTEDLLEELVGEIEDEHDIGPGRVQRLPDGSLMVDALIS 366

Query: 248 LEELAKIIGTDCNCLKGEQDV--DSLGGLIFSVLDRIPARGE 287
           + ++  ++G     +K  +D+  D+L GLI   L R P +GE
Sbjct: 367 INDVEDLLG-----IKLPEDIPYDTLAGLILDQLGRFPEKGE 403


>gi|18309012|ref|NP_560946.1| hemolysin-related protein [Clostridium perfringens str. 13]
 gi|168206177|ref|ZP_02632182.1| putative transporter [Clostridium perfringens E str. JGS1987]
 gi|168210506|ref|ZP_02636131.1| putative transporter [Clostridium perfringens B str. ATCC 3626]
 gi|168217742|ref|ZP_02643367.1| putative transporter [Clostridium perfringens NCTC 8239]
 gi|182625355|ref|ZP_02953128.1| integral membrane protein with CBS domains [Clostridium perfringens
           D str. JGS1721]
 gi|18143687|dbj|BAB79736.1| probable hemolysin-related protein [Clostridium perfringens str.
           13]
 gi|170662309|gb|EDT14992.1| putative transporter [Clostridium perfringens E str. JGS1987]
 gi|170711411|gb|EDT23593.1| putative transporter [Clostridium perfringens B str. ATCC 3626]
 gi|177909352|gb|EDT71804.1| integral membrane protein with CBS domains [Clostridium perfringens
           D str. JGS1721]
 gi|182380198|gb|EDT77677.1| putative transporter [Clostridium perfringens NCTC 8239]
          Length = 421

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F  +++ DIM+ RV++ AV   AT  E + + ++   S +PVY  S+D+  G++++
Sbjct: 194 NVFEFGDLQVKDIMVQRVNVIAVNVTATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNV 253

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+I         ++  N N+        +   F      +++L   ++ +R  +A+V+D
Sbjct: 254 KDLI------LLDSDEENFNVTEYMREPFRTFEFKK----ITELFAEMKTTRNHIAVVLD 303

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT G+V+ ED++  ++ DI  E+  +   I  + +N F+VD  T L +L+ +IG + 
Sbjct: 304 EYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIKENEFVVDGSTRLSDLSDMIGFEI 363

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 ++ DS+GG +   L R+P  GE + +   F +++ + D   V++VR+
Sbjct: 364 ES----EEFDSIGGYVIGYLGRMPKVGEEI-KTNDFRVIVEELDRNRVKKVRV 411


>gi|288916971|ref|ZP_06411343.1| CBS domain containing protein [Frankia sp. EUN1f]
 gi|288351680|gb|EFC85885.1| CBS domain containing protein [Frankia sp. EUN1f]
          Length = 449

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 117/212 (55%), Gaps = 11/212 (5%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++  ++       + ++M+ R  +  +E   TV +A+ +  + G S +PV   S+D+  
Sbjct: 189 RDMIASVFELGDTLVREVMVPRPDMLFIESDKTVRQAISLALRSGFSRIPVIGESVDDVV 248

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+  ++D++ +       +           + +++  + VP S    DLL  +Q SR  M
Sbjct: 249 GIAFLKDMVGWEREGREDSRV---------AEIMRAPVLVPESKPADDLLREMQASRTHM 299

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+VIDE+GGT GLV+ EDI+  ++ +IT E+ S    +  + D+T  V AR D+++LA++
Sbjct: 300 AVVIDEYGGTAGLVTIEDILEEIVGEITDEYDSATPPVEWLDDDTARVTARLDVDDLAEL 359

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            G +   + G +DV+++GGL+ S L R+P  G
Sbjct: 360 FGVE--DVPGARDVETVGGLLASALGRVPIPG 389


>gi|257463576|ref|ZP_05627968.1| integral membrane protein [Fusobacterium sp. D12]
 gi|317061131|ref|ZP_07925616.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. D12]
 gi|313686807|gb|EFS23642.1| magnesium and cobalt efflux protein corC [Fusobacterium sp. D12]
          Length = 427

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 137/247 (55%), Gaps = 14/247 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+ F +    ++M  R S+ A E   T+ +      + G S +PVY
Sbjct: 183 EGIIEEDEKEMIHSIVGFGETTAKEVMTPRTSMTAFEGSKTIDDIWDTLMEDGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + ++DN  G+++++D++S +     K+ N N  I+     L++   FVP +  + ++L  
Sbjct: 243 EETIDNILGVLYIKDIMSQV-----KSGNTNQPIR----ELVRPAYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GL++ ED++  ++ +I       ++  +  V +N + VDA 
Sbjct: 294 FKIKKVHIAMVLDEYGGIGGLLTIEDLIEEIVGEIRDEFDEEEEEFVRKVGENFYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            D+E L K +G     L   +D +SLGGLI + L R+  +G+  LE+   ++ +L+ D  
Sbjct: 354 IDIETLDKELGIQ---LPISEDYESLGGLITTELGRVAEKGD-ELELENVKLQVLEMDKM 409

Query: 306 CVRRVRI 312
            + +V I
Sbjct: 410 RISKVLI 416


>gi|302549910|ref|ZP_07302252.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302467528|gb|EFL30621.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 446

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 127/253 (50%), Gaps = 22/253 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG       E+F   L    +  +++M  RV + A+E +AT+ +        G S  PVY
Sbjct: 195 EGDLEADTAELFVRTLNLADLTAENVMTPRVQVVALEVQATLEDVANATRATGLSRFPVY 254

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + +LD+  G  H++DV++  +    +       I +SE  L++  L VP ++ V  LL  
Sbjct: 255 RGTLDSVVGTAHVKDVLAVPAERRTR-------IFVSE--LMREPLLVPETLTVDRLLDR 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNT----F 240
           +   R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH  H    +  A +D +    +
Sbjct: 306 LSGKRT-MAVVIDEYGGTAGVATLEDIVEEVVGEVRDEHDPHELPDLAPAGTDESGHALY 364

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
             D    ++ L +I          E   ++L GL+ +VL RIPA G+  LE+ G+ + +L
Sbjct: 365 SADGSARVDHLERI-----GLRAPEGPYETLAGLVATVLGRIPAVGD-TLEVAGWRMEVL 418

Query: 301 DADVRCVRRVRIR 313
           DA  R   RV +R
Sbjct: 419 DATGRRAARVLLR 431


>gi|297625035|ref|YP_003706469.1| hypothetical protein Trad_2825 [Truepera radiovictrix DSM 17093]
 gi|297166215|gb|ADI15926.1| protein of unknown function DUF21 [Truepera radiovictrix DSM 17093]
          Length = 496

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 126/243 (51%), Gaps = 16/243 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+    E+E+   I+   +  + ++M  RV + A+ + AT+ E + +  K+G S +PVY 
Sbjct: 232 GVIEAHEQEMIRGIIDLEETVVREVMTPRVDVVAISEDATLEELLELVTKHGYSRLPVYS 291

Query: 128 NSLDNPRGMVHMRDVISYISHMYA-KTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
            ++DN RG V+ RD+++Y+    A  T  +        ++L+    +VP ++ + +LL +
Sbjct: 292 ETIDNVRGTVYARDLLAYLGRSEALHTTRV--------ADLMTPAQYVPETLSILNLLRD 343

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDAR 245
           ++  +  +A+V+DE GGT G+V+ EDI+  +  +I  E   +++  I  + +  F +   
Sbjct: 344 MRARKNHIAIVVDEFGGTAGIVTLEDIIEEITGEIYDETDQEEAAPIVPLDEGVFRIQGS 403

Query: 246 TDLEELAKIIGTDCNCLKGE-QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
             LEE    +G +     GE  + D+L G + S    IP  GE  L+I      I +AD 
Sbjct: 404 AHLEE----VGAELKLTLGEGGEYDTLAGFLISRFGHIPQPGE-TLDIGTCSFTIEEADE 458

Query: 305 RCV 307
           R V
Sbjct: 459 RRV 461


>gi|308234192|ref|ZP_07664929.1| hypothetical protein AvagD15_04049 [Atopobium vaginae DSM 15829]
 gi|328944449|ref|ZP_08241911.1| hemolysin [Atopobium vaginae DSM 15829]
 gi|327491033|gb|EGF22810.1| hemolysin [Atopobium vaginae DSM 15829]
          Length = 443

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 132/248 (53%), Gaps = 18/248 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  SE EK + ++I         ++MI RV +  +ED AT+ E + + +K G S +P+Y 
Sbjct: 192 GELSEEEKSMIHDIFDLADTVAREVMIPRVDLTVLEDSATLGEVLDVMQKTGYSRIPIYH 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++D   G+ H++D+I      +   N +   ++ +E        FVP +  +  LL+ +
Sbjct: 252 ENIDRIVGIAHIKDLIGPCVGEHCMGNPVVGYLRKAE--------FVPDTKDIIPLLSEM 303

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           +++  +M +V+DE+GGT G+++ EDIV  ++ +I  E       ++ ++D+ +IVD R  
Sbjct: 304 RQNHEQMVIVVDEYGGTAGVITIEDIVEEIVGEIEDEFDPDNKYLTKINDHEWIVDGRFS 363

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +++ A+ +G     L+  +  +++ G I  + D +P +G  V  + G+        V+ V
Sbjct: 364 VDD-ARELGWP---LQDGEGFETVAGFILDIADGLPEQGS-VFHVEGYTF-----RVQSV 413

Query: 308 RRVRIRRL 315
           RR RI RL
Sbjct: 414 RRKRICRL 421


>gi|217033878|ref|ZP_03439302.1| hypothetical protein HP9810_870g10 [Helicobacter pylori 98-10]
 gi|216943641|gb|EEC23086.1| hypothetical protein HP9810_870g10 [Helicobacter pylori 98-10]
          Length = 449

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 132/251 (52%), Gaps = 19/251 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI    E EI  N + F      +IM  R  +  ++++ +  E + +  K   +  P  
Sbjct: 207 EGIIDSVEGEIIKNAVDFSDTSAKEIMTPRKDMVCLDEENSYEENIDIVLKSRFTRYPYC 266

Query: 127 KNSLDNPRGMVHMRDVIS---YISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           K S DN  GMVH+RD++S   +   M+                +++ ++ VP S  +S +
Sbjct: 267 KGSKDNIIGMVHIRDLLSRSIFTPEMH------------DFKQIVRKMIIVPESASISQI 314

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +++ +I  ALVIDE+GGT GL++ EDI+  +M +I+ E+  K+  ++ + +  F ++
Sbjct: 315 LIKMKKEQIHTALVIDEYGGTAGLLTMEDIIEEIMGEISDEYDLKQEGVNKLEEGVFELE 374

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
              DLE + +++  + +    E +  +LGG +FS+L+R+P  G+ ++   G+   +L  D
Sbjct: 375 GMLDLESVEEVLHIEFD---KECEQVTLGGYVFSLLERMPMEGDTIIS-HGYLFEVLSVD 430

Query: 304 VRCVRRVRIRR 314
              ++R++  +
Sbjct: 431 GARIKRLKASK 441


>gi|253827333|ref|ZP_04870218.1| magnesium and cobalt efflux protein CorC [Helicobacter canadensis
           MIT 98-5491]
 gi|313141541|ref|ZP_07803734.1| magnesium and cobalt efflux protein CorC [Helicobacter canadensis
           MIT 98-5491]
 gi|253510739|gb|EES89398.1| magnesium and cobalt efflux protein CorC [Helicobacter canadensis
           MIT 98-5491]
 gi|313130572|gb|EFR48189.1| magnesium and cobalt efflux protein CorC [Helicobacter canadensis
           MIT 98-5491]
          Length = 439

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 124/231 (53%), Gaps = 17/231 (7%)

Query: 62  IDASLEGIFSET-EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +  SL+G + +T E EI  N + F      +IM  R  +  + D  +  E M +      
Sbjct: 191 VGESLKGGYLDTIENEIIQNAVSFSDTMAKEIMTPRKDMICLYDDNSYEENMQIVTTTKH 250

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           +  P  K   DN  GMVH+RD++  +      ++N +  ++     L++ ++ VP S  +
Sbjct: 251 TRYPYCKEGKDNIIGMVHLRDLLETM-----LSDNPSKELE----KLVREMIIVPESASI 301

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           S++L  +   +I  ALV+DE+GGT GL++ EDI+  ++ DI+ EH  K      + ++T+
Sbjct: 302 SNILIQMNRRQIHTALVVDEYGGTAGLLTMEDILEEVIGDISDEHDKKSEDYHKIDEDTY 361

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVV 289
             D   DLE +A ++G     +  E+D +  ++GG +F++L+R+P  G+V+
Sbjct: 362 SFDGMLDLERVADVLG-----ITFEEDTEQVTIGGYVFNLLERMPVVGDVI 407


>gi|307330992|ref|ZP_07610123.1| CBS domain containing protein [Streptomyces violaceusniger Tu 4113]
 gi|306883378|gb|EFN14433.1| CBS domain containing protein [Streptomyces violaceusniger Tu 4113]
          Length = 436

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 124/227 (54%), Gaps = 19/227 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEQESLIEDEERRMVHSVFELGDTLVREVMVPRTDLVVIERFKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + +E+ L+   +    FVP +  
Sbjct: 235 PVTGENEDDIVGVVYLKDLV--------RKTHIN---REAEAELVSTTMRPATFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   I  +SD T
Sbjct: 284 AGDLLREMQQERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPIEDLSDGT 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
             V AR  L +L ++ GTD      ++DV+++GGL+   L R+P  G
Sbjct: 344 HRVTARLALGDLGELYGTDLE----DEDVETVGGLLAKALGRVPIAG 386


>gi|313146085|ref|ZP_07808278.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134852|gb|EFR52212.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 417

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 130/240 (54%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ + +  + +        S +P+Y  + DN 
Sbjct: 177 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTSFKDVLQCIIDNAYSRIPIYSGTRDNI 236

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 237 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 286

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 287 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 346

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   + +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 347 ITKVNEDDFEKVDGDADTLAGLLLEIKGEFPALHEKVL-YHHYEFEVLAMDSRRILKVKF 405


>gi|224417998|ref|ZP_03656004.1| magnesium and cobalt efflux protein CorC [Helicobacter canadensis
           MIT 98-5491]
          Length = 441

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 124/231 (53%), Gaps = 17/231 (7%)

Query: 62  IDASLEGIFSET-EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +  SL+G + +T E EI  N + F      +IM  R  +  + D  +  E M +      
Sbjct: 193 VGESLKGGYLDTIENEIIQNAVSFSDTMAKEIMTPRKDMICLYDDNSYEENMQIVTTTKH 252

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           +  P  K   DN  GMVH+RD++  +      ++N +  ++     L++ ++ VP S  +
Sbjct: 253 TRYPYCKEGKDNIIGMVHLRDLLETM-----LSDNPSKELE----KLVREMIIVPESASI 303

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           S++L  +   +I  ALV+DE+GGT GL++ EDI+  ++ DI+ EH  K      + ++T+
Sbjct: 304 SNILIQMNRRQIHTALVVDEYGGTAGLLTMEDILEEVIGDISDEHDKKSEDYHKIDEDTY 363

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVD--SLGGLIFSVLDRIPARGEVV 289
             D   DLE +A ++G     +  E+D +  ++GG +F++L+R+P  G+V+
Sbjct: 364 SFDGMLDLERVADVLG-----ITFEEDTEQVTIGGYVFNLLERMPVVGDVI 409


>gi|163840662|ref|YP_001625067.1| hemolysin [Renibacterium salmoninarum ATCC 33209]
 gi|162954138|gb|ABY23653.1| hemolysin containing CBS domains [Renibacterium salmoninarum ATCC
           33209]
          Length = 430

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 128/235 (54%), Gaps = 11/235 (4%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           AS   +  + E +    +    +  +  +M+ R  I ++E  +++ +A+ +F + G S +
Sbjct: 180 ASESDMIEDDEVDFIQGVFDLDETLVRAVMVPRTDIVSIERGSSLKQALALFIRSGYSRV 239

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV  +  D   G+++++DV++    +        +       +L + + +VP S  V +L
Sbjct: 240 PVIGDDADQVLGVLYLKDVVATQQRLADGEQGPRVE------SLSREVRYVPESKQVGEL 293

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+    +A+VIDE+GGT GLV+ ED++  ++ +I  E+ ++ S +  +  N++ V 
Sbjct: 294 LKELQKESTHVAIVIDEYGGTAGLVTLEDLIEEIVGEIVDEYDAEDSEVEEIGPNSYRVS 353

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIV 298
           A+ ++E+L ++ G D +    + +VD++GGL+   L R+P  G  + EI G +++
Sbjct: 354 AQMNIEDLGELFGIDLD----DDEVDTVGGLLAKRLGRVPIVGSRI-EIDGLDLL 403


>gi|158313948|ref|YP_001506456.1| CBS domain-containing protein [Frankia sp. EAN1pec]
 gi|158109353|gb|ABW11550.1| CBS domain containing protein [Frankia sp. EAN1pec]
          Length = 484

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 116/212 (54%), Gaps = 11/212 (5%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++  ++       + ++M+ R  +  +E   TV +A+ +  + G S +PV   S+D+  
Sbjct: 189 RDMIASVFELGDTLVREVMVPRPDMVFIESDKTVRQAISLALRSGFSRIPVIGESIDDVV 248

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+  ++D++ +       +           + +++  + VP S    DLL  +Q SR  M
Sbjct: 249 GIGFLKDMVGWEREGRESSRV---------AEVMRPPVLVPESKPADDLLREMQASRTHM 299

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+VIDE+GGT GLV+ ED++  ++ +IT E+ S    +  + D+T  V AR D+++LA +
Sbjct: 300 AIVIDEYGGTAGLVTIEDVLEEIVGEITDEYDSATPPVEWLDDDTARVTARLDVDDLADL 359

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            G +   L G QDV+++GGL+ + L R+P  G
Sbjct: 360 FGVE--ELPGAQDVETVGGLLANALGRVPIPG 389


>gi|169343355|ref|ZP_02864359.1| putative transporter [Clostridium perfringens C str. JGS1495]
 gi|169298441|gb|EDS80527.1| putative transporter [Clostridium perfringens C str. JGS1495]
          Length = 408

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F  +++ DIM+ RV++ AV   AT  E + + ++   S +PVY  S+D+  G++++
Sbjct: 181 NVFEFGDLQVKDIMVQRVNVIAVNVTATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNV 240

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+I         ++  N N+        +   F      +++L   ++ +R  +A+V+D
Sbjct: 241 KDLI------LLDSDEENFNVTEYMREPFRTFEFKK----ITELFAEMKTTRNHIAVVLD 290

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT G+V+ ED++  ++ DI  E+  +   I  + +N F+VD  T L +L+ +IG + 
Sbjct: 291 EYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIKENEFVVDGSTRLSDLSDMIGFEI 350

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 ++ DS+GG +   L R+P  GE + +   F +++ + D   V++VR+
Sbjct: 351 ES----EEFDSIGGYVIGYLGRMPKVGEEI-KTNDFRVIVEELDRNRVKKVRV 398


>gi|317505462|ref|ZP_07963380.1| CBS domain protein [Prevotella salivae DSM 15606]
 gi|315663375|gb|EFV03124.1| CBS domain protein [Prevotella salivae DSM 15606]
          Length = 440

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 132/248 (53%), Gaps = 14/248 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      ++M SR  I  ++ +++  + +    +   S +PVY+++ DN 
Sbjct: 206 EQSMLQGIIRFGDETAKEVMTSRQDIVNLDIRSSFSDVLKCIVENNYSRIPVYQDNSDNI 265

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S   A              +LI+   FVP +  + DLL   QE+++ 
Sbjct: 266 RGVLYIKDLLPHLSKTDA----------FRWQSLIRPPYFVPETKKIDDLLREFQENKVH 315

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT GLV+ EDI+  ++ +I  E   ++   + ++ NT+I   +  L +  +
Sbjct: 316 IAIVVDEYGGTSGLVTLEDILEEIVGEINDEFDEEEKFYTKLNYNTYIFKGKVLLADFCR 375

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +   + E D DSL GL+  +    P+  E + E   F   IL  + R + +V++
Sbjct: 376 ILNLDDDEFDEVEGDADSLAGLLLELKGDFPSAHEKI-EYENFTFEILAIEERRIAKVKV 434

Query: 313 RRLVHFKN 320
              +H KN
Sbjct: 435 T--IHQKN 440


>gi|167763392|ref|ZP_02435519.1| hypothetical protein BACSTE_01766 [Bacteroides stercoris ATCC
           43183]
 gi|167698686|gb|EDS15265.1| hypothetical protein BACSTE_01766 [Bacteroides stercoris ATCC
           43183]
          Length = 450

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  +E + +  + +    +   S +PVY  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLEIRTSFKDVLKCIVENAYSRIPVYAETRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIRDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 ITKIDEETFDEVAGDADTLAGLLLELKGEFPALHEKV-TYDYYEFEVLEMDNRRILKVKF 436


>gi|86143853|ref|ZP_01062221.1| putative hemolysin [Leeuwenhoekiella blandensis MED217]
 gi|85829560|gb|EAQ48023.1| putative hemolysin [Leeuwenhoekiella blandensis MED217]
          Length = 428

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 135/242 (55%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F +++  ++MI R  I AVE + ++     MF + G S + ++++S+D
Sbjct: 201 DSEIQIFQNALEFSEVKSREVMIPRTEIVAVEKEESLDALNAMFTETGLSKILIFQDSID 260

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  +       ++ K  +I        +++++ ++FVP +MLV D+L  + + R
Sbjct: 261 DIVGYVHSFE-------LFKKPQSI--------TDVLRPVIFVPETMLVKDVLNVLIKKR 305

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             +A+VIDE+GGT G+++ EDIV  L  +I  EH S   +   V++  +   AR +++ +
Sbjct: 306 KSIAVVIDEYGGTSGMMTVEDIVEELFGEIEDEHDSVVLIEEEVAEGVYKFSARLEVDYI 365

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    +   L  +++ ++LGGLI +  + IP   +VV +I G++  I+      +  V+
Sbjct: 366 NETYKLE---LPEDENYETLGGLIVNHTEGIPEENDVV-DIEGYQFHIIQTSNTKIELVQ 421

Query: 312 IR 313
           +R
Sbjct: 422 VR 423


>gi|153006789|ref|YP_001381114.1| CBS domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030362|gb|ABS28130.1| CBS domain containing protein [Anaeromyxobacter sp. Fw109-5]
          Length = 423

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 125/248 (50%), Gaps = 23/248 (9%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
           T  E+ + +  FR     D+M+ R  + A++    V+E + +  + G S MP+Y+ SLD+
Sbjct: 191 TTSELIHAVFEFRDKIARDVMVPRTEVVALDVDTPVHEILRLMAEEGHSRMPIYRGSLDH 250

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSMLVSDLLTNIQ 188
             G++H RD++  ++H               E  ++++IL    FVP S  +  LL  +Q
Sbjct: 251 ILGVLHARDLVPMLAH--------------PELIVLRDILRPAHFVPWSKPIDQLLREMQ 296

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDARTD 247
             ++ MALV+DE+GG  G+ + ED++  ++ DI  E   ++   + A  D +F V   T 
Sbjct: 297 RRQLHMALVVDEYGGVMGVCTLEDVLEQIVGDIGDEFDQAEGRSVEAHGDGSFTVLGATA 356

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + E      +    +  +Q V+++ G + S+   IPA+G+      G+   + D D R V
Sbjct: 357 IAEFNA---SAAAAIPEDQGVETMAGFLNSLAGAIPAKGDRFFWR-GWVFTVADGDSRKV 412

Query: 308 RRVRIRRL 315
            +VR  R+
Sbjct: 413 TKVRAARV 420


>gi|315225509|ref|ZP_07867320.1| CBS domain protein [Capnocytophaga ochracea F0287]
 gi|314944530|gb|EFS96568.1| CBS domain protein [Capnocytophaga ochracea F0287]
          Length = 416

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 122/241 (50%), Gaps = 19/241 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E ++F N L F  ++  +IMI R  I AVE   ++   +  F   G S + +Y  ++D
Sbjct: 190 DSEVQMFQNALEFSGVKAREIMIPRTEIVAVELNESIENLIATFVSSGFSKILIYNENID 249

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  D       M+ K  NI          ++  I+ +P ++ ++++L  +   R
Sbjct: 250 DILGYVHSFD-------MFKKPKNIK--------EVLIPIVNIPETIQINEVLNILTRKR 294

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+V+DE+GGT G+V+ EDIV  L  +I  EH   K +   +SD  ++  AR ++E L
Sbjct: 295 KSMAVVLDEYGGTSGIVTLEDIVEELFGEIEDEHDKDKFIEEQISDTEYLFSARLEVEYL 354

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    D   +   ++ ++LGG I    + IP +GEV+ EIP F   I       +  VR
Sbjct: 355 NETYHLD---IPESEEYETLGGFIVLHNEGIPTQGEVI-EIPPFTFTIEACSQTKIETVR 410

Query: 312 I 312
           +
Sbjct: 411 L 411


>gi|332878735|ref|ZP_08446452.1| gliding motility-associated protein GldE [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332683372|gb|EGJ56252.1| gliding motility-associated protein GldE [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 428

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 118/221 (53%), Gaps = 15/221 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           EK++  +I+ F      ++M+ RV I A+ +     E +    K G S +PVY+ +LDN 
Sbjct: 194 EKKLLESIVSFGNTETCEVMVPRVDIFALSEDTPFSEVLSEIVKIGYSRIPVYRENLDNI 253

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+++++D++ YI                  + +++   FVP +  + DLL+  QE +I 
Sbjct: 254 TGVIYIKDLLPYIEKP-----------DFQWTKVMRKAFFVPENKKLDDLLSEFQEKKIH 302

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT G+++ EDI+  ++  I  E        S ++D+T+I + +T L++  +
Sbjct: 303 LAVVVDEYGGTCGIITLEDIMEEIVGSINDEFDDDDVTYSKINDHTYIFEGKTVLKDFYR 362

Query: 254 IIGT-DCNCLKGEQ---DVDSLGGLIFSVLDRIPARGEVVL 290
           I+   D N L  ++   + ++L G +  +    P +G+ ++
Sbjct: 363 IVKMDDENILLFDEKRGEAETLAGFLLEISGNFPQKGKPIV 403


>gi|226227118|ref|YP_002761224.1| transporter [Gemmatimonas aurantiaca T-27]
 gi|226090309|dbj|BAH38754.1| transporter [Gemmatimonas aurantiaca T-27]
          Length = 432

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 130/251 (51%), Gaps = 13/251 (5%)

Query: 65  SLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMP 124
           + E   S  E+E+   +  F +   +++M+ RV I  VE +    E +        S +P
Sbjct: 181 TTEADVSRDERELLLGVFDFGETTAEEVMVPRVDITGVERETPWSEMLDRIRSAEHSRIP 240

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ S+D   G+++++DV+  +                  ++++++ +F+P+S  ++DLL
Sbjct: 241 VYEGSIDEIVGILYVKDVLPAVLADEEPAEGW--------TSVMRSPVFIPTSKRIADLL 292

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
              +++R  +A+V DE+GGT GLV+ ED++  L+ +I  E+  ++ ++ +     + V  
Sbjct: 293 REFRQARRHIAIVADEYGGTAGLVTIEDVLEELVGEIGDEYDDEERLVESEEGTRYWVSG 352

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
           R  L++L+K +  D        DV ++GGL+  +L R+P  GE  L I  F  ++     
Sbjct: 353 RLTLDDLSKALSHDFT----RDDVSTVGGLVLELLGRVPKAGE-SLTIGPFRAIVERVVR 407

Query: 305 RCVRRVRIRRL 315
           R + RV + R+
Sbjct: 408 RKIERVFLERV 418


>gi|325473811|gb|EGC76999.1| hemolysin C [Treponema denticola F0402]
          Length = 258

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 134/254 (52%), Gaps = 18/254 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+ +E ++++   ++      + ++MI R+ ++ +       E +    + G S  PVY
Sbjct: 19  EGL-NEEKRDMIRGVVDLSDTAVKEVMIPRIDVDFLALDTPSDEILDRISESGHSRFPVY 77

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             S+DN  G+++++D+I  ++         N  I+L +  +++   FVP S  +  LL  
Sbjct: 78  DESIDNVIGILYVKDIIKLLTK--------NQKIELDK--IVRRAFFVPESKRIDALLAE 127

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
            +   + +A+ +DE+GG  G+V  EDI+  ++ DI  E  ++   I+ ++   ++ DAR 
Sbjct: 128 FKRRHVHIAVAVDEYGGVSGIVCMEDIIEEIVGDIQDEFDNEGEDITEIAPGVWLCDARV 187

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
           DL++LA+ I +D   +    + ++LGG +F +  +IPA+ E       F+ ++ D D   
Sbjct: 188 DLDDLAETIKSDDLPV---DEFETLGGFVFDLFGKIPAKYEKTA-WNDFDFIVQDMDGHK 243

Query: 307 VRRVRIRRLVHFKN 320
           V+ V+I   VH KN
Sbjct: 244 VKTVKI---VHNKN 254


>gi|255008361|ref|ZP_05280487.1| CorC/HlyC family transporter associated protein [Bacteroides
           fragilis 3_1_12]
          Length = 448

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 130/240 (54%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ + +  + +        S +P+Y  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTSFKDVLQCIIDNAYSRIPIYSGTRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYTVINDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   + +   K + D D+L GL+  +    PA  E VL    +E  +L  D R + +V+ 
Sbjct: 378 ITKVNEDDFEKVDGDADTLAGLLLEIKGEFPALHEKVL-YHHYEFEVLAMDSRRILKVKF 436


>gi|157826440|ref|YP_001495504.1| hemolysin C [Rickettsia bellii OSU 85-389]
 gi|172047816|sp|A8GUH1|HLYC_RICB8 RecName: Full=Possible hemolysin C
 gi|157801744|gb|ABV78467.1| Hemolysin C [Rickettsia bellii OSU 85-389]
          Length = 302

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 127/242 (52%), Gaps = 14/242 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFE-KYGRSWMPVYKNSLDN 132
           E+ I  N+L+ +   I+DIM+ R  I A++    + E     + K   +   +Y  +LDN
Sbjct: 60  ERNILANLLKLKGKTIEDIMVPRSDIAAIKLTTNIEELNESIKVKIPHTRTLIYDGTLDN 119

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
             G +H++D+   +            N +L +  LI+  +    SM + DLL  ++  + 
Sbjct: 120 IVGFIHIKDLFKALVTKQ--------NFRLKK--LIRKHIIAAPSMKLLDLLAKMRREKT 169

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM--ISAVSDNTFIVDARTDLEE 250
            +A+VIDE+GGTDGLV+ ED++  L+  I  EH  K        ++++T I +AR ++E 
Sbjct: 170 HIAIVIDEYGGTDGLVTIEDVMEALVGRIDDEHDQKSEYDNYKVINNSTIISNARVEVEV 229

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
           L +IIG        ++  D++GGL+ + +  +PA G  +      EI + DA+ R +++V
Sbjct: 230 LEEIIGEKLKDDDDDE-FDTIGGLVLTKMGNVPAVGTKINVSENIEIEVTDANPRSLKQV 288

Query: 311 RI 312
           +I
Sbjct: 289 KI 290


>gi|288802506|ref|ZP_06407945.1| CBS domain protein [Prevotella melaninogenica D18]
 gi|288335034|gb|EFC73470.1| CBS domain protein [Prevotella melaninogenica D18]
          Length = 421

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 120/242 (49%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F+  ++ D M+ R  I AVE+  ++ E   MF + G S + VY+  +D
Sbjct: 194 EDEVKIFQNALEFQDTKVRDCMVPRTEIKAVEENCSLEELQQMFIESGNSKIVVYEGDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + +G +H        S M+    N          + I+ + FVP +M    L+      +
Sbjct: 254 HIKGYIHS-------SEMFRSPKNW--------KDHIRQMPFVPETMAAHKLMQVFLIQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G+VS EDIV  +  DI  EH + K +   ++ N +++ AR +++++
Sbjct: 299 KSLGVVVDEFGGTSGIVSLEDIVEEIFGDIEDEHDNTKYIAKQINANEYVLSARLEIDKV 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++   D   L    D  ++GGL+  V    P   E+V  +  +E  I+   +  +  VR
Sbjct: 359 NEMFNLD---LPENDDYMTVGGLLLHVYQSFPKLNEIV-TVGQYEFKIIKKTMTKIELVR 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|302557003|ref|ZP_07309345.1| integral membrane transporter with CBS domains [Streptomyces
           griseoflavus Tu4000]
 gi|302474621|gb|EFL37714.1| integral membrane transporter with CBS domains [Streptomyces
           griseoflavus Tu4000]
          Length = 445

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 137/277 (49%), Gaps = 29/277 (10%)

Query: 42  LCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINA 101
           L +   L+  SH +G  LP+  A+L            ++ L F +  +D++M+ RV    
Sbjct: 185 LEELGHLIGESHEQGA-LPKDTAAL-----------LDHALEFSERTLDEVMVPRVDAVF 232

Query: 102 VEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQ 161
           V   AT  EA+ +   +G S  PV  +  D+  G+V + +++   +     T        
Sbjct: 233 VRKDATAAEAVELIAGHGHSNYPVLGDHPDDVDGVVGVAELMRLPADRLTGT-------- 284

Query: 162 LSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI 221
            +   + +  LF+P ++ + D +T ++E     A+V+DEHGG  G+V+YEDI   L+ DI
Sbjct: 285 -TAGEVARRPLFLPDTLPLPDAVTRMRERDDEFAVVLDEHGGVAGIVTYEDIAEELVGDI 343

Query: 222 TSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDR 281
             E  +  ++  A  D  ++VDA   L+E+A+  G +   L  E+D D++ GLI   L R
Sbjct: 344 ADETDTVTAVAVAHGDG-WLVDAGRRLDEVAEATGVE---LPEEEDYDTVAGLIVDRLGR 399

Query: 282 IPARGE-VVLEIPGFEIVILDA---DVRCVRRVRIRR 314
            PA G+ + +E+P     ++D    D     RVRI R
Sbjct: 400 FPAIGDRLTVELPDGAAAVIDVRTLDRHVPERVRIER 436


>gi|110801484|ref|YP_697379.1| transporter [Clostridium perfringens SM101]
 gi|110681985|gb|ABG85355.1| putative transporter [Clostridium perfringens SM101]
          Length = 421

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F  +++ DIM+ RV++ AV   AT  E + + ++   S +PVY  S+D+  G++++
Sbjct: 194 NVFEFGDLQVKDIMVQRVNVIAVNVTATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNV 253

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+I         ++  N N+        +   F      +++L   ++ +R  +A+V+D
Sbjct: 254 KDLI------LLDSDEENFNVTEYMREPFRTFEFKK----ITELFAEMKTTRNHIAVVLD 303

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT G+V+ ED++  ++ DI  E+  +   I  + +N F+VD  T L +L+ +IG + 
Sbjct: 304 EYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIKENEFVVDGSTRLSDLSDMIGFEI 363

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 ++ DS+GG +   L R+P  GE + +   F +++ + D   V++VR+
Sbjct: 364 ES----EEFDSIGGYVIGSLGRMPKVGEEI-KTNDFRVIVEELDRNRVKKVRV 411


>gi|325267030|ref|ZP_08133700.1| magnesium and cobalt efflux protein CorC [Kingella denitrificans
           ATCC 33394]
 gi|324981530|gb|EGC17172.1| magnesium and cobalt efflux protein CorC [Kingella denitrificans
           ATCC 33394]
          Length = 280

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 28/270 (10%)

Query: 21  DLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNN 80
           D  PS+       F +  ++ +     L++ SH +GI    ID   +   S  E     N
Sbjct: 4   DNPPSLFARLRQKFSSNILQDMDALRALLQQSHTQGI----ID---QDTLSRVE-----N 51

Query: 81  ILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMR 140
           +L F ++ + D MISR  ++ ++   ++   +        S  PV  +  D+  G++H +
Sbjct: 52  VLNFNQMHVRDAMISRAQMDVLKTTDSIERIIAYAVDTAHSRFPVIADDKDHIIGILHAK 111

Query: 141 DVISYISHMYAKTNNINLNI-QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           D++ +            LN  Q    N+I+  +FVP S  ++ LL   QE    MA+V+D
Sbjct: 112 DLLKF-----------TLNPEQFKLDNIIRPAVFVPESKPLNTLLKEFQEQHNHMAIVVD 160

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GG  GLV++ED++  ++  I  E   +++ IS VS   + V A+T+++++ +  GT  
Sbjct: 161 EYGGISGLVTFEDLIEEIVGKIEDEFDEEENYISPVSSERWRVHAKTEIDDINQYFGTQY 220

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           +      + D++GGLI   L  +P RGE V
Sbjct: 221 SS----DEADTIGGLIIHELGHLPVRGEKV 246


>gi|225378151|ref|ZP_03755372.1| hypothetical protein ROSEINA2194_03811 [Roseburia inulinivorans DSM
           16841]
 gi|225209957|gb|EEG92311.1| hypothetical protein ROSEINA2194_03811 [Roseburia inulinivorans DSM
           16841]
          Length = 316

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 126/244 (51%), Gaps = 9/244 (3%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+    E E+ +NI  F      DIM+ R +I A++   T  E +    +   S  PVY
Sbjct: 68  QGVLQANEAEMIHNIFEFGDKDAKDIMVHRKNIIAIDGTMTFLEMLDFTIENNYSRYPVY 127

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
            + +DN  G++H+++V++           I          LI+ + F+P +  ++ L T 
Sbjct: 128 IDDIDNIIGVLHIKEVLALCQKQEIYHTAIK-----DIKGLIREVDFIPETRNINTLFTM 182

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +Q ++  M +V+DE+G T G+V+ EDI+  ++ +I  EH  ++ MI  + D ++++D  T
Sbjct: 183 MQNAKTHMVIVVDEYGQTSGIVAMEDILEEIVGNIEDEHDQEEKMIEKLPDGSYLMDGMT 242

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE-VVLEIPGFEIVILDADVR 305
             EE  +I+      +  E + ++L G++ S+LDRIP   E    +  G+   +L  + +
Sbjct: 243 SAEEALEILKI---HIPEEDEFETLNGILISLLDRIPNDDEKFETDAFGYHFEVLQVENK 299

Query: 306 CVRR 309
            +++
Sbjct: 300 MIKK 303


>gi|168214008|ref|ZP_02639633.1| putative transporter [Clostridium perfringens CPE str. F4969]
 gi|170714474|gb|EDT26656.1| putative transporter [Clostridium perfringens CPE str. F4969]
          Length = 421

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           N+  F  +++ DIM+ RV++ AV   AT  E + + ++   S +PVY  S+D+  G++++
Sbjct: 194 NVFEFGDLQVKDIMVQRVNVIAVNVTATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNV 253

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D+I         ++  N N+        +   F      +++L   ++ +R  +A+V+D
Sbjct: 254 KDLI------LLDSDEENFNVTEYMREPFRTFEFKK----ITELFAEMKTTRNHIAVVLD 303

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT G+V+ ED++  ++ DI  E+  +   I  + +N F+VD  T L +L+ +IG + 
Sbjct: 304 EYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIKENEFVVDGSTRLSDLSDMIGFEI 363

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
                 ++ DS+GG +   L R+P  GE + +   F +++ + D   V++VR+
Sbjct: 364 ES----EEFDSIGGYVIGSLGRMPKVGEEI-KTNDFRVIVEELDRNRVKKVRV 411


>gi|119775710|ref|YP_928450.1| magnesium and cobalt efflux protein CorC [Shewanella amazonensis
           SB2B]
 gi|119768210|gb|ABM00781.1| magnesium and cobalt efflux protein CorC [Shewanella amazonensis
           SB2B]
          Length = 292

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 131/254 (51%), Gaps = 16/254 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA    + +E  +E+   +L    +R+ DIMI R  I A++  +TV E +        S 
Sbjct: 40  DAEQRDLITEDTREMIQGVLEVSDLRVRDIMIPRAQIVAIKIDSTVEELLATVIGSAHSR 99

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV  +  D+  G++  +D+I Y        NN +    L    +I+  + VP S  V  
Sbjct: 100 FPVVNDDKDHIEGILLAKDLIKY------GFNNSDEPFALE--KVIRPAVVVPESKRVDV 151

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE--HHS-KKSMISAVSDNT 239
           LL   +  R  MA+V+DE+GG  GLV+ EDI+  ++ +I  E  H S +++ I  V++  
Sbjct: 152 LLKEFRSQRYHMAIVVDEYGGVSGLVTIEDILEEIVGEIEDEFDHDSVEETEIRKVNNTV 211

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F+V A T +E+  +  GTD +    +++ D++GG++      +P R E +  I G E  +
Sbjct: 212 FMVKALTAIEDFNEEFGTDFS----DEEFDTVGGMVAHAFGHLPERNEQI-SIGGIEFKV 266

Query: 300 LDADVRCVRRVRIR 313
           + AD R + ++R++
Sbjct: 267 ISADTRRLIQLRVK 280


>gi|34531271|dbj|BAC86097.1| unnamed protein product [Homo sapiens]
          Length = 307

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 128/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      ++M SR +I  ++  +T  E +    +   S +PVY+++ DN 
Sbjct: 73  EQSMLKGIIRFGDETAKEVMTSRQNIVDLDIHSTYPEVLKCIAENNYSRIPVYQDNTDNI 132

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++             +     +LI+   FVP +  + DLL   QE+++ 
Sbjct: 133 RGILYIKDLLPHLEK----------PVSFRWQSLIRPPYFVPETKKIDDLLREFQENKVH 182

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   S ++ NTFI + +T L +  K
Sbjct: 183 IAIVVDEFGGTSGIVTLEDILEEIVGEINDEYDEEEKFYSKLNYNTFIFEGKTLLTDFCK 242

Query: 254 IIGTDCNCLKGEQ-DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D    +  + D D+L GL+  +    P+  E + E   +   +L  + R + R+++
Sbjct: 243 ILNVDDEEFEEVEGDADTLAGLLLEIKGDFPSIHEKI-EYKNYSFEVLGVEERRISRIKV 301


>gi|289581385|ref|YP_003479851.1| hypothetical protein Nmag_1713 [Natrialba magadii ATCC 43099]
 gi|289530938|gb|ADD05289.1| protein of unknown function DUF21 [Natrialba magadii ATCC 43099]
          Length = 477

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 131/241 (54%), Gaps = 12/241 (4%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +   I RF    + ++M  R+ + AV   A++ EA+    + G + +PVY+ SLDN +G+
Sbjct: 217 MLQRIFRFNNTIVKEVMTPRLDMTAVPKDASIDEAIETCIQSGHARVPVYEGSLDNVQGI 276

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           VH+RD++  +++   +  ++ L      ++LI+  L VP S  V +LLT ++E+R+ MA+
Sbjct: 277 VHIRDLVRDLNYGETEAEDLEL------ADLIQPTLHVPESKNVDELLTEMRENRMHMAI 330

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           VIDE G T+GLV+ ED+V  ++ +I      +   I  + + T +V    ++E++ + + 
Sbjct: 331 VIDEFGTTEGLVTMEDMVEEIIGEIL--EGGEDLPIEELDERTVMVRGEVNIEDVNEALE 388

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLV 316
            D   L   ++ +++ G IF+   R+   GE +    G  I +   +   + + R+R+L 
Sbjct: 389 ID---LPEGEEFETIAGFIFNRAGRLVEEGEEIT-YDGVRITVESVENTRIMKARLRKLT 444

Query: 317 H 317
            
Sbjct: 445 E 445


>gi|225019495|ref|ZP_03708687.1| hypothetical protein CLOSTMETH_03448 [Clostridium methylpentosum
           DSM 5476]
 gi|224947716|gb|EEG28925.1| hypothetical protein CLOSTMETH_03448 [Clostridium methylpentosum
           DSM 5476]
          Length = 428

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 123/226 (54%), Gaps = 17/226 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG+  + E ++  + L F +   +++++ RV I +VE  A+V E   +F  E++ R  +P
Sbjct: 183 EGVLEDHESQLVRSALDFDETTAEEVLVPRVDIVSVEVNASVEEMKQLFLTERFSR--VP 240

Query: 125 VYKNSLDNPRGMVHMRDVI-SYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           VY+ S+DN  G+++ +D   SYI       N  N++I+     L++  LF+P    +SDL
Sbjct: 241 VYERSIDNIVGVLYEKDFFRSYIQ------NGENIDIR----GLLQQPLFIPPQTKISDL 290

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  IQ  R  MA+V D++GG +G+V+ ED++  L+ +I  E       +  +    + V+
Sbjct: 291 LKQIQSVRAHMAVVTDQYGGVEGIVTLEDVLEELVGEIYDEDEEIVEDVQRLGSGLYRVN 350

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
               +E+L + IG +        D +++GG +F +L+ IP  GE V
Sbjct: 351 PDMAVEDLFEEIGFEPKNFS--SDSNTVGGWVFELLEHIPEPGEQV 394


>gi|153940309|ref|YP_001392210.1| CBS/transporter associated domain-containing protein [Clostridium
           botulinum F str. Langeland]
 gi|152936205|gb|ABS41703.1| CBS/transporter-associated domain protein [Clostridium botulinum F
           str. Langeland]
 gi|295320207|gb|ADG00585.1| CBS/transporter-associated domain protein [Clostridium botulinum F
           str. 230613]
          Length = 439

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 118/223 (52%), Gaps = 18/223 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+ +E EKE+ N+I  F     D++M  R  +  ++ +  + E +  L+ E+Y R  +PV
Sbjct: 200 GVINEKEKEMINSIFEFDDKLADEVMTPRTEVYLIDIEKPLKEYLDELIEERYSR--IPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           Y+ S+DN  G+++M+D +     H +      N++I+    +++    FVP +  + DL 
Sbjct: 258 YEGSIDNIIGILYMKDFLGEARKHGFE-----NVDIR----SILHPAYFVPETKNIDDLF 308

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +  MA++IDE+GG  G+VS ED++  +M +I  E+   +  I  + ++TFI+D 
Sbjct: 309 KELQAFKKHMAILIDEYGGFSGIVSIEDLIEEVMGNIEDEYDEDEPAIKKIDNDTFIIDG 368

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              +++       D       QD D++ G +  +L RIP   E
Sbjct: 369 MVSIDDFNDYFNIDIES----QDYDTINGFLIDLLGRIPMSAE 407


>gi|182438797|ref|YP_001826516.1| putative transport protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178467313|dbj|BAG21833.1| putative transport protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 432

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 135/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + ++E   T+ +A+ +  + G S M
Sbjct: 175 AEAESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVSIERYKTIRQALTLALRSGFSRM 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + SES+ +   +    FVP +  
Sbjct: 235 PVTGENEDDVVGIVYLKDLV--------RKTHIN---RESESDPVSTAMRPAAFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q  R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  
Sbjct: 284 AGDLLREMQRDRSHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVQELENGC 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           + V AR D+ +L  + G D      ++DV+++GGL+   L R+P  G   V+E+P    +
Sbjct: 344 YRVTARLDIGDLGDLFGLD---EYDDEDVETVGGLLAKALGRVPIAGASAVVELPDQRRI 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAESPAGRRNKI 414


>gi|269127452|ref|YP_003300822.1| hypothetical protein Tcur_3245 [Thermomonospora curvata DSM 43183]
 gi|268312410|gb|ACY98784.1| protein of unknown function DUF21 [Thermomonospora curvata DSM
           43183]
          Length = 442

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 119/213 (55%), Gaps = 10/213 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ + +++       + ++M+ R  I  +E   T+ +A+ +  + G S +PV   + D+ 
Sbjct: 188 ERAMIHSVFELGDTLVREVMVPRTDIVFIERDKTLRQALSLALRSGFSRIPVVGENEDDV 247

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM +++DV+  + H + +      + +L ES +++   +VP S  V +LL  +Q  +  
Sbjct: 248 VGMAYLKDVVRRV-HEHPE----GASRELVES-VMRPATYVPDSKPVDELLREMQAQQTH 301

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+VIDEHGGT GL++ EDI+  ++ +IT E+  ++  +  + D    V AR  + ELA+
Sbjct: 302 VAIVIDEHGGTAGLITIEDILEEIVGEITDEYDEERPRVEHLPDGAVRVTARLPVAELAE 361

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
           + G + +     ++VD++GGL+   L R+P  G
Sbjct: 362 LFGVELDV----EEVDTVGGLLAHALGRVPIEG 390


>gi|322420854|ref|YP_004200077.1| hypothetical protein GM18_3365 [Geobacter sp. M18]
 gi|320127241|gb|ADW14801.1| protein of unknown function DUF21 [Geobacter sp. M18]
          Length = 437

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 121/228 (53%), Gaps = 24/228 (10%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVE---DKATVYEAML--MFEKYGRSW 122
           GIFSETE    +N+  F    + ++M+ R  + A +       +   +L  M+ +Y    
Sbjct: 197 GIFSETEHTFIDNLFDFTHTAVREVMVPRTRVVAFDLNLSNEEILNGVLDNMYSRY---- 252

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY  S++   G +H +D++  +          + +I+    ++++  +FVP    VSD
Sbjct: 253 -PVYLGSIEETVGFIHGKDLLGRM------VREPDFDIR----SIVRPPIFVPEGKKVSD 301

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFI 241
           LL  +Q++R+ MA V+DE+G   G+V+ ED++  L+ +I  EH   + S +  ++D +F+
Sbjct: 302 LLKEMQKTRVHMAFVVDEYGSISGIVTTEDLLEELVGEIEDEHDVGEPSRVQVLADGSFL 361

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           VDA   + +L  ++ TD   L  +   D+L GLI + + R P +GE V
Sbjct: 362 VDALISISDLEDLLETD---LGEDLPYDTLAGLILNRIGRFPEQGEKV 406


>gi|153003696|ref|YP_001378021.1| CBS domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152027269|gb|ABS25037.1| CBS domain containing protein [Anaeromyxobacter sp. Fw109-5]
          Length = 374

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 124/251 (49%), Gaps = 13/251 (5%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A   G       EI +  L FR +   ++M+ R  I A+   A+  +   M  + G S 
Sbjct: 122 EAGRAGALDAPTAEIASRALAFRDLTAGEVMVPRSRIVALPRDASQEDLKRMLLEEGHSR 181

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           MPVY  SLD+  G V  +D    ++ +  +   I L+      +L++ + FVP +     
Sbjct: 182 MPVYDGSLDDLVGYVMAKD----LAAIAWERQLIVLD------DLLRPVHFVPEAAKAVH 231

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           +L ++Q  R ++A V+DEHGG  GL++ ED+V  L+ DI  E    +++    +D   +V
Sbjct: 232 VLRDLQRRRTQIAAVVDEHGGVAGLITLEDLVEELVGDIFGETEEPEALWQREADGAALV 291

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
                + E+ + +  D    +GE D  ++ GL  ++   +P RG  +    G E+ ++DA
Sbjct: 292 RGEAPIREVNRALSLDLP--EGE-DYSTVAGLCIALAGAVPERGTRLRAEDGTELEVVDA 348

Query: 303 DVRCVRRVRIR 313
             R VR VR+R
Sbjct: 349 SPRVVRLVRLR 359


>gi|329960934|ref|ZP_08299213.1| gliding motility-associated protein GldE [Bacteroides fluxus YIT
           12057]
 gi|328532220|gb|EGF59024.1| gliding motility-associated protein GldE [Bacteroides fluxus YIT
           12057]
          Length = 449

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 130/240 (54%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ + +  E +    +   S +P+Y ++ DN 
Sbjct: 208 ETNILEGIIRFGGETAKEVMTSRLDVVDLDIRTSFKEVLKCIVENAYSRIPIYADTRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 ITKIDEETFDEVAGDADTLAGLLLELKGEFPALHEKV-TYGRYEFEVLEMDNRRILKVKF 436


>gi|288800017|ref|ZP_06405476.1| CBS domain protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333265|gb|EFC71744.1| CBS domain protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 408

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 130/240 (54%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+++   I+RF    + ++M SR  I A+   ++  + +    +   S +PVY+N+ DN 
Sbjct: 172 EQKMLQGIVRFGDETVREVMTSRQDIVALNINSSFSDVLKSIVENNYSRIPVYQNNDDNI 231

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++    H+   T+            L++   FVP +  + D++ + +E+++ 
Sbjct: 232 KGVLYIKDLLP---HLTKPTS-------FKWQTLMRPPHFVPETKRLDDMMKDFKENKVH 281

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GL++ EDI+  ++ +I  E+  + +  S ++ NT++ D +T L ++ +
Sbjct: 282 IAIVVDEFGGTSGLITLEDILEEIVGEINDEYDEEDTSYSKLNYNTYVFDGKTLLSDVTR 341

Query: 254 IIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I+  D +     E D DSL GL+  +    P   E + E   F   IL  D R + +V+I
Sbjct: 342 ILEVDDDYFSEIEGDADSLAGLLLEIKGDFPTMHERI-EYRNFMFEILKVDGRRISKVKI 400


>gi|318061438|ref|ZP_07980159.1| integral membrane protein [Streptomyces sp. SA3_actG]
 gi|318079295|ref|ZP_07986627.1| integral membrane protein [Streptomyces sp. SA3_actF]
          Length = 453

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 126/261 (48%), Gaps = 27/261 (10%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           ++ EG       E+F   L    +  +++M  RV + A+ + A+  +A  +    G S  
Sbjct: 192 SAAEGALEPDSAELFIRTLHLNDLTAENVMTPRVEVQALAEGASALDAANLAHATGLSRF 251

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+  LD   G VH+RDV++      A+T           ++L    L VP S+    L
Sbjct: 252 PVYREHLDEVTGTVHIRDVLALEPAARARTRV---------TDLATPPLLVPDSLPADTL 302

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS------MISAVSD 237
           L  ++ +R  MA+VIDE+GGT G+V+ EDIV  ++ ++  EH  +++        SA   
Sbjct: 303 LARMRAART-MAVVIDEYGGTAGVVTVEDIVEEVVGEVRDEHDPEETEDLVPGAPSADGR 361

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV------LE 291
            T+  D    L++L ++IG D      E   +++ GL+ + L RIP  G+VV        
Sbjct: 362 ETWEADGSLRLDQL-RLIGLDAP----EGPYETVAGLLATRLGRIPEAGDVVELGELDAT 416

Query: 292 IPGFEIVILDADVRCVRRVRI 312
             G+E  +L  +     RVR+
Sbjct: 417 ARGWEFTVLSVEHHRAERVRV 437


>gi|29832128|ref|NP_826762.1| transport protein [Streptomyces avermitilis MA-4680]
 gi|29609246|dbj|BAC73297.1| putative transport protein [Streptomyces avermitilis MA-4680]
          Length = 435

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 136/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEDEERRMVHSVFELGDTLVREVMVPRTDLVVIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   S D+  GMV+++D++        +  +I+ +   +ES L+   +    FVP +  
Sbjct: 235 PVTGESEDDIVGMVYLKDLV--------RKTHISRD---AESELVSTAMRPATFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + D+ 
Sbjct: 284 AGDLLREMQQERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEDLGDDR 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
             V AR D+ +L ++ G +      ++DV+++GGL+   L R+P  G   V+E+P    +
Sbjct: 344 HRVTARLDIGDLGELYGIEAY---DDEDVETVGGLLAKALGRVPIAGASSVVELPDGREL 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAETSAGRRNKI 414


>gi|317153202|ref|YP_004121250.1| CBS domain-containing protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316943453|gb|ADU62504.1| CBS domain containing protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 272

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 133/253 (52%), Gaps = 16/253 (6%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE-AMLMFEKYGR 120
           ++A  EG     E  +  NIL F +  + +IM+ R  +   +  +TV + A ++  +   
Sbjct: 29  LEARAEGEIENEEVSMLLNILDFDEKHVSEIMVPRTDMACADASSTVGDIAEIIINQGAH 88

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           S +P++K + D   G+VH +D++  +         +     +  ++L++   FVP  M +
Sbjct: 89  SRIPIFKETRDYILGIVHAKDLLPPL---------LEGRRDMPVTSLMRPPFFVPEEMRL 139

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
             +L + +  +  MA+V DE+GGT G+V+ ED++  ++ +I+ E+   +   I  + DN 
Sbjct: 140 DKVLASFKREKHHMAIVQDEYGGTSGMVTMEDVLEEIVGEISDEYDQERPDEILEIEDNV 199

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           FIV  RT L+E++   G +     GE  VDS+GG + ++  RIP  GEV L +   +  I
Sbjct: 200 FIVSGRTLLDEVSDKCGFELES--GE--VDSIGGYVAAMAGRIPREGEVFL-VDNRQFTI 254

Query: 300 LDADVRCVRRVRI 312
           + +D R +  +RI
Sbjct: 255 IRSDERQIWSIRI 267


>gi|148263841|ref|YP_001230547.1| CBS domain-containing protein [Geobacter uraniireducens Rf4]
 gi|146397341|gb|ABQ25974.1| CBS domain containing protein [Geobacter uraniireducens Rf4]
          Length = 284

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 124/239 (51%), Gaps = 14/239 (5%)

Query: 76  EIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRG 135
           ++  +I       + +IM+ R  +  V   A V   +      G S +PVY  ++DN  G
Sbjct: 50  QMIRSIFALGDTVVREIMVPRTDMACVSVDAGVKNVLNAIIACGHSRIPVYDGTVDNIIG 109

Query: 136 MVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMA 195
           +++ +D++ Y        + I L        +++   F+P S  + +LL   ++ R+ +A
Sbjct: 110 LIYAKDLLKYWG---MDASAIVLR------KIVRAPYFIPESKNLEELLHEFKKKRVHIA 160

Query: 196 LVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKII 255
           +VIDE+GGT GLV+ ED++  ++ DI  E+  ++  +    D + IVDAR  +EEL +  
Sbjct: 161 IVIDEYGGTSGLVTIEDLLEQIVGDIQDEYDLEEDWLVIEPDGSVIVDARLPIEELEEHF 220

Query: 256 GTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
             +       +  D++GGLIF ++ RIPA G+ V +     + +L AD R + +VRI R
Sbjct: 221 DIEVE----REKFDTVGGLIFHLIGRIPATGDEV-DNGSIHMTVLGADERRISKVRIVR 274


>gi|255533947|ref|YP_003094319.1| hypothetical protein Phep_4066 [Pedobacter heparinus DSM 2366]
 gi|255346931|gb|ACU06257.1| protein of unknown function DUF21 [Pedobacter heparinus DSM 2366]
          Length = 438

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 131/250 (52%), Gaps = 14/250 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G     E E+  N+  F +  + +IM+ R  I  VE      E +      G S +PVY 
Sbjct: 195 GALDTNEHELIKNVFDFNERVVKNIMVPRTKIMGVELSTPKREVVEKIIAEGYSRLPVYD 254

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           + +D   G+VH +D++  ++           N +   +++I+   FVP +  ++DLL+ +
Sbjct: 255 DIIDKIIGIVHAKDILPLLAD----------NKEWVLADIIRKPYFVPETKKINDLLSEL 304

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q+ RI++A+VIDE GGT G+V+ EDIV  ++ +I  E+  +K  +  +SD  FI++A   
Sbjct: 305 QQKRIQIAIVIDEFGGTAGMVTLEDIVEEIVGEIQDEYDEEKPTVEKISDTEFIINAYAT 364

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           + ++ + +  D   L  ++D D++GGL+     +IP  G+   E  G+   IL    + +
Sbjct: 365 VYDVNEHLPHD---LPEDEDFDTVGGLVSHAFGKIPEVGDSE-ECYGYLFTILKKTEQNI 420

Query: 308 RRVRIRRLVH 317
             +++  +++
Sbjct: 421 ETIKLELVIN 430


>gi|254448599|ref|ZP_05062058.1| CBS domain containing protein [gamma proteobacterium HTCC5015]
 gi|198261788|gb|EDY86074.1| CBS domain containing protein [gamma proteobacterium HTCC5015]
          Length = 298

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 140/291 (48%), Gaps = 25/291 (8%)

Query: 32  PAFWTRTIRALCKTWKLMKLSHHKGIRLPR-IDASLEGIFSETEKEIFN--------NIL 82
           P+  +R  R+  +   L KL    G   P+ +D  LE +    E+ +F+         + 
Sbjct: 5   PSSSSRQGRSASQPNWLEKLGQAFGGNDPQNLDQILEVLRDAQERGLFDLHALAMVEGVF 64

Query: 83  RFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDV 142
              ++R+ DIMI R  +  +E  A   + + +  + G S  PV     D   G++  +DV
Sbjct: 65  EVTEMRVRDIMIPRSHMTVLEQGADFGDVLNILTESGHSRFPVIAGDRDELVGVLLAKDV 124

Query: 143 ISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHG 202
           + Y      +     L+      ++++ ++ +P S  +  LL   + SR  +A+V+DE+G
Sbjct: 125 LKYA----GRPEEFALD------DILRQVVIIPESKRLITLLNEFRSSRNHLAMVVDEYG 174

Query: 203 GTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDARTDLEELAKIIGTDCNC 261
           G  GLV+ ED++ V++ +I  EH S++   I       + V A T++EE      T  + 
Sbjct: 175 GVSGLVTIEDVLEVIVGEIDDEHDSEEDHYIRPHRKGHYTVHALTEIEEFNAFFKTTLS- 233

Query: 262 LKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
              ++D D++GG +  +L  +P RGE V E  G    +L AD R + R+++
Sbjct: 234 ---DEDADTIGGYVMRLLGHVPKRGEQV-ESEGILFTVLGADSRRIYRLKV 280


>gi|329954392|ref|ZP_08295484.1| gliding motility-associated protein GldE [Bacteroides clarus YIT
           12056]
 gi|328527660|gb|EGF54653.1| gliding motility-associated protein GldE [Bacteroides clarus YIT
           12056]
          Length = 450

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 128/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  +E +    + +    +   S +PVY  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLEIRTPFKDVLKCIVENAYSRIPVYAETRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIRDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 ITKIDEETFDEVAGDADTLAGLLLELKGEFPALHEKV-TYDCYEFEVLEMDNRRILKVKF 436


>gi|323694624|ref|ZP_08108790.1| CBS domain-containing protein [Clostridium symbiosum WAL-14673]
 gi|323501392|gb|EGB17288.1| CBS domain-containing protein [Clostridium symbiosum WAL-14673]
          Length = 453

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 113/222 (50%), Gaps = 7/222 (3%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM-LMFEKYGRSWMPV 125
           +G+    E E+  NI         DIM  R +I A++   ++ EA+  +  +   S  PV
Sbjct: 198 QGVLEAGEAEMITNIFELNDKEAGDIMTHRTNITALDASMSLDEAVTYILTEANNSRFPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           ++  +D+  G++HMRD + +      +  N+          L+++  F+P +  V  L  
Sbjct: 258 FEKDIDDIIGILHMRDALGFAEKEENRRKNLK-----ELDGLLRDAHFIPETRHVDTLFK 312

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q  +I M +V+DE+G T G+V+ EDI+  ++ +I  E+   +  IS   D +FI D  
Sbjct: 313 EMQSQKIHMEIVVDEYGQTAGIVTMEDILEEIVGNILDEYDEDEEYISRRDDGSFIFDGL 372

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
             L+E+ + +  + +  +  ++ D+L G + S LDRIP  GE
Sbjct: 373 APLDEVGEALDVEFDE-EDYENYDTLNGFLISKLDRIPKEGE 413


>gi|323487117|ref|ZP_08092425.1| hemolysin [Clostridium symbiosum WAL-14163]
 gi|323399618|gb|EGA92008.1| hemolysin [Clostridium symbiosum WAL-14163]
          Length = 453

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 113/222 (50%), Gaps = 7/222 (3%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM-LMFEKYGRSWMPV 125
           +G+    E E+  NI         DIM  R +I A++   ++ EA+  +  +   S  PV
Sbjct: 198 QGVLEAGEAEMITNIFELNDKEAGDIMTHRTNITALDASMSLDEAVTYILTEANNSRFPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           ++  +D+  G++HMRD + +      +  N+          L+++  F+P +  V  L  
Sbjct: 258 FEKDIDDIIGILHMRDALGFAEKEENRRKNLK-----ELDGLLRDAHFIPETRHVDTLFK 312

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q  +I M +V+DE+G T G+V+ EDI+  ++ +I  E+   +  IS   D +FI D  
Sbjct: 313 EMQSQKIHMEIVVDEYGQTAGIVTMEDILEEIVGNILDEYDEDEEYISRRDDGSFIFDGL 372

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
             L+E+ + +  + +  +  ++ D+L G + S LDRIP  GE
Sbjct: 373 APLDEVGEALDVEFDE-EDYENYDTLNGFLISKLDRIPKEGE 413


>gi|187917938|ref|YP_001883501.1| magnesium and cobalt efflux protein CorC [Borrelia hermsii DAH]
 gi|119860786|gb|AAX16581.1| magnesium and cobalt efflux protein CorC [Borrelia hermsii DAH]
          Length = 259

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 116/217 (53%), Gaps = 12/217 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+S+  V+   +  E + +      S  PVY+ ++
Sbjct: 25  SRFETSLLKNFNSLKETIVKEIMIPRISVVFVDYSVSKDEILKVVTSSNHSRFPVYRETI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D+  G++H +D++    HM+ K        ++   ++++ ++FVP S  +  LL   QE+
Sbjct: 85  DDIIGIIHTKDILL---HMWKKDF-----YEIDLRDIMRKVMFVPESKKIDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++  AR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVPLDDGSYLCTARVLIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           L + +G        + D D+LGG ++ +  RIP + E
Sbjct: 197 LNEKLGLSL----PDGDFDTLGGFVYDLFGRIPLKNE 229


>gi|329941568|ref|ZP_08290833.1| integral membrane protein [Streptomyces griseoaurantiacus M045]
 gi|329299285|gb|EGG43185.1| integral membrane protein [Streptomyces griseoaurantiacus M045]
          Length = 508

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/271 (29%), Positives = 134/271 (49%), Gaps = 27/271 (9%)

Query: 50  KLSHHKG----IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDK 105
           +L+H +G    + L R  A  EG       E+F   L    +  +++M  RV + A++ +
Sbjct: 175 ELAHARGPQELVALARHSAK-EGALEADTAELFVRTLNLADLTAENVMTPRVQVVALDLQ 233

Query: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165
           AT  +        G S  PVY+ SLD+  G+ H+RDV++    + A    +    Q    
Sbjct: 234 ATCEDVANATRATGLSRFPVYRESLDSVVGVAHIRDVLA----VPAAERPLRTLGQ---- 285

Query: 166 NLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH 225
            +++  LFVP S+ V  LL  +   R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH
Sbjct: 286 -VMREPLFVPESLTVDRLLDRLS-GRQTMAVVIDEYGGTAGVATLEDIVEEVVGEVRDEH 343

Query: 226 --HSKKSMISAVSDN----TFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVL 279
             H    +  A +D      +  D    L++LA++          +   ++L GL+ + L
Sbjct: 344 DPHETPDLAPAGTDEDGRARYDADGSARLDQLARV-----GLRAPDGPYETLAGLVAAAL 398

Query: 280 DRIPARGEVVLEIPGFEIVILDADVRCVRRV 310
            RIPA G+ V E+ G+ + ++DA  R   RV
Sbjct: 399 GRIPAAGDRV-EVAGWRMDVVDATGRRAARV 428


>gi|257468602|ref|ZP_05632696.1| integral membrane protein [Fusobacterium ulcerans ATCC 49185]
 gi|317062858|ref|ZP_07927343.1| magnesium and cobalt efflux protein corC [Fusobacterium ulcerans
           ATCC 49185]
 gi|313688534|gb|EFS25369.1| magnesium and cobalt efflux protein corC [Fusobacterium ulcerans
           ATCC 49185]
          Length = 424

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 138/249 (55%), Gaps = 14/249 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI  E EKE+ ++I+ F +    ++M  R ++ A E   T+ +        G S +PVY
Sbjct: 183 EGIIEEDEKEMIHSIVGFGETSAKEVMTPRTAMLAFEGNKTIDDIWYEMVDNGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++++DN  G+++++D+++ I     K  N N+ I+    N I+   FVP +  + ++L  
Sbjct: 243 EDTIDNILGVLYIKDIMNCI-----KDGNTNVPIK----NFIRPGYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDAR 245
            +  ++ +A+V+DE+GG  GL++ ED++  ++ +I       ++  I+ + +N++ VDA 
Sbjct: 294 FKALKVHIAMVLDEYGGIVGLLTIEDLIEEIVGEIRDEFDTEEEEFITQIDENSYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            D+E L K +   C  L    D +SLGGLI + L R+   G+  L+  G ++ +L+ +  
Sbjct: 354 IDIETLDKEL---CLNLPESDDYESLGGLIVTELGRLATIGD-ELKFNGVKLKVLEINKM 409

Query: 306 CVRRVRIRR 314
            V RV I +
Sbjct: 410 RVSRVLIEK 418


>gi|225016804|ref|ZP_03705996.1| hypothetical protein CLOSTMETH_00716 [Clostridium methylpentosum
           DSM 5476]
 gi|224950472|gb|EEG31681.1| hypothetical protein CLOSTMETH_00716 [Clostridium methylpentosum
           DSM 5476]
          Length = 444

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 128/251 (50%), Gaps = 20/251 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+F+ETE E+ N+I  F  I  +++M  R  +  +     V E +  L+  KY R  +PV
Sbjct: 199 GVFNETETEMINSIFEFDDIVAEEVMTPRTDVFLINASRPVSEYLDELLAAKYSR--IPV 256

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y+   DN  G+++M+D I     + A+ N      Q+   +++     VP    +  L  
Sbjct: 257 YEGDTDNIIGVLYMKDFI-----IEARKNGFE---QVDVRSILHPPYLVPERKNIDVLFK 308

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q +  ++A++IDE+GG  G+V+ ED++  +  +I  EH ++   I ++  NTF+V   
Sbjct: 309 EMQAAHRQIAVLIDEYGGFSGIVTMEDLIEEITGEIDDEHEAEDPDIHSIDSNTFLVKGG 368

Query: 246 TDLEELAKIIGTDCNCLKGEQD-VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
             +E+L   +G     L  E D  D+LGG + ++L RIP  GE     P  E   L   V
Sbjct: 369 VSIEDLNDELGL---SLDEESDGYDTLGGFLITLLGRIPKEGEQ----PELESDGLLFKV 421

Query: 305 RCVRRVRIRRL 315
           + VR  RI ++
Sbjct: 422 QQVRDNRIEQV 432


>gi|209522818|ref|ZP_03271376.1| protein of unknown function DUF21 [Arthrospira maxima CS-328]
 gi|209496867|gb|EDZ97164.1| protein of unknown function DUF21 [Arthrospira maxima CS-328]
          Length = 587

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 114/220 (51%), Gaps = 18/220 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+++ NN+  F  +  +++MI R SI ++   AT    +        S  P+   SLD+ 
Sbjct: 222 ERQLLNNVFEFGDVLTEEVMIPRTSIVSLPHTATFQNLLEEMAVSNHSRYPITGESLDDI 281

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI----KNILFVPSSMLVSDLLTNIQE 189
            G++  RD+   ++             QL E   I    +   FV   ML+S+LL  IQ 
Sbjct: 282 LGILDFRDLAKPLAER-----------QLDEETPILTWVRAARFVSEQMLLSELLPLIQR 330

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           S+  MA+V+DE GGT GLV+ +D++S ++ D +     +   I  V D TF+V A+ D+E
Sbjct: 331 SQQEMAIVVDEFGGTAGLVTIDDLISEIIGDGSELAEGEDGDIKFVDDQTFLVQAQLDVE 390

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           E+ +++  D   L   ++  +LGG +   L +IPA GEV+
Sbjct: 391 EVNELLNLD---LPLNEEYQTLGGFLTYQLQKIPAVGEVL 427


>gi|320010901|gb|ADW05751.1| CBS domain containing protein [Streptomyces flavogriseus ATCC
           33331]
          Length = 427

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 137/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   TV +A+ +  + G S +
Sbjct: 175 AEQESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVCIERYKTVRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + +E++L+   +    FVP +  
Sbjct: 235 PVTGENEDDIVGIVYLKDLV--------RKTHIN---REAEADLVSTAMRPAAFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  
Sbjct: 284 AGDLLREMQQERSHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVQELENGC 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           F V AR D+ +L ++ G D      ++DV+++GGL+   L R+P  G   ++++P    +
Sbjct: 344 FRVTARLDIGDLGELFGLDAY---DDEDVETVGGLLAKALGRVPISGASSIVDLPDGRKL 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAESPAGRRNKI 414


>gi|153811095|ref|ZP_01963763.1| hypothetical protein RUMOBE_01486 [Ruminococcus obeum ATCC 29174]
 gi|149832983|gb|EDM88066.1| hypothetical protein RUMOBE_01486 [Ruminococcus obeum ATCC 29174]
          Length = 404

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 134/253 (52%), Gaps = 17/253 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EK++  N+         DIM+ RV+++  +  +T  E + +F +   
Sbjct: 147 VDVSHEDGVIESDEKKMIYNVFDLGDADAKDIMVPRVNVSFADVDSTYDELIDIFREDRF 206

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +PVY+N+ DN  G+++M+D++     +Y  T   N+   L + +      F      +
Sbjct: 207 TRLPVYENTQDNIVGIINMKDLL-----LYDSTKPFNIRDYLRKPH------FTYEYKDI 255

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S+LL  ++ES   +A+V+DE+G   GL++ EDI+  ++ +I  E+  S+  +I  +SD  
Sbjct: 256 SELLVEMRESTFNIAIVLDEYGEMTGLITLEDILEEIVGEIHDEYDESENELIKKLSDRE 315

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           +IV+    L+++   +GT  +     +D DSLGGLI   LDR+P  G+ V+      +V+
Sbjct: 316 YIVEGSMSLDDVNDHLGTHLDS----EDYDSLGGLIIEHLDRLPVAGDQVITDDHIRLVV 371

Query: 300 LDADVRCVRRVRI 312
              D   +  VR+
Sbjct: 372 EKLDKNRIESVRV 384


>gi|302545355|ref|ZP_07297697.1| CBS domain protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302462973|gb|EFL26066.1| CBS domain protein [Streptomyces himastatinicus ATCC 53653]
          Length = 438

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 17/250 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           ++ EG       E+F   L   ++  +++M  RV + A+E  A+  +A  +    G S  
Sbjct: 192 SAAEGALEPDSAELFVRTLHLSELTAENVMTPRVDVQALEAHASAADAANLTLATGLSRF 251

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY++SLD   G VH+RDV++  +   A T           + L    L VP S+ V  L
Sbjct: 252 PVYRDSLDEVVGTVHIRDVLALDAARRATTPV---------TELATPPLLVPDSLPVDRL 302

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIV 242
           L  ++ +   MA+VIDE+GGT G+ + EDIV  ++ D+  EH   ++  +      T+  
Sbjct: 303 LDRLRGAHT-MAVVIDEYGGTAGVATLEDIVEEVVGDVRDEHDPDETPALVPAGPGTWEA 361

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           D    L+EL+ I   D    +G    +++ GL+ + L RIPA G+ + E  G+++ +L  
Sbjct: 362 DGAVRLDELSAI---DLTVPEGPY--ETVAGLMATALKRIPAAGDGI-ETDGWQLTVLKV 415

Query: 303 DVRCVRRVRI 312
           D     RVRI
Sbjct: 416 DHHRADRVRI 425


>gi|148263214|ref|YP_001229920.1| hypothetical protein Gura_1143 [Geobacter uraniireducens Rf4]
 gi|146396714|gb|ABQ25347.1| protein of unknown function DUF21 [Geobacter uraniireducens Rf4]
          Length = 432

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 127/251 (50%), Gaps = 25/251 (9%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF---EKYGRSWMP 124
           G+FS  E E   NI  F    + ++M+ R  + A+ D     E ML F    +Y R   P
Sbjct: 197 GVFSAAESEYIRNIFDFTHTSVREVMVPRTRMAAL-DLDMPREEMLRFILENQYSR--YP 253

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           V++ S++N  G++H +D +  I  +     +IN         ++++  +VP    V+DLL
Sbjct: 254 VFRGSIENIAGVIHGKDFLGRI--VTEPEFDIN--------AIVRSPFYVPEGKRVNDLL 303

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVD 243
             +Q  R  MALV+DE+GG  GLV+ ED++  L+ +I  EH   +   +  ++D + IVD
Sbjct: 304 KEMQRKRSHMALVVDEYGGLSGLVTTEDLLEELVGEIEDEHDIGEPRRVQRLADGSLIVD 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDV--DSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           A   + +L      D   +K  QD+  D+L GLI   L R P +GE  LE   F +V  +
Sbjct: 364 ALISINDL-----EDLLNVKLAQDIPYDTLAGLILDQLGRFPEKGE-KLEWNDFTLVCEE 417

Query: 302 ADVRCVRRVRI 312
                + +VRI
Sbjct: 418 VKKTSIVKVRI 428


>gi|326779452|ref|ZP_08238717.1| CBS domain containing protein [Streptomyces cf. griseus XylebKG-1]
 gi|326659785|gb|EGE44631.1| CBS domain containing protein [Streptomyces cf. griseus XylebKG-1]
          Length = 432

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 135/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + ++E   T+ +A+ +  + G S M
Sbjct: 175 AEAESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVSIERYKTIRQALTLALRSGFSRM 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + SES+ +   +    FVP +  
Sbjct: 235 PVTGENEDDVVGIVYLKDLV--------RKTHIN---RESESDPVSTAMRPAAFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q  R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  
Sbjct: 284 AGDLLREMQRDRSHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVQELENGC 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           + V AR D+ +L  + G D      ++DV+++GGL+   L R+P  G   V+E+P    +
Sbjct: 344 YRVTARLDIGDLGDLFGLD---EYDDEDVETVGGLLAKALGRVPIAGASAVVELPDQRRI 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAESPAGRRNKI 414


>gi|88604239|ref|YP_504417.1| hypothetical protein Mhun_3011 [Methanospirillum hungatei JF-1]
 gi|88189701|gb|ABD42698.1| protein of unknown function DUF21 [Methanospirillum hungatei JF-1]
          Length = 429

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 138/250 (55%), Gaps = 13/250 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG   + E+E+ +++  F   R+ ++M  R+ +  +ED ++  EA+ +F+  G S +P++
Sbjct: 179 EGTIEKDEQEMLHSVFEFSDTRVREVMTPRIDVVMLEDTSSSDEALEIFKNTGFSRLPIW 238

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
             ++D  +G+++++D I  +   +     + L   LSE       LFVP +  + DLL  
Sbjct: 239 HGNIDTIKGILNVKDAIFSVLETHESIPIVEL---LSEP------LFVPETKNIDDLLRE 289

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           ++  +  MA+V+DE+G   G+V+ EDI+  L+ DI  E  +++  +  V+++ + VDAR 
Sbjct: 290 LRAKKTHMAIVLDEYGSFVGIVTVEDILEELVGDILDEFDTEEHELVRVAEDVYSVDARM 349

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILDADVR 305
            +E+L K +  D + L   +  +++ GL+   L  IP  G+V  L   G  +VI+    +
Sbjct: 350 WVEDLNKHL--DLH-LPTSETYETIAGLVIERLGNIPRIGDVCDLTEEGVRLVIIQMTGK 406

Query: 306 CVRRVRIRRL 315
            + R+++ R+
Sbjct: 407 RINRLKLIRI 416


>gi|260578687|ref|ZP_05846595.1| CBS domain protein [Corynebacterium jeikeium ATCC 43734]
 gi|258603184|gb|EEW16453.1| CBS domain protein [Corynebacterium jeikeium ATCC 43734]
          Length = 456

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 115/224 (51%), Gaps = 14/224 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G F+E++  I +  LRF     +D+M  R ++ ++  + T  + + +  + G S  PV +
Sbjct: 200 GGFTESKARILDLSLRFSDASAEDVMTPRSTVESLTVEETAQDLIELALETGHSRFPVTR 259

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             LD   G+VH++D ++ I H    T  +N         L+KN+  VP S+   D+L  +
Sbjct: 260 GDLDETVGVVHVKDALT-IPHDSRPTTTLN--------KLMKNVPSVPDSLSGDDVLNQV 310

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT-FIVDART 246
           + +  ++ +V+DE+GGT G+V+ ED+V  ++ ++  EH   +         T + V    
Sbjct: 311 RAAGSQLVMVVDEYGGTAGIVTIEDVVEEILGEVWDEHDDVEEDKEVRKTGTHWEVSGLV 370

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
             +EL   +G        E D D+LGGLI + L RIPA G+ VL
Sbjct: 371 RTDELPDAVGYTAP----EGDYDTLGGLIMATLGRIPAEGDEVL 410


>gi|307150928|ref|YP_003886312.1| hypothetical protein Cyan7822_1027 [Cyanothece sp. PCC 7822]
 gi|306981156|gb|ADN13037.1| protein of unknown function DUF21 [Cyanothece sp. PCC 7822]
          Length = 485

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 126/242 (52%), Gaps = 11/242 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+ NN+  F  +   ++M+ R  + A+ + AT    +      G S  PV  +SLD+ 
Sbjct: 210 ERELLNNVFEFADVTAVEVMVPRTQLIAIPETATFETLLNEVTSTGHSRYPVKGDSLDDI 269

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G++  +D+   ++          L++  S  + +K + FVP S  +S+LL+ +Q S+++
Sbjct: 270 LGIIDFKDLALPLAQGC-------LSLDASIHHWVKPVRFVPESTPLSELLSLMQRSQLK 322

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE GGT GL++ +D+++ ++ +     +     +  + + TF+V A+ +LEE+ +
Sbjct: 323 MVMVVDEFGGTSGLITLQDLIAEILGESEELENDHAVELQMLDEQTFLVQAQMNLEEVNE 382

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++  D   L    +  +LGG +     +IP +GE  L     E  ++      + ++RI 
Sbjct: 383 VLDLD---LPVTDEYQTLGGFLLYQWQKIPTQGE-TLNYNNLEFTVVSVQGPRLGQIRIT 438

Query: 314 RL 315
           RL
Sbjct: 439 RL 440


>gi|317127004|ref|YP_004093286.1| hypothetical protein Bcell_0268 [Bacillus cellulosilyticus DSM
           2522]
 gi|315471952|gb|ADU28555.1| protein of unknown function DUF21 [Bacillus cellulosilyticus DSM
           2522]
          Length = 415

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 135/247 (54%), Gaps = 16/247 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E+E+E+ +  L F  I + +I+  R+ I A++   TV E    F K   S +PVY
Sbjct: 181 EGVIDESERELVHRSLDFNDIIVAEIVTPRMDIVAIDVNNTVDEIKNTFIKERYSRIPVY 240

Query: 127 KNSLDNPRGMVHMRDVI-SYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           + ++DN  G++  RD + +YI   Y      +++I+     L+++ +FV  SM +  LL 
Sbjct: 241 EGNIDNIIGILSERDFLKAYIQLEY------DVDIR----KLLRDPVFVFESMRIHTLLP 290

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR 245
            +Q+++  MA+VIDE+GGT+GL++ EDI+  ++ +I  EH    +++  V  +T IV A 
Sbjct: 291 QLQKNKGHMAIVIDEYGGTEGLITLEDILEEIVGEIWDEHDEDINLLKQVDPSTLIVHAD 350

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             L++  +    +      +    ++GG +  V  RIP+  E V +     + I+DAD R
Sbjct: 351 CPLDDFVRKTKIEL----PDTPYHTIGGWLSEVFQRIPSVNEEV-QYEHISLKIIDADER 405

Query: 306 CVRRVRI 312
            +R + +
Sbjct: 406 RIRAIEV 412


>gi|91218478|ref|ZP_01255418.1| putative transmembrane CBS domain transporter [Psychroflexus
           torquis ATCC 700755]
 gi|91183359|gb|EAS69762.1| putative transmembrane CBS domain transporter [Psychroflexus
           torquis ATCC 700755]
          Length = 429

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 131/242 (54%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L+F +++  ++MI R  I AV+    + + + +F K G S + VYK S D
Sbjct: 202 DSEIQIFQNALQFSEVKAREVMIPRNEIVAVDISDGIQDLVQIFTKTGLSKLLVYKESND 261

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G +H  +       M+    +I         +++  ++FVP +MLV ++L  + + R
Sbjct: 262 DIVGYIHSFE-------MFRNPQDIK--------SILMPVVFVPETMLVKEILNILIKKR 306

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             +A+V+DE+GGT G+++ EDIV  L  +I  EH S   +   +  N +   AR D++ +
Sbjct: 307 KSIAVVVDEYGGTSGMMTVEDIVEELFGEIEDEHDSVVLVEEKIRGNFYKFSARLDVDYI 366

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    +   L   ++ ++LGG+I +  + IP  GE V EI  F+I IL+A  + +  V 
Sbjct: 367 NEKYKVN---LPESENYETLGGMIVNTTEEIPEVGEEV-EIDQFKIKILEASSKKIELVS 422

Query: 312 IR 313
           I+
Sbjct: 423 IK 424


>gi|332306415|ref|YP_004434266.1| CBS domain containing protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173744|gb|AEE22998.1| CBS domain containing protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 286

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 132/253 (52%), Gaps = 17/253 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA    + ++  +E+   ++   ++R+ +IMI R  +  ++   TV + + +      S 
Sbjct: 41  DAEQREVINQETREMIEGVMEVSEMRVREIMIPRAQMTTIDITETVDKFLPIMLDSAHSR 100

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV     D+  G++  +D++ Y + +  K        +     +++  + VP S  V  
Sbjct: 101 FPVISEDKDHIEGIILAKDLLKY-AFLPGK--------EFELKQVLRPAVIVPESKRVDV 151

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS---MISAVSDNT 239
           LL   Q+ R  MA+V+DE+GG  GLV+ EDI+ +++ +I  EH ++ +    I A++ +T
Sbjct: 152 LLKEFQQKRFHMAIVVDEYGGVSGLVTIEDILELIVGEIEDEHDAEDTNTDNIRALNKHT 211

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           + V A T+LE+  +  GT+ +    E++ D++GG++      +P R E V  I GF   +
Sbjct: 212 YSVKALTELEDFNEFFGTEFD----EEEADTIGGIVLKAFGHMPMRDEKV-SINGFVFAV 266

Query: 300 LDADVRCVRRVRI 312
            ++D R + ++++
Sbjct: 267 TNSDARRLIQLKV 279


>gi|313888910|ref|ZP_07822570.1| conserved hypothetical protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845083|gb|EFR32484.1| conserved hypothetical protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 418

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 118/224 (52%), Gaps = 15/224 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EGI ++ E  +  N++ F+     DIM  R  I A++ + +  E +    +Y  S MPVY
Sbjct: 179 EGIINKNESRMIQNVIDFKDNYAKDIMTPRTDIVAIDIEESFDEIIEKISEYSYSRMPVY 238

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +++LDN  G+++++D+     HM  +T ++  N         K   F         L + 
Sbjct: 239 EDNLDNIVGILNVKDIF----HM-DRTKSLADN-----KEFFKKAFFTFEYKPTGTLFSE 288

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT-SEHHSKKSMISAVSDNTFIVDAR 245
           +++ ++ +A+V DE+GGT+G++++EDI   ++  I+      +   I     N +I++A 
Sbjct: 289 MRQKKLSVAIVTDEYGGTEGMITFEDIFEKIVGQISDEYDKEEDEEILQYGPNKYIIEAS 348

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
            +++E+ +I GT+  C    Q+ DSLGG I   +DR P   EV+
Sbjct: 349 INIDEINQIFGTELEC----QEFDSLGGYIIENIDRFPKLNEVI 388


>gi|158321447|ref|YP_001513954.1| hypothetical protein Clos_2426 [Alkaliphilus oremlandii OhILAs]
 gi|158141646|gb|ABW19958.1| protein of unknown function DUF21 [Alkaliphilus oremlandii OhILAs]
          Length = 419

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 118/224 (52%), Gaps = 14/224 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    EK++  N+  F  +RI DIM+ R  I+A++  +   + M + ++   S  P+Y
Sbjct: 184 EGVLEIEEKQMIYNVFEFGDLRIKDIMVQRTDISAIDKSSDFNKIMEIIKEEKYSRYPIY 243

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++S+DN  G++ ++D I Y  H+       ++++ + E        F      +++L   
Sbjct: 244 EDSIDNIVGILSVKDFI-YGDHI---KEEFDISLYMREP------YFTYEFKKITELFKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           I+++R  M +V+DE+GGT G+V+ ED++  ++ +I  E+   +  +  +SD  +++D  T
Sbjct: 294 IRKNRNHMVVVVDEYGGTAGIVTIEDVIEEIVGEIEDEYDEVEKEVEKISDTEYLIDGST 353

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
            +      I    N      D DSLGG I + L R+P  GE +L
Sbjct: 354 KI----GFISGFLNMTMESDDFDSLGGFIMNELGRLPIVGESIL 393


>gi|86131508|ref|ZP_01050106.1| putative hemolysin [Dokdonia donghaensis MED134]
 gi|85817953|gb|EAQ39121.1| putative hemolysin [Dokdonia donghaensis MED134]
          Length = 432

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 130/242 (53%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           +TE +IF N L F +++  ++M+ R  I AV+++ T      +F + G S + VYK+++D
Sbjct: 206 DTEIQIFQNALEFSEVKSREVMLPRTEIVAVDERTTPAAINKIFIETGLSKILVYKDTID 265

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  +       ++ +   I        S+++  +++VP +MLV D+L  + + R
Sbjct: 266 DIIGYVHSFE-------LFKRPKTI--------SSVLMPVVYVPETMLVKDVLNVLTKKR 310

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +VIDE+GGT G+++ EDIV  L  +I  EH +   +   +S+  + + AR +++ L
Sbjct: 311 KSICVVIDEYGGTSGMMTVEDIVEELFGEIEDEHDTVALVEEQLSEFVYKLSARHEVDYL 370

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    D   L   ++ ++LGGL+ S  + IP  GE + EI G    IL+     +  + 
Sbjct: 371 NETYKLD---LPESENYETLGGLVVSHTEEIPEEGETI-EIAGIIFHILETSNTKIELLE 426

Query: 312 IR 313
           +R
Sbjct: 427 VR 428


>gi|297198085|ref|ZP_06915482.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|197714223|gb|EDY58257.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 441

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 123/249 (49%), Gaps = 22/249 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G       E+F   L    +  +++M  RV + A++ +AT  +        G S  PVY+
Sbjct: 196 GALEADTAELFVRTLNLADLTAENVMTPRVQVIALDVQATCEDVANATRATGLSRFPVYR 255

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLD+  G+ H++D+++  +    +          S + L++  L VP S+ V  LL  +
Sbjct: 256 GSLDSVVGIAHIKDILAVPADRRPRA---------SVAELLREPLLVPESLTVDRLLDRL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNT----FI 241
              R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH  H    + +A +D      F 
Sbjct: 307 SGKRT-MAVVIDEYGGTAGVATLEDIVEEVVGEVRDEHDPHETSDLAAAGTDEEGRELFQ 365

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            D    +++LA++          E   ++L GL+ + L RIPA G+ V EI G+++ + D
Sbjct: 366 ADGSARIDQLARV-----GLRAPEGPYETLAGLLATELGRIPAVGDSV-EITGWQLDVTD 419

Query: 302 ADVRCVRRV 310
           A  R   RV
Sbjct: 420 AQGRRAARV 428


>gi|189466524|ref|ZP_03015309.1| hypothetical protein BACINT_02899 [Bacteroides intestinalis DSM
           17393]
 gi|189434788|gb|EDV03773.1| hypothetical protein BACINT_02899 [Bacteroides intestinalis DSM
           17393]
          Length = 343

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 128/240 (53%), Gaps = 13/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +    +   S +P+Y  + DN 
Sbjct: 103 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVLQCIIENAYSRIPIYSENRDNI 162

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ ++       N ++   Q    +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 163 KGILYIKDLLPHL-------NKVDFRWQ----SLIRPAYFVPETKMIDDLLRDFQANKIH 211

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 212 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 271

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 272 ITKVDEEVFDEVAGDSDTLAGLLLELKGEFPALHEKVT-YDHYEFEVLEMDNRRILKVKF 330


>gi|295136310|ref|YP_003586986.1| gliding motility protein GldE [Zunongwangia profunda SM-A87]
 gi|294984325|gb|ADF54790.1| gliding motility protein GldE [Zunongwangia profunda SM-A87]
          Length = 440

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 118/223 (52%), Gaps = 17/223 (7%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E++I   I+ F       +M  R+ + A+ D+ T  E + +  + G S +PVYK ++
Sbjct: 204 TKEEQKILKGIVSFGNTDTKQVMRPRMDVFAISDEDTYAEIIPVIIENGYSRIPVYKENI 263

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G+++++D++ Y+                  ++L++   FVP +  + DLL   +E 
Sbjct: 264 DNVTGILYIKDLLPYLDRS-----------DFEWTSLLREPYFVPENKKLDDLLNEFKEK 312

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +  +A+V+DE+GGT GL++ EDI+  ++ DI+ E   +  + S + +  F+ + RT L++
Sbjct: 313 KNHLAIVVDEYGGTSGLITLEDIIEEIVGDISDEFDDEDLIYSKLDEFNFVFEGRTPLKD 372

Query: 251 LAKIIGTDCNCL----KGEQDVDSLGGLIFSVLDRIPARGEVV 289
             KII  +   L    KGE   ++L G +  +    P + E++
Sbjct: 373 FYKIIKLEDASLFEDNKGE--AETLAGFLLEISGDFPQQNEII 413


>gi|67924320|ref|ZP_00517754.1| CBS:Protein of unknown function DUF21:Transporter-associated region
           [Crocosphaera watsonii WH 8501]
 gi|67853837|gb|EAM49162.1| CBS:Protein of unknown function DUF21:Transporter-associated region
           [Crocosphaera watsonii WH 8501]
          Length = 464

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 128/242 (52%), Gaps = 13/242 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+  NI  F ++   ++M+ R  + A+ + AT  E +    + G S  PV  +SLD+ 
Sbjct: 210 ERELLKNIFEFGEVTTVEVMVPRTQLVAIAETATFEELLKEVTETGHSRYPVKGDSLDDI 269

Query: 134 RGMVHMRDVISYISH-MYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G++  +D+   +S      T  I         + IK + FV  SM + +LL  +Q S++
Sbjct: 270 LGIIDFKDLAEPLSKGALTPTAFIE--------SWIKPVKFVSESMALDELLALMQRSQL 321

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
           +M +V+DE GGT GL++ +D++  ++ +       ++  +  + ++ F+++A+ ++EEL 
Sbjct: 322 KMVMVVDEFGGTSGLITMQDVIEEILGNDVEGIIEEEDTLKMIDEHNFLIEAQLNVEELN 381

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            ++G D   L    +  +LGG +     +IP+ GE +LE       I++++   + ++ +
Sbjct: 382 DVLGLD---LPLTDEYQTLGGFLLYQWQKIPSEGE-ILEYENLSFTIVESEGPRLLQIHL 437

Query: 313 RR 314
           RR
Sbjct: 438 RR 439


>gi|78222369|ref|YP_384116.1| hypothetical protein Gmet_1153 [Geobacter metallireducens GS-15]
 gi|78193624|gb|ABB31391.1| conserved hypothetical protein [Geobacter metallireducens GS-15]
          Length = 447

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 128/248 (51%), Gaps = 19/248 (7%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+FS TE+E   NI  F    + ++M+ R  + A++   +  E +  ++  KY R   PV
Sbjct: 198 GVFSSTEQEFIRNIFDFTHTCVREVMVPRTRVVALDLGLSRDELVNTVLENKYSR--YPV 255

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
           Y+ S++N  G +H +D++  I        +   +I+    ++I+   +VP    V++LL 
Sbjct: 256 YRESIENVTGFIHGKDLLGGI------VTDPAFDIK----SIIRPPFYVPEGKKVNELLK 305

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH-SKKSMISAVSDNTFIVDA 244
            +Q  RI MALV+DE+GG  GL + ED++  L+ +I  EH   +   I  + D + +VDA
Sbjct: 306 EMQRKRIHMALVVDEYGGISGLATTEDLLEELVGEIEDEHDIGEPGSIQRLPDGSLLVDA 365

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADV 304
              + +LA+ +      L  +   D+L GLI   L R P +GE V E   F ++  +   
Sbjct: 366 LVSISDLAEHLEIK---LGDDIPYDTLAGLILDRLGRFPEKGERV-EWDRFTLICEEVKK 421

Query: 305 RCVRRVRI 312
             V +VRI
Sbjct: 422 TAVVKVRI 429


>gi|297159004|gb|ADI08716.1| integral membrane protein [Streptomyces bingchenggensis BCW-1]
          Length = 471

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 130/272 (47%), Gaps = 31/272 (11%)

Query: 47  KLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
           +L+ L+ H          + +G       E+F   L   ++  +++M  RV + A+E  A
Sbjct: 183 ELVALARHS---------AAQGAIEPDSAELFVRTLHLGELTAENVMTPRVDVQALEAHA 233

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESN 166
           T  +A  +    G S  PVY++SLD   G VH+RDV++  +   A T           ++
Sbjct: 234 TAVDAANLTFATGLSRFPVYRHSLDEVIGTVHIRDVLALDAAKRAAT---------PVTD 284

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH 226
           LI   L VP ++ V+ LL  ++  R+ MA+VIDE+GGT G+ + ED+V  ++ ++  EH 
Sbjct: 285 LITPPLLVPDTLPVATLLQRLRAERV-MAVVIDEYGGTAGVATVEDVVEEVIGEVRDEHD 343

Query: 227 SKKSMISAVSDNT------FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLD 280
                    +  T      +  D    L++LA I          +   ++L GL+ + L 
Sbjct: 344 PLAPPDLLPAPPTDDGRAVWEADGGVRLDQLAGI-----GLAAPDGPYETLAGLLATRLG 398

Query: 281 RIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           RIP  G+ V  + G+++ +LD D     RV I
Sbjct: 399 RIPDEGDTV-HLDGWDLTVLDVDHHRADRVTI 429


>gi|224534943|ref|ZP_03675512.1| CBS domain pair protein [Borrelia spielmanii A14S]
 gi|224513883|gb|EEF84208.1| CBS domain pair protein [Borrelia spielmanii A14S]
          Length = 259

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 113/219 (51%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  D        D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKLNLDL----PNGDFDTLGGFVYDLFGRIPLKNEKV 231


>gi|205372184|ref|ZP_03224999.1| hypothetical protein Bcoam_01540 [Bacillus coahuilensis m4-4]
          Length = 441

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 113/223 (50%), Gaps = 14/223 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G   E EK + NNI       + DIM  R +I ++  +AT  EA+ +      + +P++
Sbjct: 194 KGTIQEDEKMMINNIFELDNKVVSDIMTHRTNIVSISAQATFTEALRLMNSEKFTRVPIF 253

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + + DN  G++H++D++  + H          N+      + +  L+VP S  V DL   
Sbjct: 254 EENKDNIVGILHVKDLLQCLEH--------GKNVPFDLKEIAREPLYVPDSKRVDDLFRE 305

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHH--SKKSMISAVSDNTFIVDA 244
           +Q+    M++VIDE+GGTDG+V+ EDI+  ++  IT E+     +  I  + DNTFI+  
Sbjct: 306 MQKHNTHMSIVIDEYGGTDGIVTTEDIIEEIVGSITDEYDEPELEEYIEELDDNTFIIVG 365

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            T L+ L  ++           + D+L G +  +L  IP+  E
Sbjct: 366 STSLDLLEDVLKIQLPV----DEYDTLSGFVIGMLGYIPSEEE 404


>gi|91206126|ref|YP_538481.1| hemolysin C [Rickettsia bellii RML369-C]
 gi|122425194|sp|Q1RGX2|HLYC_RICBR RecName: Full=Possible hemolysin C
 gi|91069670|gb|ABE05392.1| Hemolysin C [Rickettsia bellii RML369-C]
          Length = 301

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 128/243 (52%), Gaps = 17/243 (6%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFE-KYGRSWMPVYKNSLDN 132
           E+ I  N+L+ +   I+DIM+ R  I A++    + E     + K   +   +Y  +LDN
Sbjct: 60  ERNILANLLKLKGKTIEDIMVPRSDIAAIKLTTNIEELNESIKVKIPHTRTLIYDGTLDN 119

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
             G +H++D+   +            N +L +  LI+  +    SM + DLL  ++  + 
Sbjct: 120 IVGFIHIKDLFKALVTKQ--------NFRLKK--LIRKHIIAAPSMKLLDLLAKMRREKT 169

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM--ISAVSDNTFIVDARTDLEE 250
            +A+VIDE+GGTDGLV+ ED++  L+  I  EH  K        ++++T I +AR ++E 
Sbjct: 170 HIAIVIDEYGGTDGLVTIEDVMEALVGRIDDEHDQKSEYDNYKVINNSTIISNARVEVEV 229

Query: 251 LAKIIGTDCNCLKGEQD-VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
           L +IIG     LK + D  D++ GL+ + +  +PA G  +      EI + DA+ R +++
Sbjct: 230 LEEIIG---EKLKDDDDEFDTISGLVLTKMGNVPAVGTKINVSENIEIEVTDANPRSLKQ 286

Query: 310 VRI 312
           V+I
Sbjct: 287 VKI 289


>gi|291547089|emb|CBL20197.1| Hemolysins and related proteins containing CBS domains
           [Ruminococcus sp. SR1/5]
          Length = 399

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 133/253 (52%), Gaps = 17/253 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EKE+  N+         DIM+ RV +   + ++T  E + +F +   
Sbjct: 147 VDVSHEDGVIESDEKEMIYNVFDLGDATAKDIMVPRVHVTFADVESTYDELIDIFREDKF 206

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +PVYK+S +N  G+++M+D++ Y           + N +    + ++   F   +  +
Sbjct: 207 TRLPVYKDSQNNIVGIINMKDLLLY-----------DKNEEFVIDHFLRKPHFTYETKSI 255

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNT 239
           SDLL  +++S   +A+V+DE+G   GL++ EDI+  ++ +I  E+  K+  ++  +SD  
Sbjct: 256 SDLLVEMKDSTFNIAIVLDEYGDMAGLITLEDILEEIVGEIHDEYDEKEDELVQKISDRE 315

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           +I++    L+++   + T+ +     +D DSLGG I   LDR+P  G+ V+   G  +++
Sbjct: 316 YIIEGSMHLDDVNDHLDTELDS----EDYDSLGGFIIEHLDRLPVAGDEVITEDGIRLIV 371

Query: 300 LDADVRCVRRVRI 312
              D   + +V +
Sbjct: 372 EKLDKNRIEKVHV 384


>gi|29833623|ref|NP_828257.1| integral membrane protein [Streptomyces avermitilis MA-4680]
 gi|29610747|dbj|BAC74792.1| putative integral membrane protein [Streptomyces avermitilis
           MA-4680]
          Length = 448

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 124/249 (49%), Gaps = 22/249 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G       E+F   L    +  +++M  RV + A++ +AT  +        G S  PVY+
Sbjct: 196 GALEADTAELFVRTLNLADLTAENVMTPRVQVVALDVQATCEDVANATRATGLSRFPVYR 255

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            +LD+  G+ H++DV++  +    +            S +++  LFVP S+ V  LL  +
Sbjct: 256 GNLDSVVGIAHIKDVVAVPAEERTRR---------PVSRVMREPLFVPESLTVDRLLDRL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDN----TFI 241
              R  MA+VIDE+GGT G+ + EDIV  ++ ++  EH  H    +  A +D+     + 
Sbjct: 307 GGKRT-MAIVIDEYGGTAGVATLEDIVEEVVGEVRDEHDPHETPDLAPAGTDDDGRALYS 365

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            D  T +++LA++          +   ++L GLI + L RIPA G+ V E+ G+ + ++D
Sbjct: 366 ADGATRIDQLARV-----GLRAPDGPYETLAGLIAAELGRIPAEGDTV-EVAGWRLDVVD 419

Query: 302 ADVRCVRRV 310
           A  R   RV
Sbjct: 420 ASGRRAARV 428


>gi|167625137|ref|YP_001675431.1| CBS domain-containing protein [Shewanella halifaxensis HAW-EB4]
 gi|167355159|gb|ABZ77772.1| CBS domain containing protein [Shewanella halifaxensis HAW-EB4]
          Length = 299

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 130/254 (51%), Gaps = 16/254 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA +  + SE  +E+   +L    +R+ DIMI R  I A++   +V E +        S 
Sbjct: 46  DAEMREVISEDTREMIKGVLEVSDLRVRDIMIPRAQIVAIQIDDSVEEVLSTVISSAHSR 105

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV     D+  G++  +D+I Y      K N     ++     +I+  + VP S  V  
Sbjct: 106 FPVVNEDKDHIEGILLAKDLIQY----GFKNNEQPFELR----QVIRPAVVVPESKRVDV 157

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE--HHS-KKSMISAVSDNT 239
           LL   +  R  MA+V+DE+GG  GLV+ EDI+  ++ DI  E  H S +++ I  ++   
Sbjct: 158 LLKEFRSQRYHMAIVVDEYGGVSGLVTIEDILEEIVGDIEDEFDHDSAEETEIKQIAKQV 217

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           F+V A T +++  +  GT+ +    +++ D++GG++      +P R E V+ I   E  +
Sbjct: 218 FMVKALTPIDDFNEAFGTEFS----DEEFDTVGGMVSHAFGHLPERDEKVM-IQNIEFKV 272

Query: 300 LDADVRCVRRVRIR 313
           ++AD R + ++R++
Sbjct: 273 INADTRRLIQLRVK 286


>gi|51598320|ref|YP_072508.1| hemolysin [Borrelia garinii PBi]
 gi|51572891|gb|AAU06916.1| hemolysin [Borrelia garinii PBi]
          Length = 259

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RDV+    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDVLL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|160944923|ref|ZP_02092150.1| hypothetical protein FAEPRAM212_02439 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444107|gb|EDP21111.1| hypothetical protein FAEPRAM212_02439 [Faecalibacterium prausnitzii
           M21/2]
 gi|295104192|emb|CBL01736.1| Hemolysins and related proteins containing CBS domains
           [Faecalibacterium prausnitzii SL3/3]
          Length = 434

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 131/252 (51%), Gaps = 19/252 (7%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           +A  +G  ++ E E+  + + F  + +++I+  RV + AVED   + E    F + G S 
Sbjct: 176 EAENDGELTDRESELIRSAIEFDDVEVEEILTPRVDVIAVEDDMPLEEVAQTFAESGYSR 235

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
           +PVY +++DN  G+VH +D   Y++ +  +T            +L+K  L+   S  +S 
Sbjct: 236 LPVYHDTIDNIIGVVHEKDF--YMARLKKETKL---------EDLVKPTLYTTGSTQISQ 284

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL  ++E    MA+V+DE+GGT+G+++ EDI+  L+ +I  EH          SD ++IV
Sbjct: 285 LLRTLREQHHHMAVVVDEYGGTEGIITLEDILEELVGEIWDEHDEVTEDFRKQSDGSWIV 344

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDS--LGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
                +++L + +G     L  ++D+DS  + GL+     R+P  G+    +  ++ V+ 
Sbjct: 345 LGSAGVDDLYERLG-----LPEDEDIDSNTVNGLVQEKTCRLPKVGD-RFTLGSYDGVVT 398

Query: 301 DADVRCVRRVRI 312
               R V  VR+
Sbjct: 399 RTAKRRVTEVRL 410


>gi|257783874|ref|YP_003179091.1| hypothetical protein Apar_0064 [Atopobium parvulum DSM 20469]
 gi|257472381|gb|ACV50500.1| protein of unknown function DUF21 [Atopobium parvulum DSM 20469]
          Length = 447

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 117/224 (52%), Gaps = 18/224 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  SE EK + + ++      + ++M+ RV + A+ED AT+ E + +  + G S +P+Y 
Sbjct: 192 GDLSEEEKSMIHEVIEMGDTVVREVMVPRVDMTAMEDTATISEVLRVMRQTGFSRIPIYH 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++D   G+ H++D++  +   +A    I        +  +++  +VP +  +  LLT +
Sbjct: 252 ENIDRIVGIAHIKDLLEPVLDQHASEEKI--------ARFVRSADYVPDTKDIIPLLTEM 303

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDAR-- 245
           Q SR +M + +DE+GGT G+++ EDIV  ++ +I  E       ++ +SD  ++VD R  
Sbjct: 304 QTSRDQMVIAVDEYGGTAGVITIEDIVEEIVGEIEDEFDPDNKYLTQLSDREWLVDGRFS 363

Query: 246 -TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
             D +EL   +G         ++ +++ G +  +   +P  GEV
Sbjct: 364 LNDADELGWPVGE-------SEEYETIAGFVLDLAGHLPRPGEV 400


>gi|162447531|ref|YP_001620663.1| CBS-domain-containing protein [Acholeplasma laidlawii PG-8A]
 gi|161985638|gb|ABX81287.1| membrane-anchored CBS-domain containing protein [Acholeplasma
           laidlawii PG-8A]
          Length = 449

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 134/252 (53%), Gaps = 16/252 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE--AMLMFEKYGRSWMP 124
           +G    +E E+  NI  F    ++++M  R  ++A+   +T  E    +  EKY R   P
Sbjct: 196 KGFIDSSENEMIQNIFEFDSTTVEEVMTHRTEVSAINVNSTRDELVKFVTNEKYTR--FP 253

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ +LD   G +H++D++ Y+S  +   N  +++       ++++ LFVP S     L 
Sbjct: 254 VYEETLDKIVGTLHVKDLLKYLSE-HEDKNEFDIH------EILRDPLFVPQSKNTRALF 306

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             ++ ++  +A+VIDE+GGT G++++ED++  ++ +I+ E+   +  I A+S++ + +D 
Sbjct: 307 REMKLTKTHIAIVIDEYGGTAGIITFEDLIEEILGNISDEYDEDEEEIQAISEDRYEIDG 366

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPG-FEIVILDAD 303
             DL+++  +I          +D D+L G +   L R P   E ++ + G +   +L  +
Sbjct: 367 LIDLDDVEDLIHAGLPI----EDYDTLSGFLLGQLGRFPEADESIVVVYGHYRFEVLSYE 422

Query: 304 VRCVRRVRIRRL 315
            + + RV + R+
Sbjct: 423 DKIIERVLVTRI 434


>gi|302545481|ref|ZP_07297823.1| CBS domain protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302463099|gb|EFL26192.1| CBS domain protein [Streptomyces himastatinicus ATCC 53653]
          Length = 435

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 127/235 (54%), Gaps = 20/235 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + A+E   T+ +A+ +  + G S +
Sbjct: 175 AEQESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVAIERFKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + SES L+   +    FVP +  
Sbjct: 235 PVTGENEDDIVGIVYLKDLV--------RKTHIN---RESESELVSTAMRPAAFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + D T
Sbjct: 284 AGDLLREMQQQRNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEDLGDGT 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV-LEIP 293
             V AR  L +L ++ GT       ++DV+++GGL+   L R+P  G    ++IP
Sbjct: 344 HRVTARLGLGDLGELYGTALE----DEDVETVGGLLAKSLGRVPIAGATAQVDIP 394


>gi|253582371|ref|ZP_04859594.1| magnesium and cobalt efflux protein corC [Fusobacterium varium ATCC
           27725]
 gi|251835910|gb|EES64448.1| magnesium and cobalt efflux protein corC [Fusobacterium varium ATCC
           27725]
          Length = 424

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 138/249 (55%), Gaps = 14/249 (5%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E EKE+ ++I+ F +    ++M  R ++ A E   T+ +        G S +PVY
Sbjct: 183 EGVIEEDEKEMIHSIVGFGETSAKEVMTPRTAMLAFEGNKTIDDIWYEMVDNGFSRIPVY 242

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           ++++DN  G+++++D+++ I     K  N N+ I+    N I+   FVP +  + ++L  
Sbjct: 243 EDTIDNILGVLYIKDIMNCI-----KDGNTNVPIK----NFIRPGYFVPETKSIIEILKE 293

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDAR 245
            +  ++ +ALV+DE+GG  GL++ ED++  ++ +I       ++  I+ + +N++ VDA 
Sbjct: 294 FKALKVHIALVLDEYGGIVGLLTIEDLIEEIVGEIRDEFDTEEEEFITQIDENSYEVDAM 353

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
            D+E L K +   C  L    D +SLGGLI + L R+   G+  L+  G ++ +L+ +  
Sbjct: 354 IDIETLDKEL---CLNLPESDDYESLGGLIVTELGRLATIGD-ELKFNGVKLKVLEINKM 409

Query: 306 CVRRVRIRR 314
            V +V I +
Sbjct: 410 RVSKVLIEK 418


>gi|218130467|ref|ZP_03459271.1| hypothetical protein BACEGG_02056 [Bacteroides eggerthii DSM 20697]
 gi|217987346|gb|EEC53676.1| hypothetical protein BACEGG_02056 [Bacteroides eggerthii DSM 20697]
          Length = 393

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 127/240 (52%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  +E +    + +    +   S +PVY  + DN 
Sbjct: 151 ENNILEGIIRFGGETAKEVMTSRLDVVDLEIRTPFKDVLKCIVENAYSRIPVYAETRDNI 210

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 211 KGVLYIKDLLPHLN----KGDNFRW------QSLIRPAYFVPETKMIDDLLRDFQANKIH 260

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 261 IAIVVDEFGGTSGIVTMEDIIEEIVGEIRDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 320

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    P   E V     +E  +L+ D R + +V+ 
Sbjct: 321 ITKIDEETFDEVAGDADTLAGLLLELKGEFPVLHEKV-AYDCYEFEVLEMDNRRILKVKF 379


>gi|331268870|ref|YP_004395362.1| integral membrane protein [Clostridium botulinum BKT015925]
 gi|329125420|gb|AEB75365.1| Integral membrane protein with CBS domains [Clostridium botulinum
           BKT015925]
          Length = 415

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 131/246 (53%), Gaps = 17/246 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+   TE+++  N+  F   ++ D+MI R  I A++  ++  E +  F+    S +P+Y
Sbjct: 185 EGVLEITERKMIYNVFEFGDSQVKDVMIPRADIVALDINSSYDEIVETFKMQQFSRIPIY 244

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +DN  G++H+++++       A   N ++       ++I    F       ++L   
Sbjct: 245 EEEIDNVIGILHVKNLV------LASKENFDIR------DIIHEPYFTYEYKKTTELFEE 292

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDART 246
           +++ R+ + +V+DE+GGT GL++ ED+V  ++ DI  E+      I  + ++ +I+D   
Sbjct: 293 MRKQRVSLTIVLDEYGGTVGLITMEDLVEEIVGDIEDEYDEHNIGIEVIKEDEYIIDGSI 352

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            ++E+  +IGT+       +D D++GG +   L R P +GE++ E    + +I + D   
Sbjct: 353 KIDEVNDMIGTNIES----EDFDTIGGFVIGELGRFPEQGEMI-EYMNVKFIIEEIDRNR 407

Query: 307 VRRVRI 312
           ++++++
Sbjct: 408 IKKLKV 413


>gi|297199577|ref|ZP_06916974.1| CBS domain-containing protein [Streptomyces sviceus ATCC 29083]
 gi|197713495|gb|EDY57529.1| CBS domain-containing protein [Streptomyces sviceus ATCC 29083]
          Length = 435

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 136/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEDEERRMVHSVFELGDTLVREVMVPRTDLVVIERFKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   S D+  G+V+++D++        +  +I+ +   +ES L+   +    FVP +  
Sbjct: 235 PVSGESEDDIVGIVYLKDLV--------RKTHISRD---AESELVSTAMRPAAFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + D+ 
Sbjct: 284 AGDLLREMQQDRNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEDLGDDR 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
             V AR D+ +L ++ G D      ++DV+++GGL+   L R+P  G   V+E+P    +
Sbjct: 344 HRVTARLDITDLGELYGLDEY---DDEDVETVGGLLAKALGRVPIAGASAVVELPDGRAL 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAEAAAGRRNKI 414


>gi|253576671|ref|ZP_04853998.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843881|gb|EES71902.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 425

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 136/264 (51%), Gaps = 18/264 (6%)

Query: 51  LSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE 110
           L   + IR+   ++S  G+   TE  + +NI  F      +IMI R  +  +  + ++ E
Sbjct: 169 LHTEEEIRVMMKESSESGLIDSTEMSLVDNIFEFADTTAREIMIPRTEMICLYTQHSLEE 228

Query: 111 AMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKN 170
            + +  +  R+  PV  +  D+  G +H++D+I        ++ N N+       +LI+ 
Sbjct: 229 NLEIALEGTRTRYPVCNHDKDHIIGFIHIKDLI--------RSQNRNIR------DLIRP 274

Query: 171 ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS 230
           I+ VP S+ +SDL+  +Q  R ++A++IDE+GGT G+V+ EDIV  ++ +I  E   ++ 
Sbjct: 275 IMAVPESIPISDLMKRMQRGRTQIAILIDEYGGTSGMVTLEDIVEEIVGEIQDEFDEERP 334

Query: 231 MISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
            I  +  N + +D    +E +    G + +      D D++GG ++S +D +P +    +
Sbjct: 335 GIEQLDTNVYSIDGLMLIESINDRFGLELDS----DDYDTIGGWLYSRIDILPPQVGQTV 390

Query: 291 EIPGFEIVILDADVRCVRRVRIRR 314
           E  G   V+ + D + + RV++ R
Sbjct: 391 EYGGITYVVEETDNKRISRVKLIR 414


>gi|118579200|ref|YP_900450.1| hypothetical protein Ppro_0762 [Pelobacter propionicus DSM 2379]
 gi|118501910|gb|ABK98392.1| protein of unknown function DUF21 [Pelobacter propionicus DSM 2379]
          Length = 456

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 133/253 (52%), Gaps = 29/253 (11%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVE---DKATVYEAML--MFEKYGRSW 122
           G+FSETE E  +N+  F    + ++M+ R  I  +E    +  V   +L  M+ +Y    
Sbjct: 220 GVFSETETEYIHNVFEFTHTCVREVMVPRTRIVGLELGTSRDQVVSVILENMYSRY---- 275

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PVY  ++++  G+VH +D++     M A             +  +K  +FVP S +V++
Sbjct: 276 -PVYSGTIEDVVGVVHGKDLLG---RMVAGEP-------FDLAATMKAPVFVPESKMVNE 324

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFI 241
           LL  +Q S+ +MA+V+DE+GG +GLV+ +D++  L+ +I  EH + ++  I  ++D + +
Sbjct: 325 LLKEMQRSQNQMAMVVDEYGGLNGLVTSQDLIEELLGEIRDEHDTAETAGIQRLADGSLL 384

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDV--DSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           VD    + +LA+ +      ++   D+  D++ G+I   L R P RGE V+   G+    
Sbjct: 385 VDGFFSIFDLAEFLE-----IRQVADLPYDTVAGMILDALGRFPQRGEGVV-WQGYRFTC 438

Query: 300 LDADVRCVRRVRI 312
            D     + RVR+
Sbjct: 439 EDVTRTAILRVRV 451


>gi|333025600|ref|ZP_08453664.1| putative integral membrane protein [Streptomyces sp. Tu6071]
 gi|332745452|gb|EGJ75893.1| putative integral membrane protein [Streptomyces sp. Tu6071]
          Length = 453

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 125/261 (47%), Gaps = 27/261 (10%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           ++ EG       E+F   L    +  +++M  RV + A+ + A+  +A  +    G S  
Sbjct: 192 SAAEGALEPDSAELFIRTLHLNDLTAENVMTPRVEVQALAEGASALDAANLAHATGLSRF 251

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+  LD   G VH+RDV++      A+T           ++L    L VP S+    L
Sbjct: 252 PVYREHLDEVTGTVHIRDVLALEPAARARTRV---------TDLATPPLLVPDSLPADTL 302

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS------MISAVSD 237
           L  ++ +R  MA+VIDE+GGT G+V+ EDIV  ++ ++  EH  +++        S    
Sbjct: 303 LARMRAART-MAVVIDEYGGTAGVVTVEDIVEEVVGEVRDEHDPEETEDLVPGAPSTDGR 361

Query: 238 NTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV------LE 291
            T+  D    L++L ++IG D      E   +++ GL+ + L RIP  G+VV        
Sbjct: 362 ETWEADGSLRLDQL-RLIGLDAP----EGPYETVAGLLATRLGRIPEAGDVVELGELDAT 416

Query: 292 IPGFEIVILDADVRCVRRVRI 312
             G+E  +L  +     RVR+
Sbjct: 417 AQGWEFTVLSVEHHRAERVRV 437


>gi|225552083|ref|ZP_03773023.1| CBS domain pair protein [Borrelia sp. SV1]
 gi|225371081|gb|EEH00511.1| CBS domain pair protein [Borrelia sp. SV1]
          Length = 259

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVHLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|317473950|ref|ZP_07933229.1| gliding motility-associated protein GldE [Bacteroides eggerthii
           1_2_48FAA]
 gi|316909792|gb|EFV31467.1| gliding motility-associated protein GldE [Bacteroides eggerthii
           1_2_48FAA]
          Length = 450

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 128/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  +E +    + +    +   S +PVY  + DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLEIRTPFKDVLKCIVENAYSRIPVYAETRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIRDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    P   E V+    +E  +L+ D R + +V+ 
Sbjct: 378 ITKIDEETFDEVAGDADTLAGLLLELKGEFPVLHEKVV-YDCYEFEVLEMDNRRILKVKF 436


>gi|111221448|ref|YP_712242.1| CBS domain-containing protein [Frankia alni ACN14a]
 gi|111148980|emb|CAJ60660.1| Putative membrane protein containing CBS domain [Frankia alni
           ACN14a]
          Length = 477

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 118/215 (54%), Gaps = 9/215 (4%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++  ++       + ++M+ R  +  +E   TV +A+ +  + G S +PV   S+D+  
Sbjct: 213 RDMIASVFELGDTLVREVMVPRPDMVFIESSKTVRQALSLALRSGFSRVPVIGESVDDVV 272

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G       I+++  M  +  + + +  ++E  +++  + VP S    DLL  +Q SR  M
Sbjct: 273 G-------IAFLKDMVRRERDGDEDGPVAE--IMRAPVLVPESKPADDLLREMQASRTHM 323

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+VIDE+GGT GLV+ EDI+  ++ +IT E+ S+ + +  +  +T  V AR D+++L K+
Sbjct: 324 AIVIDEYGGTAGLVTIEDILEEIVGEITDEYDSEVAPVEWLDPDTARVTARLDVDDLVKL 383

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
              D + L G  D  ++GGL+ + L R+P  G  V
Sbjct: 384 FDFDVDELPGADDSVTVGGLLATALGRVPIPGATV 418


>gi|15594405|ref|NP_212193.1| hemolysin (tlyC) [Borrelia burgdorferi B31]
 gi|2687942|gb|AAC66449.1| hemolysin (tlyC) [Borrelia burgdorferi B31]
          Length = 259

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETVVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|197124289|ref|YP_002136240.1| hypothetical protein AnaeK_3902 [Anaeromyxobacter sp. K]
 gi|196174138|gb|ACG75111.1| CBS domain containing protein [Anaeromyxobacter sp. K]
          Length = 425

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 122/254 (48%), Gaps = 16/254 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G  SE  +E+ +N+  FR+    D+M+ R  + AVE    V + +    + G S M
Sbjct: 182 AGRGGSGSEGTRELIHNVFEFREKVARDVMVPRTDVVAVELGTPVPQIIRTLSEEGHSRM 241

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+ SLD   G++H RD++  ++H       I L      +++++   FVP S  V  L
Sbjct: 242 PVYRESLDQIAGVLHARDLVPLLAH----PELIVL------ADILRPAHFVPWSKPVEQL 291

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV--SDNTFI 241
           L  +Q   + MA V+DE GG  G+ + ED++  ++ DI  E   +         +D +F 
Sbjct: 292 LREMQRRHLHMAFVVDEFGGVMGICTIEDVLEQIVGDIQDEFEEEDEGREVEQHADGSFT 351

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           V     + E  +        +  +Q  +++ G + S+   IPARG+      G+   + +
Sbjct: 352 VQGAAAVAEFNR---AAQAGVPEDQGFETMAGFVSSLAGAIPARGDRFF-WKGWVFTVAE 407

Query: 302 ADVRCVRRVRIRRL 315
           AD R V +VR  R+
Sbjct: 408 ADPRRVVKVRAARV 421


>gi|310659246|ref|YP_003936967.1| hypothetical protein CLOST_1942 [Clostridium sticklandii DSM 519]
 gi|308826024|emb|CBH22062.1| conserved membrane protein of unknown function [Clostridium
           sticklandii]
          Length = 377

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 134/249 (53%), Gaps = 13/249 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           +S EG+    EKE+  NI  F  +R+ D+MI R+ I A+  + T  E + +F+    S +
Sbjct: 140 SSKEGVLEHEEKEMIYNIFEFGDLRVADVMIQRMDIKAISVEDTYDEIIQVFKNEKFSRL 199

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           P+Y++++DN  G+++ +D+      +  + + +N +++           F+    ++SD 
Sbjct: 200 PIYEDTIDNIIGVLYAKDLF----FLDREADRLNFDVRDYMRAPFNTFEFI----MISDF 251

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
              +Q ++I MA V+DE+GG  G+++ EDIV  +  +I  E+   +  I  + ++ ++V+
Sbjct: 252 FKQMQGNKIHMATVLDEYGGVAGIITMEDIVESIFGEIDDEYDDTEEEIEVIKEDEYVVN 311

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
               L +L  ++G +       +D +S+GG I   + R+P  GE++ +    + +I + D
Sbjct: 312 GAARLSDLNDMLGINLES----EDFESVGGFIIGEIGRLPKTGEII-QHKNIKFIIENVD 366

Query: 304 VRCVRRVRI 312
              +++VRI
Sbjct: 367 KNRIKKVRI 375


>gi|260903863|ref|ZP_05912185.1| CBS domain-containing protein [Brevibacterium linens BL2]
          Length = 417

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 115/223 (51%), Gaps = 11/223 (4%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           AS   +  + E+E+  ++        +++M+ R  +  V     + + M +F + G S +
Sbjct: 174 ASESDVIEDGEREMIQSVFNLSDTSANEVMVPRTDLVTVNSGTPLSKVMNLFFRSGFSRI 233

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV    LD+ RG+ +++DV   + H++ +     ++I      L + +LFVP +    DL
Sbjct: 234 PVSGEDLDDIRGVAYLKDVARRL-HLHPEDAERPVDI------LARGVLFVPETKPADDL 286

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           +  +Q     +A++IDE+GGT GLV+ EDIV  ++ +I  E+ +    +  V D +F+V 
Sbjct: 287 MEQMQVDSTHLAILIDEYGGTAGLVTIEDIVEEIVGEIEDEYDTSDDELVEVDDGSFVVS 346

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            R  + + A       +    E DV+S+GGL+  ++ R+P  G
Sbjct: 347 TRMSISDFADYFDVKID----EDDVNSVGGLLTKLIGRVPIDG 385


>gi|260912068|ref|ZP_05918627.1| CBS domain protein [Prevotella sp. oral taxon 472 str. F0295]
 gi|260633807|gb|EEX51938.1| CBS domain protein [Prevotella sp. oral taxon 472 str. F0295]
          Length = 420

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 130/241 (53%), Gaps = 13/241 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      +IM SR  I  ++ K    E +   ++   S +P+Y+++ DN 
Sbjct: 187 EERLLQGIIRFGDETAKEIMTSRKDIVDIDIKCNFSEVLESIKENNYSRIPIYQDNTDNI 246

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++  +               +LI+   FVP +  + DLL + QE++I 
Sbjct: 247 KGVLYVKDLLPHLTKPHT----------FRWQSLIRPPYFVPETKKIDDLLRDFQENKIH 296

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDARTDLEELA 252
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  + +   + ++ NTFI D +T L +L 
Sbjct: 297 IAIVVDEFGGTSGLVTLEDILEEIVGEINDEYDDETEKTYTKLNYNTFIFDGKTLLSDLC 356

Query: 253 KIIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           +I+  D +   + E   D+L GL+  +    P+ GE  L    +   IL  + R + RV+
Sbjct: 357 RILEVDDDEFSEVEGGADTLAGLLLELKGDFPSIGE-RLNYKDYLFEILAIEERRISRVK 415

Query: 312 I 312
           +
Sbjct: 416 V 416


>gi|216264749|ref|ZP_03436741.1| CBS domain pair protein [Borrelia burgdorferi 156a]
 gi|218249741|ref|YP_002374590.1| CBS domain pair protein [Borrelia burgdorferi ZS7]
 gi|221217424|ref|ZP_03588895.1| CBS domain pair protein [Borrelia burgdorferi 72a]
 gi|224533054|ref|ZP_03673660.1| CBS domain pair protein [Borrelia burgdorferi WI91-23]
 gi|224533923|ref|ZP_03674508.1| CBS domain pair protein [Borrelia burgdorferi CA-11.2a]
 gi|225549242|ref|ZP_03770215.1| CBS domain pair protein [Borrelia burgdorferi 94a]
 gi|225549769|ref|ZP_03770734.1| CBS domain pair protein [Borrelia burgdorferi 118a]
 gi|226320769|ref|ZP_03796325.1| CBS domain pair protein [Borrelia burgdorferi 29805]
 gi|226322029|ref|ZP_03797554.1| CBS domain pair protein [Borrelia burgdorferi Bol26]
 gi|215981222|gb|EEC22029.1| CBS domain pair protein [Borrelia burgdorferi 156a]
 gi|218164929|gb|ACK74990.1| CBS domain pair protein [Borrelia burgdorferi ZS7]
 gi|221192702|gb|EEE18918.1| CBS domain pair protein [Borrelia burgdorferi 72a]
 gi|224512048|gb|EEF82443.1| CBS domain pair protein [Borrelia burgdorferi WI91-23]
 gi|224512926|gb|EEF83292.1| CBS domain pair protein [Borrelia burgdorferi CA-11.2a]
 gi|225369729|gb|EEG99177.1| CBS domain pair protein [Borrelia burgdorferi 118a]
 gi|225370100|gb|EEG99540.1| CBS domain pair protein [Borrelia burgdorferi 94a]
 gi|226232619|gb|EEH31373.1| CBS domain pair protein [Borrelia burgdorferi Bol26]
 gi|226233824|gb|EEH32549.1| CBS domain pair protein [Borrelia burgdorferi 29805]
 gi|312148245|gb|ADQ30904.1| CBS domain pair protein [Borrelia burgdorferi JD1]
 gi|312149137|gb|ADQ29208.1| CBS domain pair protein [Borrelia burgdorferi N40]
          Length = 259

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|220919063|ref|YP_002494367.1| CBS domain containing protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956917|gb|ACL67301.1| CBS domain containing protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 425

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 122/254 (48%), Gaps = 16/254 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G  SE  +E+ +N+  FR+    D+M+ R  + AVE    V + +    + G S M
Sbjct: 182 AGRGGSGSEGTRELIHNVFEFREKVARDVMVPRTDVVAVELGTPVPQIIRTLSEEGHSRM 241

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY+ SLD   G++H RD++  ++H       I L      +++++   FVP S  V  L
Sbjct: 242 PVYRESLDQIAGVLHARDLVPLLAH----PELIVL------ADILRPAHFVPWSKPVEQL 291

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAV--SDNTFI 241
           L  +Q   + MA V+DE GG  G+ + ED++  ++ DI  E   +         +D +F 
Sbjct: 292 LREMQRRHLHMAFVVDEFGGVMGICTIEDVLEQIVGDIQDEFEEEDEGREVEQHADGSFT 351

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
           V     + E  +        +  +Q  +++ G + S+   IPARG+      G+   + +
Sbjct: 352 VQGAAAVAEFNR---AAQAGVPEDQGFETMAGFVSSLAGAIPARGDRFF-WKGWVFTVAE 407

Query: 302 ADVRCVRRVRIRRL 315
           AD R V +VR  R+
Sbjct: 408 ADPRRVVKVRAARV 421


>gi|219684823|ref|ZP_03539765.1| CBS domain pair protein [Borrelia garinii PBr]
 gi|219671768|gb|EED28823.1| CBS domain pair protein [Borrelia garinii PBr]
          Length = 259

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IM+ R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMVPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RDV+    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDVLL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|111114880|ref|YP_709498.1| hemolysin [Borrelia afzelii PKo]
 gi|110890154|gb|ABH01322.1| hemolysin [Borrelia afzelii PKo]
          Length = 259

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SSIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|86143787|ref|ZP_01062163.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Leeuwenhoekiella blandensis MED217]
 gi|85829830|gb|EAQ48292.1| putative transmembrane CorC/HlyC family transporter associated
           protein [Leeuwenhoekiella blandensis MED217]
          Length = 442

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 124/233 (53%), Gaps = 18/233 (7%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E++I   I+ F       +M  R+ I A+ ++ T  E + +  + G S +PV+  ++DN 
Sbjct: 208 EQKILKGIVSFGNTDTKQVMKPRMDIFALNEELTYQEVIPLIIENGYSRIPVFTENIDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+++++D++ +I                + ++L+++  FVP +  + DLL   ++ R  
Sbjct: 268 AGILYVKDLLPHIDKE-----------DFAWTSLLRDPYFVPENKKLDDLLNEFKDKRNH 316

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE+GGT GL+S EDI+  ++ DI+ E   +  + S + DN +I + +T L++  K
Sbjct: 317 LAIVVDEYGGTSGLISMEDIIEEIVGDISDEFDDEDIIFSKLDDNNYIFEGKTSLKDFYK 376

Query: 254 IIGTDCNCL----KGEQDVDSLGGLIFSVLDRIPARGEVV-LEIPGFEIVILD 301
           +I  + N      KGE   ++L G +  +    P + E++  E   F I ++D
Sbjct: 377 VIKLEDNTAFEDNKGE--AETLAGFLLEISKGFPRKNEILNFEHYAFTIEVID 427


>gi|329934651|ref|ZP_08284692.1| Magnesium and cobalt efflux protein CorC [Streptomyces
           griseoaurantiacus M045]
 gi|329305473|gb|EGG49329.1| Magnesium and cobalt efflux protein CorC [Streptomyces
           griseoaurantiacus M045]
          Length = 435

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 139/254 (54%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 174 AEAESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVVIERYKTIRQALTLALRSGFSRI 233

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV  +S D+  G+V+++D+        A+  +I+ +   +E++L+   +    FVP +  
Sbjct: 234 PVTGDSEDDIVGIVYLKDL--------ARKTHISRD---AENDLVSTAMRPAAFVPDTKN 282

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + ++ 
Sbjct: 283 AGDLLREMQQERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEELGEDR 342

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           F V AR D+ +L ++ G +      ++DV+++GGL+   L R+P  G   V+E+P    +
Sbjct: 343 FRVTARLDIGDLGELYGVEEY---DDEDVETVGGLLAKALGRVPIAGASSVVELPDERRL 399

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 400 RLTAEAAAGRRNKI 413


>gi|332297630|ref|YP_004439552.1| transporter-associated region [Treponema brennaborense DSM 12168]
 gi|332180733|gb|AEE16421.1| transporter-associated region [Treponema brennaborense DSM 12168]
          Length = 263

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 118/226 (52%), Gaps = 14/226 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
            + E   +E ++++   I    +  + ++MI R+ ++ +       E +      G S  
Sbjct: 21  GTTEEQLNEEKRDMIRGIEDLSETSVKEVMIPRIDVDFLSVGTPQNELLEKIADSGHSRF 80

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVY  S+DN  G+++++D+I+     +A+   I+L  Q      ++   FVP S  +  L
Sbjct: 81  PVYSESIDNVIGVLYVKDLIA----AFARHEAIDLEKQ------VRKAFFVPESKRIDTL 130

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L   +   + +A+ IDE+GG  G+V  EDI+  ++ DI  E  +++  I ++ DN ++ D
Sbjct: 131 LREFKRRHVHIAIAIDEYGGISGIVCMEDIIEEIVGDIQDEFDNEREDIISLGDNIWLCD 190

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           AR +L++L + IG+        ++ D+LGG +F +  +IP + E V
Sbjct: 191 ARVNLDDLNETIGSGFP----NEEFDTLGGFVFDLFGKIPVKYEKV 232


>gi|288928128|ref|ZP_06421975.1| CBS domain protein [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330962|gb|EFC69546.1| CBS domain protein [Prevotella sp. oral taxon 317 str. F0108]
          Length = 420

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 130/241 (53%), Gaps = 13/241 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+++   I+RF      +IM SR  I  ++ K    E +   ++   S +P+Y+++ DN 
Sbjct: 187 EEKLLQGIIRFGDETAKEIMTSRKDIVDIDIKCNFSEVLESIKENNYSRIPIYQDNTDNI 246

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++  +               +LI+   FVP +  + DLL + QE++I 
Sbjct: 247 KGVLYVKDLLPHLTKPHT----------FRWQSLIRPPYFVPETKKIDDLLRDFQENKIH 296

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK-KSMISAVSDNTFIVDARTDLEELA 252
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+  + +   + ++ NTF+ D +T L +L 
Sbjct: 297 IAIVVDEFGGTSGLVTLEDILEEIVGEINDEYDDETEKTYTKLNYNTFVFDGKTLLSDLC 356

Query: 253 KIIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           +I+  D     + E   D+L GL+  +    P+ GE  L    +   IL  + R + RV+
Sbjct: 357 RILEVDDEEFSEVEGGADTLAGLLLELKGDFPSIGE-RLNYKNYLFEILAIEERRISRVK 415

Query: 312 I 312
           +
Sbjct: 416 V 416


>gi|68535987|ref|YP_250692.1| hypothetical protein jk0910 [Corynebacterium jeikeium K411]
 gi|68263586|emb|CAI37074.1| putative membrane protein [Corynebacterium jeikeium K411]
          Length = 456

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 114/224 (50%), Gaps = 14/224 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G F+E++  I +  LRF     +D+M  R ++ ++    T  + + +  + G S  PV +
Sbjct: 200 GGFTESKARILDLSLRFSDASAEDVMTPRSTVESLTVDETALDLIELALETGHSRFPVTR 259

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             LD   G+VH++D ++ I H    T  +N         L+KN+  VP S+   D+L  +
Sbjct: 260 GDLDETVGVVHVKDALT-IPHDSRPTTTLN--------KLMKNVPSVPDSLSGDDVLNQV 310

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT-FIVDART 246
           + +  ++ +V+DE+GGT G+V+ ED+V  ++ ++  EH   +         T + V    
Sbjct: 311 RAAGSQLVMVVDEYGGTAGIVTIEDVVEEILGEVWDEHDDVEEDKEVRKTGTHWEVSGLV 370

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
             +EL   +G        E D D+LGGLI + L RIPA G+ VL
Sbjct: 371 RTDELPDAVGYTAP----EGDYDTLGGLIMATLGRIPAEGDEVL 410


>gi|261880597|ref|ZP_06007024.1| CBS domain protein [Prevotella bergensis DSM 17361]
 gi|270332716|gb|EFA43502.1| CBS domain protein [Prevotella bergensis DSM 17361]
          Length = 435

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 129/241 (53%), Gaps = 14/241 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      +IM SR  I  ++ +++  E +    +   S +PVY+++ DN 
Sbjct: 204 EQSMLRGIIRFGDETAKEIMTSRQDIVRIDIRSSYQEVLDCIVESNYSRIPVYQDNDDNI 263

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ ++S                  +L++   FVP +  + DLL   Q++++ 
Sbjct: 264 RGVLYIKDLLPHLSK----------KADFRWQSLMRPPYFVPETKKIDDLLHEFQDNKVH 313

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT GLV+ EDI+  ++ +I  E+    +  S +S NT++ + +T L +  K
Sbjct: 314 IAIVVDEFGGTSGLVTMEDILEEIVGEINDEYDDDDNGYSKLSYNTYLFEGKTLLSDFCK 373

Query: 254 IIGTDCNCLKGEQ-DVDSLGGLIFSVL-DRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
           ++  D N    E  D D+L GL+  +  D +  R +  LE   +   +++ + R + RV+
Sbjct: 374 VLQVDSNEFAEEYPDADTLAGLLLEIKGDFLSVREK--LEYKNYRFEVMNVEGRRISRVK 431

Query: 312 I 312
           +
Sbjct: 432 V 432


>gi|303232584|ref|ZP_07319270.1| conserved hypothetical protein [Atopobium vaginae PB189-T1-4]
 gi|302481371|gb|EFL44445.1| conserved hypothetical protein [Atopobium vaginae PB189-T1-4]
          Length = 436

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 130/248 (52%), Gaps = 13/248 (5%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G  S+ EK + ++I         ++MI RV + A+ED +TV + +      G S +P+Y 
Sbjct: 192 GELSDEEKSMIHDIFDLADTIAREVMIPRVDMCALEDTSTVEDVLSTMRTTGYSRVPIYH 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             +D+  G+ H++D+I+ +   +A    I        S  I+   F P +  +  LL+ +
Sbjct: 252 GEVDHIVGIAHIKDLIAALLDKHAAAQPI--------SGFIREADFYPDTKDIIPLLSEM 303

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           + S  +M +V+DE+GGT G+++ EDIV  ++ +I  E       ++ ++ N ++VD R  
Sbjct: 304 RSSHDQMVIVVDEYGGTAGIITIEDIVEEIVGEIEDEFDPDNKYLTKLAPNKWLVDGRFS 363

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           +++ A+ +G     ++ + D +++ G + ++ D +PA G+V +   G+E  +       V
Sbjct: 364 VDD-ARELGWP---IEDDPDYETIAGFVLNLADGLPAPGDVFIH-EGYEFRVQSMRRTRV 418

Query: 308 RRVRIRRL 315
             VR+R L
Sbjct: 419 STVRVRAL 426


>gi|213965978|ref|ZP_03394168.1| integral membrane transporter with CBS domain [Corynebacterium
           amycolatum SK46]
 gi|213951392|gb|EEB62784.1| integral membrane transporter with CBS domain [Corynebacterium
           amycolatum SK46]
          Length = 478

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 120/226 (53%), Gaps = 13/226 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           +S EG  +    E+    + F +    D+M  R  I  +ED+ +V E + +    G +  
Sbjct: 194 SSDEGKINPQTAELVARSIEFGERTAADVMTPRTQIIFIEDQ-SVAEMLTVVADSGHARF 252

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV  NS+D+ RG+VH  D++S + H    T         S ++L K++L V  S  +  L
Sbjct: 253 PVVGNSVDDIRGVVHYTDLLS-VPHAQRLTT--------SAASLAKDVLVVNDSTTLDPL 303

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           +  ++E   + A+V+DE+GGTDG+V+ ED+V  ++ +I  E   +  + S +S NT IV 
Sbjct: 304 MRQLREDAYQFAVVVDEYGGTDGIVTLEDLVEEIVGEIDDEQDDRSLLYSRISPNTVIVS 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
                +EL +I+  +    +GE+  D++GG I   LDR+P  G+ V
Sbjct: 364 GLMRPDELGEIL--NLVLPEGEES-DTIGGFITERLDRMPRFGDTV 406


>gi|195941798|ref|ZP_03087180.1| hemolysin (tlyC) [Borrelia burgdorferi 80a]
          Length = 238

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNALKETIVKEIMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|119952862|ref|YP_945071.1| magnesium and cobalt efflux protein CorC [Borrelia turicatae
           91E135]
 gi|119861633|gb|AAX17401.1| magnesium and cobalt efflux protein CorC [Borrelia turicatae
           91E135]
          Length = 259

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 117/217 (53%), Gaps = 12/217 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S+ E  +  N    ++  + +IMI R+S+  V+   +  E + +      S  PVY+ ++
Sbjct: 25  SKFETSLLKNFNSLKETIVKEIMIPRISVVFVDYSWSKDEILKVVTSSNHSRFPVYRETI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           D+  G++H +D++    HM+ +        ++   ++++ ++FVP S  +  LL   QE+
Sbjct: 85  DDIIGIIHTKDILL---HMWKRDF-----YEIDLRDIMRKVMFVPESKKIDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++  AR  +E+
Sbjct: 137 HVHIAIVVDEYGGVAGLVTLEDILEEIVGDIQDEFDNELDEIVPLDDGSYLCTARVLIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           L + +G        + D D+LGG ++ +  RIP + E
Sbjct: 197 LNEKLGLSL----PDGDFDTLGGFVYDLFGRIPLKNE 229


>gi|308513314|ref|NP_953331.3| CBS domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39984271|gb|AAR35658.1| CBS domain protein [Geobacter sulfurreducens PCA]
          Length = 250

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 121/238 (50%), Gaps = 14/238 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +  +I   R   + +IM+ R  +  V   A V   +      G S +PVY  ++DN  G+
Sbjct: 17  MIRSIFELRDTIVREIMVPRTDMACVSADAAVANVLNTIISCGHSRIPVYDGTVDNIIGL 76

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           ++ +D++ Y          I+L        +++   F+P +  + +LL   +  R+ +A+
Sbjct: 77  IYAKDLLKYWGM---SEPAIDLK------RIMRAPYFIPETKNLEELLQEFKRKRVHIAI 127

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           VIDE+GGT GLV+ ED++  ++ DI  E+  ++  +    D + +VDAR  +E+L +  G
Sbjct: 128 VIDEYGGTSGLVTIEDLLEQIVGDIQDEYDLEEEWLEEEPDGSILVDARLPIEDLEEYFG 187

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            +       +  D++ GLIF +  RIP   E V E     + +L+A  R +++VRI R
Sbjct: 188 IEVE----REKFDTVAGLIFHLTGRIPMVREEV-ESDTLRMTVLEAGERNIKKVRIAR 240


>gi|219685399|ref|ZP_03540218.1| CBS domain pair protein [Borrelia garinii Far04]
 gi|219673172|gb|EED30192.1| CBS domain pair protein [Borrelia garinii Far04]
          Length = 259

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IM+ R+ +  V+   +  E + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNAIKETIVKEIMVPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RDV+    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDVLL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|159039361|ref|YP_001538614.1| CBS domain-containing protein [Salinispora arenicola CNS-205]
 gi|157918196|gb|ABV99623.1| CBS domain containing protein [Salinispora arenicola CNS-205]
          Length = 464

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 134/249 (53%), Gaps = 14/249 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+    E+++ +++         ++M+ R  +  +E    + +A+ +F + G S +
Sbjct: 190 AEQRGVVEHGERQMIHSVFALGDTIAREVMVPRTEMVWIERHKMLSQALALFLRSGFSRI 249

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S+D+  G+++++D+I               + +L  + L++   FVP S  V DL
Sbjct: 250 PVIGESVDDVLGVLYLKDLIRRTQ------GGAPEDRRLPVAELMRPATFVPESKPVDDL 303

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L+ +Q +R  + +V+DE+GGT GLV+ EDI+  ++ +IT E+  ++  +  + D+   V 
Sbjct: 304 LSEMQAARNHLVIVVDEYGGTGGLVTIEDILEEIVGEITDEYDVERPPVERLDDDAVRVT 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           AR  +++L ++  T+   L G++ V+++GGL+   L R+P  G  V E+ G  ++   A+
Sbjct: 364 ARLPVDDLGELFDTE---LPGDE-VETVGGLLAQSLGRVPIPGAQV-EVAGLRLL---AE 415

Query: 304 VRCVRRVRI 312
               RR RI
Sbjct: 416 GTTGRRNRI 424


>gi|282898905|ref|ZP_06306889.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196216|gb|EFA71129.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 451

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 113/216 (52%), Gaps = 10/216 (4%)

Query: 73  TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDN 132
            E+E+ NN+  F +I    +MI R +I ++   A+  + +      G S  PV   SLD+
Sbjct: 219 AERELLNNVFEFGEITTQSVMIPRTNIISLSVDASFQKLLEEITSSGYSRYPVIGESLDD 278

Query: 133 PRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            RG+++ +D+ + +S          +N +      +++  FVP   LVS+LL+ +Q  + 
Sbjct: 279 IRGIIYFQDLATPLSQG-------KMNPETKIYPWMRSPRFVPEQTLVSELLSMMQREKS 331

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
            M +V+DE G T G+++  D++  ++    +   ++   I  +   +F+V A+T+LEEL 
Sbjct: 332 TMVIVVDEFGATAGMITIGDVIEEIIGHAGNSSANEGVAIQRLERQSFLVQAQTNLEELN 391

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
           + +  D    +   +  +LGG +   L RIP++GE+
Sbjct: 392 RFLQIDLPLAR---EYQTLGGFLLYQLQRIPSKGEI 424


>gi|315225214|ref|ZP_07867031.1| CBS domain protein [Capnocytophaga ochracea F0287]
 gi|314944897|gb|EFS96929.1| CBS domain protein [Capnocytophaga ochracea F0287]
          Length = 442

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 128/254 (50%), Gaps = 20/254 (7%)

Query: 46  WKLMKLSHHKG-IRLPRIDASLEGIFSE----TEKEIFNNILRFRKIRIDDIMISRVSIN 100
           W   KL   K  I + ++  +LE    E     EK+I   I+ F      ++M+ RV I 
Sbjct: 172 WIQKKLGKQKSNISVGQLSQALELASEEDTTNEEKKILEGIVSFGNTETREVMVPRVDIF 231

Query: 101 AVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNI 160
           A+ ++ +  E +      G S +PVY  +LD+  G+++++D++ ++       N++    
Sbjct: 232 ALSEELSYQELLNEIVAIGYSRIPVYHENLDHITGVIYIKDLLPHLDKTDFDWNSVK--- 288

Query: 161 QLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRD 220
                   +N  FVP +  + DLL+  QE +I +A+V+DE+GGT G+++ EDI+  ++ +
Sbjct: 289 --------RNAFFVPENKKLDDLLSEFQEKKIHLAVVVDEYGGTCGVITLEDIIEEIVGN 340

Query: 221 ITSEHHSKKSMISAVSDNTFIVDARTDLEELAKII--GTDCNCLKGEQ--DVDSLGGLIF 276
           I  E   +    S ++DN FI + +T L++  +I+    +   L  E   D ++L G + 
Sbjct: 341 INDEFDDEDVTHSKINDNVFIFEGKTVLKDFYRILEFTDEEEALFDENRGDAETLAGFLL 400

Query: 277 SVLDRIPARGEVVL 290
            +    P +G  +L
Sbjct: 401 EISGNFPQKGTPIL 414


>gi|281422908|ref|ZP_06253907.1| CBS domain protein [Prevotella copri DSM 18205]
 gi|281403038|gb|EFB33718.1| CBS domain protein [Prevotella copri DSM 18205]
          Length = 436

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 121/215 (56%), Gaps = 11/215 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +   I+RF      ++M SR +I  ++ +++  E +   E+   S +PVY+++ DN 
Sbjct: 193 EQSMLKGIIRFGDETAKEVMTSRQNIVDLDIRSSYPEVLKCIEENNYSRIPVYQDNTDNI 252

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG+++++D++ +++    K +N          +LI+   FVP +  + DLL   Q++++ 
Sbjct: 253 RGVLYIKDLLPHLT----KASNFRWQ------SLIRPPYFVPETKKIDDLLREFQDNKVH 302

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   S ++ NTF+ + +T L +  K
Sbjct: 303 IAIVVDEFGGTSGIVTLEDILEEIVGEINDEYDEEEKFYSKLNYNTFVFEGKTLLSDFCK 362

Query: 254 IIGTDCNCLKGEQ-DVDSLGGLIFSVLDRIPARGE 287
           I+  D    +  + D DSL GL+  +    P+  E
Sbjct: 363 ILNVDDEEFEEVEGDADSLAGLLLEIKGDFPSMHE 397


>gi|319789455|ref|YP_004151088.1| protein of unknown function DUF21 [Thermovibrio ammonificans HB-1]
 gi|317113957|gb|ADU96447.1| protein of unknown function DUF21 [Thermovibrio ammonificans HB-1]
          Length = 416

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 131/251 (52%), Gaps = 17/251 (6%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           +++S   +  +TE+ I  NIL  R+  + DI     S+ AV D A V EA+ +FEK G S
Sbjct: 179 VESSSRLLVEKTERRILGNILNLREKSVGDIYTPLSSVIAVSDNAAVGEALELFEKSGFS 238

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +PVY+   DN  G + + D+IS          + ++ ++     +++ +L +P  M + 
Sbjct: 239 KLPVYRERFDNIVGYLLISDLIS--------VTDDSMKVK----EIMRPVLVLPEYMSIF 286

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
           D L   ++S+ ++ +V+DE G T G+V+ EDI+  ++  I  E   K ++    + NT  
Sbjct: 287 DALREFRKSKEQLGIVVDEFGSTLGIVTVEDILEEIVGRIEDE-FDKTTLHITKTGNTVT 345

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            DA  ++EE+ K++    + L    D  ++ GLI S L R P  GE V E+P   I +  
Sbjct: 346 ADALVEVEEINKLLR---HKLPKSPDYTTVAGLILSKLGRFPQPGEKV-ELPLHTITVNS 401

Query: 302 ADVRCVRRVRI 312
            + R + +V I
Sbjct: 402 LNGRRIGKVTI 412


>gi|152967329|ref|YP_001363113.1| CBS domain containing protein [Kineococcus radiotolerans SRS30216]
 gi|151361846|gb|ABS04849.1| CBS domain containing protein [Kineococcus radiotolerans SRS30216]
          Length = 438

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 125/250 (50%), Gaps = 15/250 (6%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +    E+ + N++       + ++M+ R  + +    A ++E   +  + G S MPV   
Sbjct: 183 VIEAGERRMINSVFELGDTLVREVMVPRTDVVSARRGAGLHEVEALLLRSGFSRMPVIGE 242

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
             D   G+V+++DV          T+ +    +  E+ + +  +FVP S+ V +LL  +Q
Sbjct: 243 DADEVLGIVYLKDVARRF-----HTDPVAARAERVET-VARQTVFVPDSLPVDELLRQMQ 296

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
                +A+V+DE+GGT GLV+ ED++  ++ DI  E+      +  + D  F V +R  +
Sbjct: 297 RDTTHVAIVVDEYGGTAGLVTIEDVIEEIVGDIADEYDRAAPDVEPLPDGGFRVSSRLHV 356

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVR 308
           E+L ++   +      ++DVD++GGL+   L  +   G V  E+ G     L+AD R  R
Sbjct: 357 EDLGELFEKEIE----DEDVDTVGGLLAKTLGEVLVPGAVA-EVHGLR---LEADARVGR 408

Query: 309 RVRIRR-LVH 317
           R ++R  LVH
Sbjct: 409 RNQVRTVLVH 418


>gi|288925728|ref|ZP_06419659.1| CBS domain protein [Prevotella buccae D17]
 gi|288337383|gb|EFC75738.1| CBS domain protein [Prevotella buccae D17]
          Length = 423

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 119/247 (48%), Gaps = 27/247 (10%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F   ++ D M+ R  INA+E+ A + E   +F + G S + VY+  +D
Sbjct: 198 EDEVKIFQNALDFSDTKVRDCMVPRTEINAIEENAPLEELRQLFIESGNSKIIVYREDID 257

Query: 132 NPRGMVH----MRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +  G +H     R+   +I H                   ++ + FVP +M    L+   
Sbjct: 258 HIIGYIHSSEMFRNPRRWIDH-------------------VRTMPFVPETMAAQKLMKIF 298

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            + +  + +V+DE GGT G+V+ EDIV  +  DI  EH S K +     D  +++ AR +
Sbjct: 299 MQQKKTLGVVVDEFGGTSGIVALEDIVEEIFGDIEDEHDSDKYIAKRTDDGDYVLSARLE 358

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           ++++ +I       L    D  +LGGLI       P   E+V +I  ++I IL A +  +
Sbjct: 359 IDKINEIFDL---GLPESDDYMTLGGLILHDYQSFPKLNEIV-KIGSYDIKILKASMTKI 414

Query: 308 RRVRIRR 314
             V++ +
Sbjct: 415 ELVKLHK 421


>gi|254384275|ref|ZP_04999618.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194343163|gb|EDX24129.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 446

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 123/249 (49%), Gaps = 22/249 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G   +   E+F   L    +  +++M  RV + A++ +AT  +        G S  PVY+
Sbjct: 196 GALEKDTAELFVRTLNLADLTAENVMTPRVQVTALDLQATAEDVANATLATGLSRFPVYR 255

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            SLD   G VH++DV++  +    +T         + S L++  L VP S+ V  LL  +
Sbjct: 256 GSLDTVVGTVHIKDVLALPAEERHRT---------AVSQLLREPLLVPESLTVDRLLDRL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH--HSKKSMISAVSDNT----FI 241
              R  MA+VIDE+GGT G+V+ EDIV  ++ ++  EH  H    +  A +D +    + 
Sbjct: 307 S-GRQTMAVVIDEYGGTAGVVTLEDIVEEVVGEVRDEHDPHETPDLAPAGTDASGRALYS 365

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILD 301
            D     ++L +I          E   ++L GLI + L RIPA G+  LE+ G+ + ++D
Sbjct: 366 ADGAARTDQLRRI-----GLRVPEGPYETLAGLIATELGRIPAVGD-SLELDGWHLDVVD 419

Query: 302 ADVRCVRRV 310
           A  R   RV
Sbjct: 420 ASGRRAARV 428


>gi|332670851|ref|YP_004453859.1| CBS domain-containing protein [Cellulomonas fimi ATCC 484]
 gi|332339889|gb|AEE46472.1| CBS domain containing protein [Cellulomonas fimi ATCC 484]
          Length = 437

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 115/219 (52%), Gaps = 5/219 (2%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           +  + E+++F ++L        ++M+ R  +        V++A+ +  + G S +PV   
Sbjct: 172 VIEDDERDMFRSVLELGDTLTREVMVPRTDMVTTNADTPVHKAIALLLRSGFSRVPVVGE 231

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTN-NINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           S+D+ RG+++++DV+  +  +    + + +  +    S++ +  ++VP S  V +LL  +
Sbjct: 232 SVDDLRGVLYLKDVVRRLRLVPGVGDPDADAFLAAPASSVARPAVYVPESKPVDELLREL 291

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
           Q     +A+V+DE+GG  GLV+ ED +  ++ ++T EH      +  + D  + V AR  
Sbjct: 292 QAGASHIAMVVDEYGGIAGLVTIEDALEEIVGELTDEHDRSAPEVEDLGDGVYRVPARLG 351

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            +EL ++ G        ++DVDS GGL+   L ++P  G
Sbjct: 352 RDELGELFGLQVE----DEDVDSAGGLLAKALGKVPLPG 386


>gi|88801329|ref|ZP_01116857.1| putative hemolysin [Polaribacter irgensii 23-P]
 gi|88781987|gb|EAR13164.1| putative hemolysin [Polaribacter irgensii 23-P]
          Length = 401

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 124/233 (53%), Gaps = 23/233 (9%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F  ++  ++M+ R  I AVE    V     +F + G S + VYK+S+D
Sbjct: 173 DSEIQIFQNALGFHNVKGREVMVPRTEITAVEIHEKVTNLESIFIETGLSKVLVYKSSMD 232

Query: 132 NPRGMVHMRDVISYIS--HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
                    DV+ YI+   ++ K   I         +++  I  VP SM+++++L  + +
Sbjct: 233 ---------DVVGYINAFELFKKPKTI--------KSILLPIEIVPESMMINNILNILMK 275

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
            R  +A+V+DE+GGT G+++ EDIV  L  +I  EH S++ +   + + TF   AR +++
Sbjct: 276 KRKSVAVVVDEYGGTSGMITVEDIVEELFGEIEDEHDSQEFLEEKIDEFTFKFSARLEVD 335

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
            L +    D    K E   ++LGG I    + IP   E VL+I GFEI IL+ 
Sbjct: 336 YLNE--EYDLEIPKSEA-YETLGGFILEHTENIPEENE-VLDIEGFEIRILNT 384


>gi|298506319|gb|ADI85042.1| CBS and CorC_HlyC domain protein [Geobacter sulfurreducens KN400]
          Length = 284

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 121/238 (50%), Gaps = 14/238 (5%)

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +  +I   R   + +IM+ R  +  V   A V   +      G S +PVY  ++DN  G+
Sbjct: 51  MIRSIFELRDTIVREIMVPRTDMACVSADAAVANVLNTIISCGHSRIPVYDGTVDNIIGL 110

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMAL 196
           ++ +D++ Y          I+L        +++   F+P +  + +LL   +  R+ +A+
Sbjct: 111 IYAKDLLKYWGM---SEPAIDLK------RIMRAPYFIPETKNLEELLQEFKRKRVHIAI 161

Query: 197 VIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIG 256
           VIDE+GGT GLV+ ED++  ++ DI  E+  ++  +    D + +VDAR  +E+L +  G
Sbjct: 162 VIDEYGGTSGLVTIEDLLEQIVGDIQDEYDLEEEWLEEEPDGSILVDARLPIEDLEEYFG 221

Query: 257 TDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            +       +  D++ GLIF +  RIP   E V E     + +L+A  R +++VRI R
Sbjct: 222 IEVE----REKFDTVAGLIFHLTGRIPMVREEV-ESDTLRMTVLEAGERNIKKVRIAR 274


>gi|309790518|ref|ZP_07685076.1| CBS domain containing protein [Oscillochloris trichoides DG6]
 gi|308227434|gb|EFO81104.1| CBS domain containing protein [Oscillochloris trichoides DG6]
          Length = 434

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 129/256 (50%), Gaps = 34/256 (13%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+E+   ++ F    + +IM+ RV I A+E    + +A+ +    G S +PVY
Sbjct: 176 EGLIEHDEREMIEGVIAFGNTLLREIMVPRVDIVALEVDTPLEKALDVVISGGHSRIPVY 235

Query: 127 KNSLDNPRGMVHMRDVISYIS----HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
             +++   G+++ +D+I  +     HM   T             L++   FVP +M V+ 
Sbjct: 236 NETVNQIVGILYAKDLIPALRDGQRHMPINT-------------LLRPAHFVPETMRVNA 282

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL ++Q+ ++ MA+++DE+G T GL + ED++  ++ +I  E+ ++   I  + +  +IV
Sbjct: 283 LLEDLQQRKVHMAIIVDEYGNTAGLATIEDLIEQIVGEIQDEYDTEDPSIQPIDEGIYIV 342

Query: 243 DARTDLEELAKIIGTDCNCLK----GEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEI 297
           D R  ++        D N L          D +GGL++  L R+P  G E++LE    E 
Sbjct: 343 DGRVAID--------DVNYLADLKLASDSADRIGGLVYEQLGRVPRVGDELLLE----EA 390

Query: 298 VILDADVRCVRRVRIR 313
            I    V+ +R  ++R
Sbjct: 391 TITVLSVKGIRPQKLR 406


>gi|302670573|ref|YP_003830533.1| hypothetical protein bpr_I1212 [Butyrivibrio proteoclasticus B316]
 gi|302395046|gb|ADL33951.1| hypothetical protein bpr_I1212 [Butyrivibrio proteoclasticus B316]
          Length = 455

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 131/255 (51%), Gaps = 19/255 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           +G+  ETE ++  NI  F      DIM +R ++ A++   ++ EA+        S  PVY
Sbjct: 198 QGVLQETEADMITNIFEFSDKEARDIMTNRKAMVAIDANMSLKEAVGFMMDTNNSRFPVY 257

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSMLVSD 182
            + +D+  G++H+RD +  +S    +  +  L I+      IK IL    FVP +  +  
Sbjct: 258 LDDIDHIIGIMHIRDAMKKLS----EETDEELPIR-----KIKGILRQPKFVPETRNIDS 308

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDN-TFI 241
           L  ++Q ++ +M ++IDE+G T GLV+ EDI+  ++ +I  E+   ++ I    ++  ++
Sbjct: 309 LFHSMQSTKTQMVIIIDEYGQTAGLVTMEDILEEIVGNIMDEYDEDENFIKPTKNSGEYL 368

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIP-ARGEVVLEIPGFEIVIL 300
           V+  T LE L K          GE + ++L G + S LDRIP A  E    + G+   IL
Sbjct: 369 VEGTTPLEVLEKRFKISF----GESEFETLNGYMISQLDRIPEADEEFSTTVDGYSFKIL 424

Query: 301 DADVRCVRRVRIRRL 315
             D   V+ V++ +L
Sbjct: 425 SVDNHMVQSVQVNKL 439


>gi|332879533|ref|ZP_08447228.1| gliding motility-associated protein GldE [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332682499|gb|EGJ55401.1| gliding motility-associated protein GldE [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 448

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 157/320 (49%), Gaps = 34/320 (10%)

Query: 6   KINSSEHPKEKNEGIDLSPSISKTSVPAF-WTRTI-----RALCKTWKLMKLSHHKGIRL 59
           KI SS+H          + S  +   P+F W   +       L ++ KL     HK  R 
Sbjct: 139 KIYSSQH----------TLSFCRMVAPSFVWIEKLFWPLSSLLVRSRKLATKVVHKEKRA 188

Query: 60  PRIDASLEGI------FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAML 113
             +D   + +      +   E+ +   I+RF      +IM  R+ I  ++ K    E + 
Sbjct: 189 ISVDELEQALELTDKKYIAEEQNMLEGIIRFGGEMAKEIMTPRMDIVDLDMKTPYPEVLQ 248

Query: 114 MFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILF 173
              +   S +PVY +S DN +G+++++D++ +++    K  N          +LI+   F
Sbjct: 249 CIVESNYSRIPVYADSRDNIKGVLYIKDLLPHLN----KPANFRWQ------SLIRPPYF 298

Query: 174 VPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMIS 233
           VP + ++ DLL + Q++++ +A+V+DE GGT G+V+ EDI+  ++ +I  E+   +    
Sbjct: 299 VPETKMIDDLLGDFQKNKVHIAIVVDEFGGTSGIVTMEDIIEEIVGEINDEYDEDERQYV 358

Query: 234 AVSDNTFIVDARTDLEELAKIIGTDCNCLKG-EQDVDSLGGLIFSVLDRIPARGEVVLEI 292
            ++ NT++ +A+  L +  +I+  D +  +  E + D+L GL+  +    P R EV+ + 
Sbjct: 359 RLNANTYVFEAKVLLTDFFRIMKLDDDFFEEVEGEADTLAGLLLEIKGEFPERHEVI-KY 417

Query: 293 PGFEIVILDADVRCVRRVRI 312
             +   +L+ D R + ++++
Sbjct: 418 KNYCFEVLEMDDRRLLKIKV 437


>gi|148269227|ref|YP_001243687.1| hypothetical protein Tpet_0082 [Thermotoga petrophila RKU-1]
 gi|147734771|gb|ABQ46111.1| protein of unknown function DUF21 [Thermotoga petrophila RKU-1]
          Length = 455

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 119/221 (53%), Gaps = 10/221 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  E E+ I       ++I + +IM  RV I A+E+  TV + + + E  G S +PVYK
Sbjct: 192 GVIEEEEERIIKRAFEMKQIAVKEIMTPRVDIVAIEENQTVKDLIELVEDEGYSRIPVYK 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+ + +DV+S ++    +         +   ++++  L+VP +M + +LL  +
Sbjct: 252 ETIDNIVGICYAKDVLSILAAKDCEEVK-----AMKVKDIMREALYVPETMNIDELLKIL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  +I +A+V+DE+GGT G+V+ EDI+  L  +I  E+ + + S I  + + TF+VD  T
Sbjct: 307 KAKKIHIAIVVDEYGGTAGIVTLEDIIEELFGNIMDEYDYDEISGIRKIDERTFVVDGTT 366

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            + +    I  +      E + +++ G +     RIP  GE
Sbjct: 367 PIND----IEMELRVQFPETEYETIAGYLLEHFKRIPNVGE 403


>gi|32141174|ref|NP_733576.1| hypothetical protein SCO2534 [Streptomyces coelicolor A3(2)]
 gi|24419032|emb|CAD55195.1| putative membrane protein [Streptomyces coelicolor A3(2)]
          Length = 434

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 137/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +    E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEAEERRMVHSVFELGDTLVREVMVPRTDLVVIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV  +S D+  G+V+++D++        +  +I+ +   +ES+L+   +    FVP +  
Sbjct: 235 PVTGDSEDDIVGIVYLKDLV--------RRTHISRD---AESDLVSTAMRPASFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  +  + 
Sbjct: 284 AGDLLREMQKERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEELGGDR 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           F V AR D+ +L ++ G D      ++DV+++GGL+   L R+P  G   ++E+P    +
Sbjct: 344 FRVTARLDIGDLGELYGLDEY---DDEDVETVGGLLAKALGRVPIAGASSIVELPDGREL 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAEAAAGRRNKI 414


>gi|154249684|ref|YP_001410509.1| hypothetical protein Fnod_1002 [Fervidobacterium nodosum Rt17-B1]
 gi|154153620|gb|ABS60852.1| protein of unknown function DUF21 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 443

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 139/274 (50%), Gaps = 25/274 (9%)

Query: 22  LSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLE-----GIFSETEKE 76
           LSP +S      F+        K +   K++    I +  I + LE     G     E  
Sbjct: 140 LSPLVS------FFVTVSNYFVKLFGGQKVAEAPFITMDDIASYLEMGREEGTIDHEEGL 193

Query: 77  IFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPVYKNSLDNPR 134
           +    +   +  + +IMI R+ + AVE+  T+ E +  ++ E+Y R  +PVY++++DN  
Sbjct: 194 MVERTIAMDETLVKEIMIPRIDVVAVEETQTLGEVINVIIEEEYSR--IPVYRDTIDNVV 251

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+ + +D++S+I+   +   N    +++ E  L++  LFVP  M VS+LL   +  ++ M
Sbjct: 252 GICYAKDILSFIAQRGSDVMN---KVRVKE--LMRPPLFVPEVMPVSELLKEFKSKKVHM 306

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAK 253
           A+V+DE+GGT G+V+ EDI+  +  +I  E+   +S  I  + D T++VDA   L ++ +
Sbjct: 307 AIVVDEYGGTAGIVTMEDILEEIFGEIMDEYDEHESTGIKKLDDFTYLVDATLSLNDIER 366

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
               +      E + ++L G +      IP  GE
Sbjct: 367 ----ELRIEFPEGEFETLAGYLLDKFHHIPKVGE 396


>gi|15807170|ref|NP_295899.1| hypothetical protein DR_2176 [Deinococcus radiodurans R1]
 gi|6459977|gb|AAF11725.1|AE002051_1 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 446

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 135/258 (52%), Gaps = 19/258 (7%)

Query: 52  SHHKG-----IRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKA 106
            HH       IR+    +S EG+  ++EKE+  N+       + ++M  RV +  V+   
Sbjct: 175 GHHTAYSEEEIRMIVSASSQEGVLEDSEKELVYNVFDLSDTTVREVMRPRVDMVTVDSAL 234

Query: 107 TVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESN 166
            +   + + +++G S +PVY+++ DN  G+ H+ DV+ ++  +            L+ ++
Sbjct: 235 PLRRLLELNDEHGYSRVPVYQDTGDNIVGIAHIGDVLRHLGELD----------HLTIAD 284

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH- 225
           +++ + FVP +M + DLL  ++  +  M++V+DE GGT GLV+ ED +  ++ +I  E  
Sbjct: 285 IMRPVFFVPEAMKIKDLLAKMRAKKSHMSIVVDEFGGTMGLVTLEDAIEEIVGEIYDETV 344

Query: 226 HSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPAR 285
             ++  I  +++  +++DA   + E+ + +G+  N   GE + D+L G + S    IP  
Sbjct: 345 EEEEQPIIVIAEGIYLMDASLTVHEVEERLGS--NLEDGEAEYDTLAGFMTSHFGDIPEV 402

Query: 286 GEVVLEIPGFEIVILDAD 303
           G+  +   G+   + +AD
Sbjct: 403 GQSFVH-GGWSFTVEEAD 419


>gi|313672926|ref|YP_004051037.1| hypothetical protein Calni_0963 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939682|gb|ADR18874.1| protein of unknown function DUF21 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 422

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 131/242 (54%), Gaps = 17/242 (7%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    +KE+ +NI    +  + +IM+    +  +E   ++ E +    K   S +P+Y
Sbjct: 181 EGVLENQKKEMLHNIFEISETSVKEIMVPLNDVTMIEISTSINEIIDTIAKTEYSRIPIY 240

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           + + DN  G+++ +D+I YI+    K     LNI+    N++K   FVPS+  + DLL  
Sbjct: 241 EENKDNVIGILYSKDIIKYINKGLEK-----LNIK----NILKKPYFVPSTKRIDDLLRE 291

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDAR 245
            Q +RI +ALV+DE+G  DGL++ EDI+  ++ +I       ++  I  + ++ +IV  R
Sbjct: 292 FQINRIHLALVVDEYGSIDGLITLEDILEEIVGEIRDEYDKEEEEDIKKIGESQYIVKGR 351

Query: 246 TDLEELAKIIGTDCNCLKGE--QDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
            ++++  +      N  K E  +  +++ GL++ + D+IP  GE  +   G++ ++++ D
Sbjct: 352 LNIDDFCEYF----NFEKTENMEQYETISGLLYDLADKIPDVGEEYI-YNGYKFIVVEKD 406

Query: 304 VR 305
            R
Sbjct: 407 GR 408


>gi|193214475|ref|YP_001995674.1| transporter-associated region [Chloroherpeton thalassium ATCC
           35110]
 gi|193087952|gb|ACF13227.1| transporter-associated region [Chloroherpeton thalassium ATCC
           35110]
          Length = 411

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 119/215 (55%), Gaps = 18/215 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           + EI +NI     +++ + MI R  I+AV    T+ E + +F K   S +PVY++++D+ 
Sbjct: 187 DSEIVSNIFAISDVQVRESMIPRTDIHAVPSTITLDELVKVFGKTKYSVVPVYESTIDHI 246

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+V + +       ++ K +++         ++++  LFVP +    +LL     S + 
Sbjct: 247 IGVVSVYE-------LFKKPDSLK--------SVLREALFVPETKKTVELLQEFCYSDMN 291

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V+DE GGT GLV+ ED++  L+ D+ ++  S   +  A+S+NTF+V  R D++ + +
Sbjct: 292 MAIVVDEFGGTAGLVTSEDLIEELIGDVHNDCQSDDEICHALSENTFLVSGRVDIDTINE 351

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
            +    +    E+  ++L G I S + RIP +GE+
Sbjct: 352 KLKLGFSV---EEQYETLAGYILSHIGRIPKQGEI 383


>gi|170759792|ref|YP_001788246.1| CBS/transporter associated domain-containing protein [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169406781|gb|ACA55192.1| CBS/transporter-associated domain protein [Clostridium botulinum A3
           str. Loch Maree]
          Length = 439

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 118/223 (52%), Gaps = 18/223 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+ +E EKE+ N+I  F     D++M  R  +  ++ +  + E +  L+ E+Y R  +PV
Sbjct: 200 GVINEKEKEMINSIFEFDDKLADEVMTPRTEVYLIDIEKPLKEYLDELIEERYSR--IPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           Y+ S+DN  G+++M+D +     H +      N++I+    +++ +  FVP +  + +L 
Sbjct: 258 YEGSIDNIIGILYMKDFLREARKHGFE-----NVDIR----SILHSAYFVPETKNIDELF 308

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +  MA++IDE+GG  G+VS ED++  +M +I  E+   +  I  + D+ FI+D 
Sbjct: 309 KELQAFKKHMAILIDEYGGFSGIVSIEDLIEEVMGNIEDEYDEDEPAIKKIDDDAFIIDG 368

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              L++       +       QD D++ G +  +L RIP   E
Sbjct: 369 MVSLDDFNDYFNINIES----QDYDTINGFLIDLLGRIPMSAE 407


>gi|218437698|ref|YP_002376027.1| hypothetical protein PCC7424_0703 [Cyanothece sp. PCC 7424]
 gi|218170426|gb|ACK69159.1| protein of unknown function DUF21 [Cyanothece sp. PCC 7424]
          Length = 477

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 126/241 (52%), Gaps = 11/241 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+ NN+  F  +   ++MI R  + A+ + AT    +      G S  PV  +SLD+ 
Sbjct: 210 ERELLNNVFEFADVTAVEVMIPRTQLIAIPETATFETLLNEVTSTGHSRYPVKGDSLDDI 269

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           RG++  +D+   ++          L++  S    +K + FVP S  +++LL+ +Q S ++
Sbjct: 270 RGIIDFKDLALPLAQG-------RLSLDASIHLWVKPVRFVPESTPLNELLSLMQRSHLK 322

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE GGT GL++ +D+++ ++ + +   +     +  + + TF+V A+ +LEE+ +
Sbjct: 323 MVMVVDEFGGTSGLITLQDLIAEILGERSPSENDNVVELQMLDEQTFLVQAQMNLEEVNE 382

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           ++  +   L    +  +LGG +     +IP +GE  L     E  ++  +   + ++RI 
Sbjct: 383 VLDLE---LPVTNEYQTLGGFLLYQWQKIPMQGE-TLHYDNLEFTVVSVEGPRLGQIRIA 438

Query: 314 R 314
           R
Sbjct: 439 R 439


>gi|312196051|ref|YP_004016112.1| hypothetical protein FraEuI1c_2203 [Frankia sp. EuI1c]
 gi|311227387|gb|ADP80242.1| protein of unknown function DUF21 [Frankia sp. EuI1c]
          Length = 482

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 112/212 (52%), Gaps = 9/212 (4%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++  ++       + ++M+ R  +  +E   TV  A+ +  + G S +PV   S+D+  
Sbjct: 189 RDMIASVFELGDTLVREVMVPRPDMVFIESTKTVDAAISLALRGGFSRIPVVGESVDDVV 248

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+V ++D++                   S  ++++  + VP S    DLL  +Q SR  M
Sbjct: 249 GIVFLKDLVGREREGGGDG---------SVESVMRPPVLVPESKPADDLLREMQASRTHM 299

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+VIDE+GGT GLV+ EDI+  ++ +I  E+ S    +  + D T  V AR ++E+LA++
Sbjct: 300 AVVIDEYGGTAGLVTIEDILEEIVGEIVDEYDSAVPRVEWLDDETARVTARLEVEDLAEL 359

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG 286
            G   + L G   V+++GGL+ S L R+P  G
Sbjct: 360 FGVSEDDLPGADGVETVGGLLASALGRVPIPG 391


>gi|168179362|ref|ZP_02614026.1| CBS/transporter domain protein [Clostridium botulinum NCTC 2916]
 gi|182669579|gb|EDT81555.1| CBS/transporter domain protein [Clostridium botulinum NCTC 2916]
          Length = 380

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 117/223 (52%), Gaps = 18/223 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+ +E EKE+ N+I  F     D++M  R  +  ++ +  + E +  L+ E+Y R  +PV
Sbjct: 141 GVINEKEKEMINSIFEFDDKLADEVMTPRTEVYLIDIEKPLKEYLDELIEERYSR--IPV 198

Query: 126 YKNSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           Y+ S+DN  G+++M+D +     H +      N++I+    +++    FVP +  + DL 
Sbjct: 199 YEGSIDNIIGILYMKDFLGEARKHGFE-----NVDIR----SILHPAYFVPETKNIDDLF 249

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +  MA++IDE+GG  G+VS ED++  +M +I  E+   +  I  + ++ FI+D 
Sbjct: 250 KELQAFKKHMAILIDEYGGFSGIVSIEDLIEEVMGNIEDEYDEDEPAIKKIDNDIFIIDG 309

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              +++       D       QD D++ G +  +L RIP   E
Sbjct: 310 MVSIDDFNDYFNIDIES----QDYDTINGFLIDLLGRIPMSAE 348


>gi|109898526|ref|YP_661781.1| CBS domain-containing protein [Pseudoalteromonas atlantica T6c]
 gi|109700807|gb|ABG40727.1| CBS domain containing protein [Pseudoalteromonas atlantica T6c]
          Length = 286

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 132/253 (52%), Gaps = 17/253 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA    + ++  +E+   ++   ++R+ +IMI R  +  ++   TV + + +      S 
Sbjct: 41  DAEQREVINQETREMIEGVMEVSEMRVREIMIPRAQMTTIDITETVDKFLPIMLDSAHSR 100

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV     D+  G++  +D++ Y + +  K        +     +++  + VP S  V  
Sbjct: 101 FPVISEDKDHIEGIILAKDLLKY-AFLPGK--------EFELKQVLRPAVIVPESKRVDV 151

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS---MISAVSDNT 239
           LL   Q+ R  MA+V+DE+GG  GLV+ EDI+ +++ +I  EH ++++    I A++ +T
Sbjct: 152 LLKEFQQKRFHMAIVVDEYGGVSGLVTIEDILELIVGEIEDEHDAEETNTDNIRALNKHT 211

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           + V A T+LE+  +   TD +    E++ D++GG++      +P R E V  I GF   +
Sbjct: 212 YSVKALTELEDFNEFFKTDFD----EEEADTIGGIVLKAFGHMPMRDEKV-SINGFVFTV 266

Query: 300 LDADVRCVRRVRI 312
            ++D R + ++++
Sbjct: 267 TNSDSRRLIQLKV 279


>gi|218885657|ref|YP_002434978.1| CBS domain containing protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756611|gb|ACL07510.1| CBS domain containing protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 273

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 127/258 (49%), Gaps = 21/258 (8%)

Query: 62  IDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRS 121
           I+A  +G     E  +  NIL     ++ DIM  R  I+ VE   ++ E +      G S
Sbjct: 30  IEAREDGELDAEEGSMLLNILSLDDTQVQDIMTPRTDIDCVEVDNSLGEVIERIVASGHS 89

Query: 122 WMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVS 181
            +P+Y+++ DN  G+V+ +D++            +        + L++   FVP +  V 
Sbjct: 90  RIPIYRDNRDNIVGVVYAKDLLRCFVDPTGCATPV--------AELMREPYFVPETKNVY 141

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTF 240
           +LL   +  +  MA+V+DE+GGT GLV+ ED++ +++ DI  EH + +   I  +    +
Sbjct: 142 ELLQEFRGRKNHMAIVLDEYGGTSGLVTIEDVLELIVGDIEDEHDAPRDEDIVVLDGENY 201

Query: 241 IVDART---DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEI 297
           ++  R    DLEEL   + +D        +VD++GG +  +   +P  GE   E+ G   
Sbjct: 202 LLSGRALLEDLEELGISLDSD--------EVDTIGGYLSMLAGHVPQAGE-TFELAGRRF 252

Query: 298 VILDADVRCVRRVRIRRL 315
            + +AD + +R VR+  L
Sbjct: 253 EVAEADAKQIRTVRVGPL 270


>gi|167761491|ref|ZP_02433618.1| hypothetical protein CLOSCI_03901 [Clostridium scindens ATCC 35704]
 gi|167661157|gb|EDS05287.1| hypothetical protein CLOSCI_03901 [Clostridium scindens ATCC 35704]
          Length = 413

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 140/283 (49%), Gaps = 24/283 (8%)

Query: 42  LCKTWK-----LMKLSHHKGIRLPRI-----DASLEGIFSETEKEIFNNILRFRKIRIDD 91
           L   WK     L K S   GI    +     +A  +G   E E ++ ++ L F +  + D
Sbjct: 144 LFGQWKKLLSLLFKSSDDTGITEEELLFIVDEAEQDGGIDEQESKLIHSALEFTEQEVID 203

Query: 92  IMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYA 151
           ++  R+ I AV  +AT  E   +F +   S +P+Y  S+D+  G+++ +D  +Y+ H   
Sbjct: 204 VLTPRIDITAVSTQATKEEIAEIFAETAYSRIPLYDESVDHIIGIIYQKDFHNYVYHTDK 263

Query: 152 KTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYE 211
                        S +++  L+V  +  +  LL  +Q+ ++  A+V+DE GGT G+V+ E
Sbjct: 264 DI-----------SEIVRPTLYVHKNKKIGVLLKELQQRKMHFAVVLDEFGGTIGIVTLE 312

Query: 212 DIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSL 271
           DI+  L+ +I  EH    S I   S++  I     ++E+L +++  +    + E+    +
Sbjct: 313 DILEELVGEIWDEHDEVNSEIEIKSEDEVIALGSANVEKLFEVLNIEIT--EDEEIPVIV 370

Query: 272 GGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRR 314
            G +   L+RIP +G+   E  G++I +L  + + V +V I++
Sbjct: 371 NGWVMKELERIPVKGD-TFEYKGYKITVLSVNEKRVEKVLIKK 412


>gi|118443688|ref|YP_877590.1| integral membrane protein [Clostridium novyi NT]
 gi|118134144|gb|ABK61188.1| Integral membrane protein with CBS domains [Clostridium novyi NT]
          Length = 422

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 120/224 (53%), Gaps = 15/224 (6%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    E+++  N+  F   ++ D+M+ R  + +V+  +T  E + + +K   S +PVY
Sbjct: 185 EGVLEVEERKMIYNVFEFGDSQVKDVMVPRTEMASVDIDSTYDEILEVLKKEQFSRIPVY 244

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           K+S DN  G++H++ ++ +           N   +   +  +    F       ++L   
Sbjct: 245 KDSTDNIIGILHIKKLVFF----------DNSKEKFDITKYMVKPYFTYEYKPTTELFEE 294

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKS-MISAVSDNTFIVDAR 245
           +++ R+ M +V+DE+GGT G+V+ ED+V  ++ DI  E+ ++++  I  + D+ +IV   
Sbjct: 295 MRKDRVAMTVVLDEYGGTAGIVTMEDMVEEIVGDIEDEYDNEQNDEIKLIKDDEYIVKGS 354

Query: 246 TDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           T ++E+ +++G D       +D DS+GG +   + R P +GE V
Sbjct: 355 TKIDEVNEMLGIDIES----EDFDSIGGFVIGEVGRFPKKGEFV 394


>gi|291549784|emb|CBL26046.1| Hemolysins and related proteins containing CBS domains
           [Ruminococcus torques L2-14]
          Length = 411

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 134/253 (52%), Gaps = 17/253 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EKE+  N+      +  DIM+ RV +   +  +T  E + +F +   
Sbjct: 147 VDVSHEDGVIESDEKEMIYNVFDLGDAKAKDIMVPRVHVTFADVNSTFDELIDIFREDKF 206

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +PVY+ + DN  G+++M+D++ Y        ++   NI+    + ++   F      +
Sbjct: 207 TRLPVYEETQDNVVGIINMKDLLLY-------DHDTPFNIR----DFLRKPHFTYEFKDI 255

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S+LL  +++S   +A+V+DE+G   GL++ EDI+  ++ +I  E+  ++  +I  +SD+ 
Sbjct: 256 SELLVEMRDSTFNIAIVLDEYGEMAGLITLEDILEEIVGEIHDEYDENEDELIKEISDHE 315

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           +I++    L+++   + T+ N     +D DSLGGLI   LDR+P  G+ V+   G  +V+
Sbjct: 316 YIIEGSMSLDDVNDHLHTELNS----EDYDSLGGLIIEHLDRLPQMGDEVVTEDGIRLVV 371

Query: 300 LDADVRCVRRVRI 312
              D   V  V +
Sbjct: 372 EKLDKNRVEMVHV 384


>gi|256787844|ref|ZP_05526275.1| hypothetical protein SlivT_25441 [Streptomyces lividans TK24]
 gi|289771729|ref|ZP_06531107.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|289701928|gb|EFD69357.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 434

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 137/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +    E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEAEERRMVHSVFELGDTLVREVMVPRTDLVVIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV  +S D+  G+V+++D++        +  +I+ +   +ES+L+   +    FVP +  
Sbjct: 235 PVTGDSEDDIVGIVYLKDLV--------RRTHISRD---AESDLVSTAMRPASFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  +  + 
Sbjct: 284 AGDLLREMQKERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEELGGDR 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           F V AR D+ +L ++ G D      ++DV+++GGL+   L R+P  G   ++E+P    +
Sbjct: 344 FRVTARLDIGDLGELYGLDEY---DDEDVETVGGLLAKALGRVPIAGASSIVELPDGREL 400

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 401 RLTAEAAAGRRNKI 414


>gi|300866192|ref|ZP_07110908.1| conserved membrane hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300335806|emb|CBN56068.1| conserved membrane hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 447

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 125/242 (51%), Gaps = 11/242 (4%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+E+ NN+  F  + ++++M +R SI A+   AT    +      G S  P +  SLD  
Sbjct: 215 ERELLNNVFEFGAVSVEEVMTTRTSIAAIPRTATFQMLLDEIAISGHSRYPAFGESLDEI 274

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+V  + +   ++          L+ Q      I+ I FVP  ML+S+LL  +Q S   
Sbjct: 275 VGLVDFKQLAKPLAQGL-------LSPQTLIDPWIRPIRFVPEVMLLSELLPLMQRSPEE 327

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           MA+V++E+GGT GLV+ +D+++ ++ +       ++  +  + D TF+V A+ +LE + +
Sbjct: 328 MAIVVNEYGGTSGLVTLKDLIAEIIGESRESADMEEVDLQMLDDRTFLVQAQLELESVNE 387

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           I+  +   L    + ++LGG +   L  IPA GE+ +     E  ++ A    + ++RIR
Sbjct: 388 ILNFN---LPLADEYETLGGFLIHELQIIPALGEIFV-YGNLEFTVISASGARLDQIRIR 443

Query: 314 RL 315
            L
Sbjct: 444 IL 445


>gi|226950359|ref|YP_002805450.1| CBS/transporter-associated domain protein [Clostridium botulinum A2
           str. Kyoto]
 gi|226840779|gb|ACO83445.1| CBS/transporter-associated domain protein [Clostridium botulinum A2
           str. Kyoto]
          Length = 439

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 117/223 (52%), Gaps = 18/223 (8%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAM--LMFEKYGRSWMPV 125
           G+ +E EKE+ N+I  F     D++M  R  +  ++ +  + E +  L+ E+Y R  +PV
Sbjct: 200 GVINEKEKEMINSIFEFDDKLADEVMTPRTEVYLIDIEKPLKEYLDELIEERYSR--IPV 257

Query: 126 YKNSLDNPRGMVHMRDVISYI-SHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           Y+ S+DN  G+++M+D +     H +      N++I+    +++    FVP +  + DL 
Sbjct: 258 YEGSIDNIIGILYMKDFLGEARKHGFE-----NVDIR----SILHPAYFVPETKNIDDLF 308

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q  +  MA++IDE+GG  G+VS ED++  +M +I  E+   +  I  + ++ FI+D 
Sbjct: 309 KELQAFKKHMAILIDEYGGFSGIVSIEDLIEEVMGNIEDEYDEDEPAIKKIDNDIFIIDG 368

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              +++       D       QD D++ G +  +L RIP   E
Sbjct: 369 MVSIDDFNDYFNIDIES----QDYDTINGFLIDLLGRIPMSAE 407


>gi|195952467|ref|YP_002120757.1| CBS domain containing protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932079|gb|ACG56779.1| CBS domain containing protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 417

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 125/244 (51%), Gaps = 16/244 (6%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
           FSE E ++   + + R+  + +IM  R+ I  +E   TV E +    ++  S +P+YK++
Sbjct: 181 FSEEETQMIQKVSQMRETIVREIMTPRLDIFMLEATQTVKEVINDILEHEHSRIPIYKDT 240

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
            DN  G +H++D+     H   K + + +         ++ I F+P  M + +LL  +++
Sbjct: 241 KDNVVGYIHIKDLTPVYQH---KDDTLEI--------FLRPIEFIPEVMSIKNLLQEMKK 289

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           S  ++ +V+DEHG   GL++  D++  L  D+  E   +    + +S + +IV+    +E
Sbjct: 290 SSSQIMMVVDEHGAISGLITKHDLLEWLAGDLPQEWEDENEF-TKMSSDVYIVEGSASIE 348

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRR 309
           E+A  +G +   L    D D+L G I + + +IP  G+   E  GF+ ++   D + +  
Sbjct: 349 EVAATVGFE---LSENYDYDTLSGFIMANMGKIPKEGD-EFEYKGFKFIVDKMDGKKIEH 404

Query: 310 VRIR 313
           V I+
Sbjct: 405 VLIK 408


>gi|331086350|ref|ZP_08335430.1| hypothetical protein HMPREF0987_01733 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406116|gb|EGG85639.1| hypothetical protein HMPREF0987_01733 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 432

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 129/240 (53%), Gaps = 15/240 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EKE+  N+      +  DIM+ RV +   +  +T  E + +F +   
Sbjct: 176 VDVSHEDGVIESEEKEMIYNVFDMGDAKAKDIMVPRVHVTFADINSTYDELIEIFREDKF 235

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +P+Y+ + DN  G ++M+D++ Y         N N   +    ++++   F      +
Sbjct: 236 TRLPIYEETTDNVVGTINMKDLLLY---------NYNDKKEFHVRDILREAYFTYEYKSI 286

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S+LL  ++++ I +A+V+DE+G T GL++ ED++  ++ +I  E+  +++  +  ++D  
Sbjct: 287 SELLVEMRQASINIAIVLDEYGETAGLITLEDLLEEIVGEIHDEYDENEEEFVRQINDRE 346

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           +I++   +L++L   +G + +     +D DSLGG I   LDR+P +G+ +    G  +V+
Sbjct: 347 YIIEGSMNLDDLNDSLGLNLSS----EDYDSLGGFIIEHLDRLPEQGDELTTDDGIRLVV 402


>gi|239941041|ref|ZP_04692978.1| putative transport protein [Streptomyces roseosporus NRRL 15998]
 gi|239987520|ref|ZP_04708184.1| putative transport protein [Streptomyces roseosporus NRRL 11379]
 gi|291444481|ref|ZP_06583871.1| transport protein [Streptomyces roseosporus NRRL 15998]
 gi|291347428|gb|EFE74332.1| transport protein [Streptomyces roseosporus NRRL 15998]
          Length = 432

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 132/251 (52%), Gaps = 13/251 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  + ++E   TV +A+ +  + G S +
Sbjct: 175 AEAESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVSIERYKTVRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE-SNLIKNILFVPSSMLVSD 182
           PV   + D+  G+V+++D++        +  +IN   +    S  ++   FVP +    D
Sbjct: 235 PVTGENEDDVVGIVYLKDLV--------RKTHINRESEADPVSTAMRPAAFVPDTKNAGD 286

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
           LL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  + V
Sbjct: 287 LLREMQQDRSHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVQELENGCYRV 346

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIVILD 301
            AR D+ +L  + G D      ++DV+++GGL+   L R+P  G    +E+P    + L 
Sbjct: 347 TARLDIGDLGDLFGLD---EYDDEDVETVGGLLAKALGRVPIAGASATVELPDGRELRLT 403

Query: 302 ADVRCVRRVRI 312
           A+    RR +I
Sbjct: 404 AESPAGRRNKI 414


>gi|163753205|ref|ZP_02160329.1| putative transmembrane CBS domain transporter [Kordia algicida
           OT-1]
 gi|161326937|gb|EDP98262.1| putative transmembrane CBS domain transporter [Kordia algicida
           OT-1]
          Length = 424

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 119/219 (54%), Gaps = 18/219 (8%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E +IF N L F  ++  ++MI R  I A+E + +      +F + G S + VYKN++D
Sbjct: 197 DSEIQIFQNALEFSAVKTREVMIPRTEIVAIELRESTQNLAKLFSETGYSKVLVYKNTID 256

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  +       ++ K   I         +++  ++FVP +ML +D+L  + +  
Sbjct: 257 DIIGYVHSFE-------LFKKPKTIR--------SIVLPVVFVPEAMLANDVLNVLTKKS 301

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             +A+V+DE+GGT G+V+ EDIV  L  +I  EH   + +   +S+  ++  AR +++ +
Sbjct: 302 KSIAVVLDEYGGTSGIVTVEDIVEELFGEIEDEHDVTELLEKRISEYEYLFSARLEVDYI 361

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVL 290
            +   T    L   ++ ++LGGLI S  + IP + EV++
Sbjct: 362 NE---TYKLNLPESENYETLGGLIVSETEEIPQKDEVII 397


>gi|189425667|ref|YP_001952844.1| hypothetical protein Glov_2611 [Geobacter lovleyi SZ]
 gi|189421926|gb|ACD96324.1| protein of unknown function DUF21 [Geobacter lovleyi SZ]
          Length = 445

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 129/246 (52%), Gaps = 15/246 (6%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+FSE+E E   N+  F    + ++M+ R  + A+E + +  E + +  +   S  PVY 
Sbjct: 197 GVFSESENEYIRNVFEFTHTCVREVMVPRTRMVALELQMSRDELVRIILEAQYSRYPVYH 256

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
             ++   G++H +D+++ +     K   +NL        +I+  +FVP    V++LL  +
Sbjct: 257 TDIEEIVGVLHDKDIMAAL----VKGEELNLE------QIIRPPVFVPEGKKVNELLKEM 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIVDART 246
           Q +R  MALV+DE+GG  GLV+ ED++  L+ +I  EH + +   +    D +++VD  T
Sbjct: 307 QRTRNHMALVVDEYGGISGLVTTEDLLEELVGEIEDEHDAGEPGKLVQQPDGSWLVDGLT 366

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRC 306
            + +L + +G     L+     +++ GL+ + L  +P +GE V +  GF +V        
Sbjct: 367 SIFDLQEPLGIK---LEEAPLYETVAGLVLNELGHLPLQGETV-DWNGFRLVCEQVTRTA 422

Query: 307 VRRVRI 312
           + +VRI
Sbjct: 423 ILQVRI 428


>gi|315657185|ref|ZP_07910069.1| magnesium and cobalt efflux protein CorC [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
 gi|315492288|gb|EFU81895.1| magnesium and cobalt efflux protein CorC [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
          Length = 426

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 129/234 (55%), Gaps = 12/234 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           + ++E+  ++    +  + ++M+ RV +  +E + T+ +A+ +F +   S +PV     D
Sbjct: 186 DADREMIWSVFEMGRTLVREVMVPRVDMVTIESEKTLDKALTLFVRSSYSRVPVIGEDAD 245

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + RG+++++DV+        + N+ +   Q++    ++   F+P   LV D L ++Q++ 
Sbjct: 246 DIRGILYLKDVLR-------RVNSDSAARQMTAEQAMREAKFIPEMNLVDDTLRDMQQNS 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+++DE+G   GLV+ ED+V  ++ +++ EH   +       D ++IV AR  L +L
Sbjct: 299 YHMAVLVDEYGLIAGLVTLEDLVEEVIGEVSDEHDHAEKEPELQPDGSWIVPARLPLVDL 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             ++GT+ +    ++DVD++GGL+   +  +P  G     + G E+  ++A+ R
Sbjct: 359 NDLLGTEID----DEDVDTVGGLLTKAVGVVPLVGASA-TVEGLELCAVEAEGR 407


>gi|304389933|ref|ZP_07371890.1| magnesium and cobalt efflux protein CorC [Mobiluncus curtisii
           subsp. curtisii ATCC 35241]
 gi|304326826|gb|EFL94067.1| magnesium and cobalt efflux protein CorC [Mobiluncus curtisii
           subsp. curtisii ATCC 35241]
          Length = 426

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 129/234 (55%), Gaps = 12/234 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           + ++E+  ++    +  + ++M+ RV +  +E + T+ +A+ +F +   S +PV     D
Sbjct: 186 DADREMIWSVFEMGRTLVREVMVPRVDMVTIESEKTLDKALTLFVRSSYSRVPVIGEDAD 245

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + RG+++++DV+        + N+ +   Q++    ++   F+P   LV D L ++Q++ 
Sbjct: 246 DIRGILYLKDVLR-------RVNSDSAARQMTAEQAMREAKFIPEMNLVDDTLRDMQQNS 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+++DE+G   GLV+ ED+V  ++ +++ EH   +       D ++IV AR  L +L
Sbjct: 299 YHMAVLVDEYGLIAGLVTLEDLVEEVIGEVSDEHDHAEKEPELQPDGSWIVPARLPLVDL 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             ++GT+ +    ++DVD++GGL+   +  +P  G     + G E+  ++A+ R
Sbjct: 359 NDLLGTEID----DEDVDTVGGLLTKAVGVVPLVGASA-TVEGLELCAVEAEGR 407


>gi|325662598|ref|ZP_08151198.1| hypothetical protein HMPREF0490_01938 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471095|gb|EGC74321.1| hypothetical protein HMPREF0490_01938 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 432

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 129/240 (53%), Gaps = 15/240 (6%)

Query: 62  IDASLE-GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
           +D S E G+    EKE+  N+      +  DIM+ RV +   +  +T  E + +F +   
Sbjct: 176 VDVSHEDGVIESEEKEMIYNVFDMGDAKAKDIMVPRVHVTFADINSTYDELIEIFREDKF 235

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           + +P+Y+ + DN  G ++M+D++ Y         N N   +    ++++   F      +
Sbjct: 236 TRLPIYEETTDNVVGTINMKDLLLY---------NYNDKKEFHVRDILREAYFTYEYKSI 286

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNT 239
           S+LL  ++++ I +A+V+DE+G T GL++ ED++  ++ +I  E+  +++  +  ++D  
Sbjct: 287 SELLVEMRQASINIAIVLDEYGETAGLITLEDLLEEIVGEIHDEYDENEEEFVRQINDRE 346

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           +I++   +L++L   +G + +     +D DSLGG I   LDR+P +G+ +    G  +V+
Sbjct: 347 YIIEGSMNLDDLNDSLGLNLSS----EDYDSLGGFIIEHLDRLPEQGDELTTDDGIRLVV 402


>gi|220934021|ref|YP_002512920.1| protein of unknown function DUF21 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995331|gb|ACL71933.1| protein of unknown function DUF21 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 430

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 131/259 (50%), Gaps = 24/259 (9%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAV--EDKATVYEAMLMFEKYGRSWMPV 125
           G+     +++  NIL   K  ++DIM+ R  I  +  ED     E  L    Y R  MPV
Sbjct: 183 GLIPSKHQKMLVNILDLEKATVEDIMVPRHEIQGIDLEDDWDDIEQQLFTGSYTR--MPV 240

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNL---IKNILFVPSSMLVSD 182
           Y+ ++D   G +H+R+V+  I           +  +LS+ +L   +++  F+P    ++ 
Sbjct: 241 YQGNIDQVLGFIHVRNVLPLI-----------MREELSKESLRAHLRDAYFIPEGTPLNR 289

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIV 242
            L N Q  R R+ LV+DE+G   GLV+ ED++  ++ + T++  +    +    D +++V
Sbjct: 290 QLLNFQRERRRIGLVVDEYGDIQGLVTLEDLLEEIVGEFTTDPAALSPDVMPQEDGSWVV 349

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
           D    L EL ++IG   + L+G +   +L GLI   L+ IP     VL I G+ I I+  
Sbjct: 350 DGGVHLRELNRMIGAHFS-LEGPR---TLNGLIIEHLETIPEASTSVL-IDGYPIEIVQV 404

Query: 303 DVRCVRRVRI-RRLVHFKN 320
               V+ VRI RRL  +++
Sbjct: 405 KNNAVKTVRIGRRLAAYRS 423


>gi|256820105|ref|YP_003141384.1| hypothetical protein Coch_1275 [Capnocytophaga ochracea DSM 7271]
 gi|256581688|gb|ACU92823.1| protein of unknown function DUF21 [Capnocytophaga ochracea DSM
           7271]
          Length = 435

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 121/241 (50%), Gaps = 19/241 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           ++E ++F N L F  ++  +IMI R  I AVE   ++   +  F   G S + +Y  ++D
Sbjct: 209 DSEVQMFQNALEFSGVKAREIMIPRTEIVAVELNESIENLIATFVSSGFSKILIYNENID 268

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G VH  D       M+ K   I          ++  I+ +P ++ ++++L  +   R
Sbjct: 269 DILGYVHSFD-------MFKKPKAIK--------EVLIPIVNIPETIQINEVLNILTRKR 313

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+V+DE+GGT G+V+ EDIV  L  +I  EH   K +   +SD  ++  AR ++E L
Sbjct: 314 KSMAVVLDEYGGTSGIVTLEDIVEELFGEIEDEHDKDKFIEEQISDTEYLFSARLEVEYL 373

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            +    D   +   ++ ++LGG I    + IP +GEV+ EIP F   I       +  VR
Sbjct: 374 NETYHLD---IPESEEYETLGGFIVLHNEGIPTQGEVI-EIPPFTFTIEACSQTKIETVR 429

Query: 312 I 312
           +
Sbjct: 430 L 430


>gi|170287889|ref|YP_001738127.1| hypothetical protein TRQ2_0082 [Thermotoga sp. RQ2]
 gi|170175392|gb|ACB08444.1| protein of unknown function DUF21 [Thermotoga sp. RQ2]
          Length = 455

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 119/221 (53%), Gaps = 10/221 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  E E+ I       ++I + +IM  RV I A+E+  TV + + + E  G S +PVYK
Sbjct: 192 GVIEEEEERIIKRAFEMKQIAVKEIMTPRVDIVAIEENQTVKDLIELVEDEGYSRIPVYK 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+ + +DV+S ++    +         +   ++++  L+VP +M + +LL  +
Sbjct: 252 ETIDNIVGICYAKDVLSILAAKDCEEVK-----GMKVKDIMREALYVPETMNIDELLKIL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  +I +A+V+DE+GGT G+V+ EDI+  L  +I  E+ + + S I  + + TF+VD  T
Sbjct: 307 KAKKIHIAIVVDEYGGTAGIVTLEDIIEELFGNIMDEYDYDEISGIRKIDERTFVVDGTT 366

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            + +    I  +      E + +++ G +     RIP  GE
Sbjct: 367 PIND----IEIELRVQFPETEYETIAGYLLEHFKRIPNVGE 403


>gi|294629267|ref|ZP_06707827.1| CBS domain-containing protein [Streptomyces sp. e14]
 gi|292832600|gb|EFF90949.1| CBS domain-containing protein [Streptomyces sp. e14]
          Length = 437

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 134/250 (53%), Gaps = 11/250 (4%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEQESLIEDEERRMVHSVFELGDTLVREVMVPRTDLVVIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV   S D+  G+V+++D ++  +H+     N  +      S  ++  +FVP +    DL
Sbjct: 235 PVTGESEDDIVGIVYLKD-LARRTHISRDAENDLV------STAMRPAVFVPDTKNAGDL 287

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  + V 
Sbjct: 288 LREMQKERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVEDLGEGRYRVT 347

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIVILDA 302
           AR D+ +L ++ G +      ++DV+++GGL+   L R+P  G   V+E+P    + L A
Sbjct: 348 ARLDITDLGELYGLEEY---DDEDVETVGGLLAKALGRVPIAGASAVVELPDERALRLTA 404

Query: 303 DVRCVRRVRI 312
           +    RR +I
Sbjct: 405 EAAAGRRNKI 414


>gi|319902739|ref|YP_004162467.1| gliding motility-associated protein GldE [Bacteroides helcogenes P
           36-108]
 gi|319417770|gb|ADV44881.1| gliding motility-associated protein GldE [Bacteroides helcogenes P
           36-108]
          Length = 445

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ + +  E +    +   S +PVY ++ DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTSYKEVLKCIVENAYSRIPVYADTRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYATLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   +     +   D D+L GL+  +    P   E V     +E  +L+ D R + +V+ 
Sbjct: 378 ITKINEETFDEVAGDADTLAGLLLELKGEFPVLHEKV-SYDCYEFEVLEMDNRRILKVKF 436


>gi|303237678|ref|ZP_07324238.1| CBS domain protein [Prevotella disiens FB035-09AN]
 gi|302482130|gb|EFL45165.1| CBS domain protein [Prevotella disiens FB035-09AN]
          Length = 419

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 117/242 (48%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F   ++ D MI R  INAV+   T  +   MF + G S + VYK  +D
Sbjct: 194 EEEVKIFQNALDFTDTKVKDCMIPRTEINAVDIDCTATDLQQMFIESGNSKIIVYKEDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G +H        S M+        N Q    + ++ + FVP +M    L+    + +
Sbjct: 254 HIVGYIHS-------SEMFK-------NFQEWREH-VREMPFVPETMPAQKLMQTFLQQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT G++S EDIV  +  +I  EH +   +   ++DN +I+ AR ++E++
Sbjct: 299 KSLGVVVDEFGGTSGIISLEDIVEEIFGEIEDEHDNSNYIAKQITDNEYILSARLEIEKV 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
             + G D   L    D  ++ G I       P   E+V +I  FE  I+   +  +  V+
Sbjct: 359 NDMFGLD---LPENDDYMTISGFILYEYQSFPKLNELV-KIGKFEFKIIKNTMTKIELVK 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|298369903|ref|ZP_06981219.1| magnesium and cobalt efflux protein CorC [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298281363|gb|EFI22852.1| magnesium and cobalt efflux protein CorC [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 277

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 129/242 (53%), Gaps = 25/242 (10%)

Query: 74  EKEIFN--------NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPV 125
           E+E+F+         +L F ++ + D MI+R  +N +++   +   +    +   S  PV
Sbjct: 37  EQEVFDADTLFRLEKVLDFAELEVRDAMITRSQMNVIKENDGIDRIVAYIIETSHSRFPV 96

Query: 126 YKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLT 185
                D   G++H +D++ +++      N    N+Q    N+++  +FVP    ++ LL 
Sbjct: 97  ISGDKDEVLGILHAKDLLKFMA------NPEQFNLQ----NILRPAVFVPEGKSLNSLLK 146

Query: 186 NIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSM--ISAVSDNTFIVD 243
            ++E R  MA+VIDE+GG  GLV++EDI+  ++ DI  E    +S   I AVS   + ++
Sbjct: 147 ELREQRNHMAIVIDEYGGVSGLVTFEDIIEQIVGDIEDEFDEDESADNIHAVSAERWRIN 206

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDAD 303
           A T++E++    GTD +    +++ D++GGL+   L R+P RGE V+  P  +  +  AD
Sbjct: 207 AVTEIEDVNAFFGTDYS----DEEADTIGGLVIQELGRLPVRGEKVVVGP-LQFTVARAD 261

Query: 304 VR 305
            R
Sbjct: 262 KR 263


>gi|333030025|ref|ZP_08458086.1| gliding motility-associated protein GldE [Bacteroides coprosuis DSM
           18011]
 gi|332740622|gb|EGJ71104.1| gliding motility-associated protein GldE [Bacteroides coprosuis DSM
           18011]
          Length = 452

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 129/250 (51%), Gaps = 32/250 (12%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  +E K    E +    +   S +P+Y ++ DN 
Sbjct: 209 ENTILEGIIRFGGETAKEVMTSRLDMVDLEIKTPYQEVLKCIIENVYSRIPIYNDNRDNI 268

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            G+++++D++ +++    K +N          ++I+   FVP + ++ DLL + Q +++ 
Sbjct: 269 CGVLYIKDLLPHLN----KGDNFRWQ------SIIRPAYFVPETKMIDDLLRDFQANKVH 318

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL----- 248
           +A+V+DE GGT GL++ EDI+  ++ +I  E+   +S    +SDN+++ +A+T L     
Sbjct: 319 IAIVVDEFGGTSGLITMEDIIEEIVGEIQDEYDEDESTFRKISDNSWVFEAKTQLSDFYK 378

Query: 249 ------EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
                 EE  KI+G            D++GGL+  +    PA  E V+    +E  +L  
Sbjct: 379 ETHIDEEEFDKIVG----------GADTIGGLLLEIKGEFPALHEKVV-YKNYEFEVLAK 427

Query: 303 DVRCVRRVRI 312
           D R + +V++
Sbjct: 428 DNRRILKVKL 437


>gi|15643608|ref|NP_228654.1| hemolysin-related protein [Thermotoga maritima MSB8]
 gi|4981378|gb|AAD35927.1|AE001751_7 hemolysin-related protein [Thermotoga maritima MSB8]
          Length = 455

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 121/221 (54%), Gaps = 10/221 (4%)

Query: 68  GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYK 127
           G+  E E+ I       ++I + +IM  RV I A+E+  TV + + + E  G S +PVYK
Sbjct: 192 GVIEEEEERIIKRAFEMKQIAVKEIMTPRVDIVAIEENQTVKDLIELVEDEGYSRIPVYK 251

Query: 128 NSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
            ++DN  G+ + +DV+S    M A+ +   +   +   ++++  L+VP +M + +LL  +
Sbjct: 252 ETIDNIVGICYAKDVLS----MLAEKDCEEVK-SMKVKDIMREALYVPETMNIDELLKIL 306

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDART 246
           +  +I +A+V+DE+GGT G+V+ EDI+  L  +I  E+ + + S I  + + T+IVD  T
Sbjct: 307 KARKIHIAIVVDEYGGTAGIVTLEDIIEELFGNIMDEYDYDEISGIRKIDERTYIVDGAT 366

Query: 247 DLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
            + +    I  +      E + +++ G +     RIP  GE
Sbjct: 367 PIND----IEMELRVQFPETEYETIAGYLLEHFKRIPNVGE 403


>gi|116626741|ref|YP_828897.1| CBS domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229903|gb|ABJ88612.1| CBS domain containing protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 420

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 134/252 (53%), Gaps = 21/252 (8%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYE--AMLMFEKYGRSWMP 124
           EG+  E ++++  +++ F    + ++M  R +I A+   AT+ +   +++ E+Y R  +P
Sbjct: 180 EGLIEEEDRKLIQSVVEFGDKVVREVMTPRPNIVAIAADATLEQLRQLVITEQYSR--IP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY+ ++DN  G VH+RD+         K          +   L++NI+ VP +  VS L+
Sbjct: 238 VYEGTIDNVIGFVHVRDMFELQEEEREKR---------TVRGLVRNIMLVPETKPVSVLM 288

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+    M +V+DE+G T GL + ED++ V++ +I  EH    S ++      FIV  
Sbjct: 289 RRMQQENTHMVIVVDEYGNTAGLATMEDLLEVIIGEIRDEHEP-DSDVAEDGRGGFIVSG 347

Query: 245 RTDLEELAKIIGTDCNCLKGEQDVDS--LGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
             DL+ +  +I T     +G+ D++S  +GGL+   L R+P  GE V E  G  + +L +
Sbjct: 348 SFDLDRITDLIDT---FHRGD-DIESTTVGGLVSEWLGRVPKTGEFV-ERDGVRLEVLAS 402

Query: 303 DVRCVRRVRIRR 314
           D   V +VRI +
Sbjct: 403 DELRVGQVRISK 414


>gi|159901100|ref|YP_001547347.1| hypothetical protein Haur_4588 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894139|gb|ABX07219.1| protein of unknown function DUF21 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 427

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 114/215 (53%), Gaps = 13/215 (6%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           +++   I  F    + ++M+ R+ I  +   A++ EA+ +F   G S +P+Y  S+D+  
Sbjct: 185 RDMIEGIFEFSDTAVREVMVPRIDIVGLAATASMEEALNLFISAGHSRLPIYDESIDHVL 244

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+++ +D+   +                   +L++   FVP S+ V DL+  +Q  ++ M
Sbjct: 245 GVLYAKDLFPLLRDGLRDA---------PLRSLVRQSYFVPDSIKVDDLMRALQSRKVHM 295

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKI 254
           A+++DE+G T GLV+ ED++  ++ +I  E  S+++ I  V  + ++ D R  ++ +   
Sbjct: 296 AIIVDEYGSTAGLVTIEDLLEEIVGEIQDEFDSEEAPIQQVGPHEWLFDGRVSIDAVND- 354

Query: 255 IGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
             T+   +    DVDSLGG + S+L  +P  G+V+
Sbjct: 355 -ATELTLIN--DDVDSLGGFVLSMLGSMPKVGDVI 386


>gi|302534334|ref|ZP_07286676.1| CBS domain-containing protein [Streptomyces sp. C]
 gi|302443229|gb|EFL15045.1| CBS domain-containing protein [Streptomyces sp. C]
          Length = 435

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 136/254 (53%), Gaps = 19/254 (7%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + + +       + ++M+ R  +  +E   T+ +A  +  + G S +
Sbjct: 177 AEKESLIEDDERRMVHQVFELGDTLVREVMVPRTDLVCIERYKTIRQATTLALRSGFSRI 236

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  GMV+++D++        +  +IN   + +ES+L+  ++    FVP +  
Sbjct: 237 PVTGENEDDIVGMVYLKDLV--------RRTHIN---REAESDLVSTVMRPAVFVPDTKN 285

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q  R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + ++ 
Sbjct: 286 AGDLLREMQSVRNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDREIPPVEELGEDR 345

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
           + V AR D+ +L ++ G +      ++DV+++GGL+   L R+P  G   V+++P    +
Sbjct: 346 YRVTARLDITDLGELFGVEAF---DDEDVETVGGLLAKALGRVPIAGASAVVDLPDGRPL 402

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 403 RLTAESPGGRRNKI 416


>gi|291566993|dbj|BAI89265.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 572

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+++ NN+  F  +  ++IMI R SI ++   AT    +        S  P+   SLD+ 
Sbjct: 230 ERQLLNNVFEFGDVLAEEIMIPRTSIVSLPSTATFQHLLEEMAVCNHSRYPITGESLDDI 289

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESN----LIKNILFVPSSMLVSDLLTNIQE 189
            G++  RD+   ++             QLSE       I+   F+   ML+S+LL  +Q 
Sbjct: 290 LGILDFRDLAKPLAER-----------QLSEETPILTWIRAARFISEQMLLSELLPLMQR 338

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           S+  MA+V+DE GGT GLV+  D++S ++ D +     +   I  V D TF+V A+  +E
Sbjct: 339 SQQEMAIVVDEFGGTAGLVTINDLISEIIGDGSELAEHEDVNIQFVDDQTFLVQAQLSVE 398

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
           E+ +++  D   L   ++  +LGG +   L +IPA GEV
Sbjct: 399 EINELLNLD---LPLNEEYQTLGGFLTYYLQKIPAVGEV 434


>gi|284052758|ref|ZP_06382968.1| hypothetical protein AplaP_14913 [Arthrospira platensis str.
           Paraca]
          Length = 479

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+++ NN+  F  +  ++IMI R SI ++   AT    +        S  P+   SLD+ 
Sbjct: 233 ERQLLNNVFEFGDVLAEEIMIPRTSIVSLPSTATFQHLLEEMAVCNHSRYPITGESLDDI 292

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESN----LIKNILFVPSSMLVSDLLTNIQE 189
            G++  RD+   ++             QLSE       I+   F+   ML+S+LL  +Q 
Sbjct: 293 LGILDFRDLAKPLAER-----------QLSEETPILTWIRAARFISEQMLLSELLPLMQR 341

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           S+  MA+V+DE GGT GLV+  D++S ++ D +     +   I  V D TF+V A+  +E
Sbjct: 342 SQQEMAIVVDEFGGTAGLVTINDLISEIIGDGSELAEHEDVNIQFVDDQTFLVQAQLSVE 401

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEV 288
           E+ +++  D   L   ++  +LGG +   L +IPA GEV
Sbjct: 402 EINELLNLD---LPLNEEYQTLGGFLTYYLQKIPAVGEV 437


>gi|162447765|ref|YP_001620897.1| putative hemolysin-like protein [Acholeplasma laidlawii PG-8A]
 gi|161985872|gb|ABX81521.1| putative hemolysin-related protein [Acholeplasma laidlawii PG-8A]
          Length = 422

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 138/270 (51%), Gaps = 21/270 (7%)

Query: 35  WTRTIRALCKTWKLMKLSHHKGIRLPRIDASLE-GIFSETEKEIFNNILRFRKIRIDDIM 93
           W + +  + K      LS  + I +  +D   E G   E+   +  + + F  +   DI 
Sbjct: 147 WKKVLSYIVKPNSKAHLSEDELIMI--VDEVQESGAIDESSGTLIRSAIEFADLEAVDIY 204

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT 153
             R+ + AV   A   +   +F++ G S +PVY+ ++D+  G+++ +D    ++  +   
Sbjct: 205 TPRIDVVAVSTAARHEDIFKVFKESGYSRIPVYEENIDHIIGVMNYKDFFMVLTEGF--- 261

Query: 154 NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI 213
                +I+     +IK++LF+P +  V DLL  +Q+S+  MA+VID++GGT G+++ EDI
Sbjct: 262 -----DIK----EIIKDVLFIPKTKKVKDLLLELQQSKSHMAVVIDDYGGTAGILTLEDI 312

Query: 214 VSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGG 273
           +  L+ DI  EH      +  ++DN ++V   + +E+  +IIG+     K E +V ++ G
Sbjct: 313 LEELVGDIWDEHDDIIEAVKKMNDNQYLVLGNSSIEDFLEIIGS-----KEEPNVLTVNG 367

Query: 274 LIFSVLDRIPARGEVVLEIP-GFEIVILDA 302
            +   L  +P  G+     P  FEIV +D 
Sbjct: 368 WVVEKLGTLPVEGKTYEVKPYTFEIVKMDG 397


>gi|153956115|ref|YP_001396880.1| hypothetical protein CKL_3518 [Clostridium kluyveri DSM 555]
 gi|219856448|ref|YP_002473570.1| hypothetical protein CKR_3105 [Clostridium kluyveri NBRC 12016]
 gi|146348973|gb|EDK35509.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219570172|dbj|BAH08156.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 428

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 148/296 (50%), Gaps = 24/296 (8%)

Query: 28  KTSVPAFWT--RTIRALCKTWKLMKLSHHKG------IRLPRIDASLEGIFSETEKEIFN 79
           K + P  W    +   + K + + +   H+       I+L   ++   G+  +TE    +
Sbjct: 148 KATYPIMWAFNHSTDLVLKIFGISQWDEHETAYTDDEIKLLLEESYKSGLIDKTELTFVD 207

Query: 80  NILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHM 139
           NI  F +  + DIM+ R  +  +  + ++ + + +      +  P+   + DN  G +H+
Sbjct: 208 NIFDFSEKTVKDIMVPRTDMTCIFSEDSLEDIIKVVMDRQHTRYPICTYNKDNVIGFIHI 267

Query: 140 RDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVID 199
           +D       +Y +    + NI+    ++I+ + F+P  M +SDLL   ++ + ++A++ID
Sbjct: 268 KD-------LYKQQIQGDKNIK----DIIRKVKFIPKWMPISDLLKVFKKEKSQIAIIID 316

Query: 200 EHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDC 259
           E+GGT GLV+ EDI+  ++ +I  E   + + I+   DN ++VD +  LE++  ++  D 
Sbjct: 317 EYGGTLGLVTIEDILEEIVGEIQDEFDEEGTEINKTEDNKYVVDGKLILEDVNDLLQIDI 376

Query: 260 NCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRL 315
                 ++VD+LGG I+S L+  P   + V     +E  +L  + + + ++ I +L
Sbjct: 377 KS----ENVDTLGGWIYSKLNSYPKVNDKV-NYENYEFTVLKCNKKRIGKILIEKL 427


>gi|325478624|gb|EGC81736.1| hypothetical protein HMPREF9290_0661 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 455

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 122/221 (55%), Gaps = 12/221 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           +S +G+ +   +E+  NI+ F      +IM  R SI  ++      + +    + G S +
Sbjct: 192 SSQQGVINSQGEEMIVNIMSFDDKIAREIMTPRTSIYMIDYDEFSIDTLNDLLEEGYSRV 251

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PVYK+S+DN  G V+++D+  +I   Y + N  ++NI     N IK+  +VP +  +  L
Sbjct: 252 PVYKDSIDNILGTVYIKDL--FIE--YKRNNYKDINID----NCIKDCYYVPETKKIDIL 303

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVD 243
           L  +Q ++  ++++IDE+GG  G+V+ EDIV  ++ +I  E+  K   I  +S+N FIVD
Sbjct: 304 LKELQANKNYLSILIDEYGGFSGMVTVEDIVEEIVGEIEDEYDEKLPEIQKISENEFIVD 363

Query: 244 ARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPA 284
              D++++ + IGT     K E    ++ GLI   LD IP+
Sbjct: 364 GSMDIDDVNEHIGTYLYSDKHE----TISGLIIENLDFIPS 400


>gi|239947062|ref|ZP_04698815.1| hemolysin [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921338|gb|EER21362.1| hemolysin [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 299

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 131/246 (53%), Gaps = 21/246 (8%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVE---DKATVYEAMLMFEKYGRSWMPVYKNSL 130
           E+ I  N+L+     I+DIM+ R  I A++   +   + E++ +   + R+   +Y  +L
Sbjct: 61  ERNILANLLKLEDKTIEDIMVPRSDIAAIKLTTNLEELSESIKLEVPHTRTL--IYDGTL 118

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G +H++D+   +    A   N  L        LI+  +    SM + DLL  ++  
Sbjct: 119 DNVVGFIHIKDLFKAL----ATKQNGRL------KKLIRKHIIAAPSMKLLDLLAKMRRE 168

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK--KSMISAVSDNTFIVDARTDL 248
           R  +A+V+DE+GGTDGLV+ ED++  ++  I  EH  +        ++++T I +AR ++
Sbjct: 169 RTHIAIVVDEYGGTDGLVTIEDLIEEIVGRIDDEHDQQLDSDNFKVINNSTIISNARVEV 228

Query: 249 EELAKIIGTDCNCLKGEQD-VDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           E L +IIG     LK + D  D++GGL+ + +  +PA G  +      EI + DA  R +
Sbjct: 229 EVLEEIIG---EKLKSDDDEFDTIGGLVLTRVGSVPAIGTRIDISENIEIEVTDATPRSL 285

Query: 308 RRVRIR 313
           ++V+IR
Sbjct: 286 KQVKIR 291


>gi|290960551|ref|YP_003491733.1| hypothetical protein SCAB_61711 [Streptomyces scabiei 87.22]
 gi|260650077|emb|CBG73193.1| putative membrane protein [Streptomyces scabiei 87.22]
          Length = 434

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 137/252 (54%), Gaps = 15/252 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +    E+ + +++       + ++M+ R  + A+E   T+ +A+ +  + G S +
Sbjct: 175 AEKESLIEAEERRMVHSVFELGDTLVREVMVPRTDLVAIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSE--SNLIKNILFVPSSMLVS 181
           PV   + D+  G+V+++D+        A+  +I+ + + SE  S  ++  +FVP +    
Sbjct: 235 PVTGENEDDIVGIVYLKDL--------ARKTHISRDAE-SELVSTAMRPAVFVPDTKNAG 285

Query: 182 DLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFI 241
           DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + ++ + 
Sbjct: 286 DLLREMQQERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDREIPPVEDLGEDRYR 345

Query: 242 VDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIVIL 300
           V AR D+ +L ++ G D      ++DV+++GGL+   L R+P  G   V+ +P    + L
Sbjct: 346 VTARLDITDLGELYGLDA---YDDEDVETVGGLLAKALGRVPIAGASSVVALPDERELRL 402

Query: 301 DADVRCVRRVRI 312
            A+    RR +I
Sbjct: 403 TAEAAAGRRNKI 414


>gi|291279471|ref|YP_003496306.1| magnesium/cobalt efflux protein [Deferribacter desulfuricans SSM1]
 gi|290754173|dbj|BAI80550.1| magnesium/cobalt efflux protein [Deferribacter desulfuricans SSM1]
          Length = 424

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 118/227 (51%), Gaps = 22/227 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+    +KE+ +NI       + +IM+ R  +  +     + E + +  +   S +PVY
Sbjct: 182 EGVLENQKKEMLHNIFEISDTLVKEIMVPRTEMVVIRIDQDINEILDVVIETEYSRIPVY 241

Query: 127 KNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTN 186
           +  +DN  G+++ +D+I     +   + ++NL       N+++   FVP +  + DLL  
Sbjct: 242 EGKMDNIIGILYTKDLIK---ELRKSSKDVNL------KNILRKPYFVPETKKIDDLLRE 292

Query: 187 IQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEH-HSKKSMISAVSDNTFIVDAR 245
            Q   I +A+VIDE+GG  GLV+ ED++  ++ +I  E    ++  +  +SD+TFI+D  
Sbjct: 293 FQSKHIHLAIVIDEYGGVAGLVTLEDVIEEIVGEIRDEFDKEEEDKLIKLSDDTFIIDPL 352

Query: 246 TDLEELAKIIGTDCNCLKGEQ-----DVDSLGGLIFSVLDRIPARGE 287
            D+++        C   K E+     D +++GGLI+ +  +IP  GE
Sbjct: 353 LDIDDF-------CEYFKLEKDESMDDYETVGGLIYFIAGKIPEIGE 392


>gi|221194931|ref|ZP_03567987.1| transporter, HlyC/CorC family [Atopobium rimae ATCC 49626]
 gi|221184834|gb|EEE17225.1| transporter, HlyC/CorC family [Atopobium rimae ATCC 49626]
          Length = 450

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 117/218 (53%), Gaps = 12/218 (5%)

Query: 70  FSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNS 129
            SE EK + + ++        ++M+ RV +  +ED +T+ E + +  K G S +P+Y ++
Sbjct: 194 LSEEEKSMIHEVIDMGDTVAREVMVPRVDLTTMEDISTLSEVLTVMRKTGYSRIPIYHDN 253

Query: 130 LDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQE 189
           +D   G+ H++D+I  I   +A   +I        +  ++   ++P +  +  LL+ +Q 
Sbjct: 254 VDRIVGIAHIKDIIEPILEEHAGEKHI--------AQYVRAANYIPDTKDIIPLLSEMQS 305

Query: 190 SRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249
           SR +M +V+DE+GGT G ++ EDIV  ++ +I  E       ++ +SD  ++VD R  L+
Sbjct: 306 SRDQMVIVVDEYGGTAGAITVEDIVEEIVGEIADEFDPDNKYLTQLSDREWLVDGRFSLD 365

Query: 250 ELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
           +  ++       ++  ++ +++ G +  + DR+P  G+
Sbjct: 366 DAVEL----GWPVEDSEEYETIAGFVLELADRLPRPGD 399


>gi|218961524|ref|YP_001741299.1| CBS domain protein (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730181|emb|CAO81093.1| CBS domain protein (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 421

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 126/240 (52%), Gaps = 18/240 (7%)

Query: 75  KEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPR 134
           K++   + RF++  I +I + RV I A+E+   + E   +    G S +PVY+ ++D   
Sbjct: 192 KKMLVGLFRFKEAEIKEIYVPRVKITAIEENKDLEELKQVIIDSGYSRIPVYRGTIDEIV 251

Query: 135 GMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRM 194
           G+++++D++     +Y +   I          L++ + FV  +M V  LL   ++ ++++
Sbjct: 252 GIIYVKDLL-----LYPEKKTIK--------ELMRPVWFVTENMKVQALLNQFKQKKLQI 298

Query: 195 ALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKK-SMISAVSDNTFIVDARTDLEELAK 253
           A+V+DE+GGT G++S EDI+  ++ DI  E+   +   +    +NT+I+     + +  +
Sbjct: 299 AVVVDEYGGTSGIISLEDILEEIVGDIRDEYDKDEIPELIKKDENTYIISGNFSVRQFNE 358

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
              T+ +     +D D++   + +  + +PA G         E  +LDAD + +++++++
Sbjct: 359 DFSTEISV----EDYDNIAEFLLAYFNNVPAIGATAKYDDKLEFTVLDADEKSIKQIQVK 414


>gi|258651806|ref|YP_003200962.1| CBS domain containing protein [Nakamurella multipartita DSM 44233]
 gi|258555031|gb|ACV77973.1| CBS domain containing protein [Nakamurella multipartita DSM 44233]
          Length = 537

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 128/251 (50%), Gaps = 15/251 (5%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A   G+  ETE+E+  ++       + ++M+ R     +E   T+ +A+ +  + G S +
Sbjct: 173 AGSRGVVEETEREMLQSVFDLGDTIVREVMVPRTETVWIERDKTLRQALALASRSGMSRI 232

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV    LD+  G+ +++D+I+   ++        L      + +++  +FVP S  V DL
Sbjct: 233 PVVGEDLDDIVGVAYLKDLIAPAMNLAPDDQGPVL------TQIMREPVFVPESKNVDDL 286

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHS-KKSMISAVSDNTFIV 242
           L  +Q  R   A+V+DE+GGT G+V+ EDI+  ++ +IT E+ +   + +  + D +F V
Sbjct: 287 LREMQRDRTHFAVVVDEYGGTAGIVTIEDILEEIVGEITDEYDADTPAPVVPLPDGSFRV 346

Query: 243 DARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDA 302
            AR  +E+L ++   + +  +    VD++GGL+   L R+P  G  V    G   + L  
Sbjct: 347 SARLPVEDLGELFDVELDDDE----VDTVGGLLAQQLGRVPLPGSEV----GVAGLFLHG 398

Query: 303 DVRCVRRVRIR 313
           +    RR R R
Sbjct: 399 EPGVDRRGRPR 409


>gi|315608315|ref|ZP_07883304.1| CBS domain protein [Prevotella buccae ATCC 33574]
 gi|315249945|gb|EFU29945.1| CBS domain protein [Prevotella buccae ATCC 33574]
          Length = 423

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 119/247 (48%), Gaps = 27/247 (10%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F   ++ D M+ R  INA+E+ A + E   +F + G S + VY+  +D
Sbjct: 198 EDEVKIFQNALDFSDTKVRDCMVPRTEINAIEENAPLEELRQLFIESGNSKIIVYREDID 257

Query: 132 NPRGMVH----MRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNI 187
           +  G +H     R+   +I H                   ++ + FVP +M    L+   
Sbjct: 258 HIIGYIHSSEMFRNPRRWIDH-------------------VRTMPFVPETMAAQKLMKIF 298

Query: 188 QESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTD 247
            + +  + +V+DE GGT G+V+ EDIV  +  DI  EH S K +     D  +++ AR +
Sbjct: 299 MQQKKTLGVVVDEFGGTSGIVALEDIVEEIFGDIEDEHDSDKYIAKRTDDGDYVLSARLE 358

Query: 248 LEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
           ++++ ++       L    D  +LGGLI       P   E+V +I  ++I IL A +  +
Sbjct: 359 IDKINEMFDL---GLPESDDYMTLGGLILHDYQSFPKLNEIV-KIGSYDIKILKASMTKI 414

Query: 308 RRVRIRR 314
             V++ +
Sbjct: 415 ELVKLHK 421


>gi|224532101|ref|ZP_03672733.1| CBS domain pair protein [Borrelia valaisiana VS116]
 gi|224511566|gb|EEF81972.1| CBS domain pair protein [Borrelia valaisiana VS116]
          Length = 259

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 115/219 (52%), Gaps = 12/219 (5%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           S  E  +  N    ++  + +IMI R+ +  V+   +  + + +      S  PVY  ++
Sbjct: 25  SNIETSLIKNFNSLKETIVKEIMIPRIGVIFVDYAKSKDDLLKVVTSSTHSRFPVYHGTI 84

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G++H RD++    HM  K        ++   ++++ ++FVP S     LL   QE+
Sbjct: 85  DNIVGIIHTRDILL---HMCKKDF-----YEIDLKDIMRKVMFVPESKKTDSLLKEFQEN 136

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
            + +A+V+DE+GG  GLV+ EDI+  ++ DI  E  ++   I  + D +++ DAR  +E+
Sbjct: 137 HVHIAIVVDEYGGVSGLVTLEDILEEIVGDIQDEFDNELDEIVRLDDGSYLCDARILIED 196

Query: 251 LAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVV 289
           L + +  + N   G  D D+LGG ++ +  RIP + E V
Sbjct: 197 LNEKL--NLNLPNG--DFDTLGGFVYDLFGRIPLKNEKV 231


>gi|328882368|emb|CCA55607.1| Magnesium and cobalt efflux protein CorC [Streptomyces venezuelae
           ATCC 10712]
          Length = 431

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 137/254 (53%), Gaps = 17/254 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A  E +  + E+ + +++       + ++M+ R  +  +E   T+ +A+ +  + G S +
Sbjct: 175 AEQESLIEDDERRMVHSVFELGDTLVREVMVPRTDLVCIERYKTIRQALTLALRSGFSRI 234

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNIL----FVPSSML 179
           PV   + D+  G+V+++D++        +  +IN   + SES+L+   +    FVP +  
Sbjct: 235 PVTGENEDDIVGVVYLKDLV--------RKTHIN---RESESDLVSTAMRAATFVPDTKN 283

Query: 180 VSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNT 239
             DLL  +Q+ R  +A+VIDE+GGT G+V+ EDI+  ++ +IT E+  +   +  + +  
Sbjct: 284 AGDLLREMQQERNHVAVVIDEYGGTAGIVTIEDILEEIVGEITDEYDRELPPVQDLGEGR 343

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARG-EVVLEIPGFEIV 298
             V AR D+ +L ++ G   +    ++DV+++GGL+   L R+P  G + V+E+P    +
Sbjct: 344 HRVTARLDIGDLGELYGLGPDEYD-DEDVETVGGLLAKALGRVPIAGAKAVVELPDGRSL 402

Query: 299 ILDADVRCVRRVRI 312
            L A+    RR +I
Sbjct: 403 RLTAESPAGRRNKI 416


>gi|237809459|ref|YP_002893899.1| CBS domain containing protein [Tolumonas auensis DSM 9187]
 gi|237501720|gb|ACQ94313.1| CBS domain containing protein [Tolumonas auensis DSM 9187]
          Length = 292

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 127/253 (50%), Gaps = 16/253 (6%)

Query: 63  DASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW 122
           DA    +  E  KE+   +L   ++R+ DIMI R  +  +     V   + M  +   S 
Sbjct: 41  DAEERDVIDEDTKEMIEGVLEVSELRVRDIMIPRTQMITIRSDQPVSAFLPMIIRSAHSR 100

Query: 123 MPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSD 182
            PV  +  D+  G++  +D++ Y   + +++ +           +++  + VP S  V  
Sbjct: 101 FPVISDDKDHVDGILLAKDLLPYGFGLTSESFDFE--------KVLRPAVVVPESKRVDR 152

Query: 183 LLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSK---KSMISAVSDNT 239
           LL   Q+ R  MA+V+DE G   GLV+ EDI+ +++ +I  E+  +   +  I A+ +  
Sbjct: 153 LLKEFQQQRYHMAIVVDEFGSVSGLVTIEDILELIVGEIEDEYDDQAQDQPSIRALDEYR 212

Query: 240 FIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVI 299
           + ++A T +E+  +  G+  +    + DVD++GGL+      +P RGE + E+ GFE  I
Sbjct: 213 YTINALTPIEDFNEHFGSHFS----DDDVDTIGGLVMHGFGHLPKRGESI-ELSGFEFKI 267

Query: 300 LDADVRCVRRVRI 312
           L  D R + ++++
Sbjct: 268 LQVDRRRLIQLQV 280


>gi|254421990|ref|ZP_05035708.1| conserved domain protein [Synechococcus sp. PCC 7335]
 gi|196189479|gb|EDX84443.1| conserved domain protein [Synechococcus sp. PCC 7335]
          Length = 476

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 126/242 (52%), Gaps = 13/242 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+EI +N+  FR   +++IM+ R  I A+   AT  + +    +   S  P+   SLDN 
Sbjct: 224 EREILSNVFEFRGATVEEIMVPRTQIAALPLSATFQDLLDEIVRSKHSRYPIIGESLDNV 283

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
            GM++  D+   +S          L+ Q S    IK    VP ++ ++DLLT +Q+S   
Sbjct: 284 LGMINFHDLALPLSRE-------ELSSQSSIEPWIKTAKVVPETLPLNDLLTQMQQSAKE 336

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           M +V+DE+GGT GLV++ D+ + ++ D  +++      I    ++T I  A+TDLE++ +
Sbjct: 337 MVIVVDEYGGTAGLVTFRDLTAKIIGD--ADNTESIGKIIYQDNHTVIFPAQTDLEDVNE 394

Query: 254 IIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
            +      L   ++  +LGG +   L RIP   E ++     E+ +  A+   + +++IR
Sbjct: 395 RLSV---ALPTSENYVTLGGFVIFELQRIPQVNEQLI-YEDLELTVAAAEGPRLTKIKIR 450

Query: 314 RL 315
           RL
Sbjct: 451 RL 452


>gi|126658843|ref|ZP_01729987.1| hypothetical protein CY0110_08326 [Cyanothece sp. CCY0110]
 gi|126619941|gb|EAZ90666.1| hypothetical protein CY0110_08326 [Cyanothece sp. CCY0110]
          Length = 469

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 125/242 (51%), Gaps = 13/242 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E+ +  N+  F  +   ++M+ R  + A+ + AT  E +    + G S  PV  +SLD+ 
Sbjct: 210 ERALLKNVFEFSAVTAVEVMVPRTQLVAIAETATFEEFLQEVTQTGHSRYPVKGDSLDDI 269

Query: 134 RGMVHMRDVISYISH-MYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRI 192
            G++  +D+   +       T+ +         + IK + FV  SM + +LL  +Q S++
Sbjct: 270 LGIIDFKDLAQPLGQGELIPTSQVQ--------SWIKPVKFVSESMALDELLALMQRSQL 321

Query: 193 RMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
           +M +V+DE GGT GL++ +D++  ++ +       ++  +  + ++ F+++A+ +LEEL 
Sbjct: 322 KMVMVVDEFGGTSGLITIQDVIGEILGNDIEGIIEEEDTLKMIDEHNFLIEAQLNLEELN 381

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
            ++G D   L    +  +LGG +     +IP+ GE  L        I+D++   ++++ +
Sbjct: 382 NVLGLD---LPLTDEYQTLGGFLLYQWQKIPSEGE-SLNYENLSFTIVDSEGPRLKQIHL 437

Query: 313 RR 314
           RR
Sbjct: 438 RR 439


>gi|298346302|ref|YP_003718989.1| HCC HlyC/CorC family transporter [Mobiluncus curtisii ATCC 43063]
 gi|298236363|gb|ADI67495.1| HCC HlyC/CorC family transporter [Mobiluncus curtisii ATCC 43063]
          Length = 426

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 128/234 (54%), Gaps = 12/234 (5%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           + ++E+  ++    +  + ++M+ RV +  +E + T+ +A+ +F +   S +PV     D
Sbjct: 186 DADREMIWSVFEMGRTLVREVMVPRVDMVTIESEKTLDKALTLFVRSSYSRVPVIGEDAD 245

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           + RG+++++DV+        + N+     Q++    ++   F+P   LV D L ++Q++ 
Sbjct: 246 DIRGILYLKDVLR-------RVNSDPAARQMTAEQAMREAKFIPEMNLVDDTLRDMQQNS 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             MA+++DE+G   GLV+ ED+V  ++ +++ EH   +       D ++IV AR  L +L
Sbjct: 299 YHMAVLVDEYGLIAGLVTLEDLVEEVIGEVSDEHDHAEKEPELQPDGSWIVPARLPLVDL 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVR 305
             ++GT+ +    ++DVD++GGL+   +  +P  G     + G E+  ++A+ R
Sbjct: 359 NDLLGTEID----DEDVDTVGGLLTKAVGVVPLVGASA-TVEGLELCAVEAEGR 407


>gi|304383133|ref|ZP_07365607.1| CBS domain protein [Prevotella marshii DSM 16973]
 gi|304335710|gb|EFM01966.1| CBS domain protein [Prevotella marshii DSM 16973]
          Length = 420

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 119/242 (49%), Gaps = 19/242 (7%)

Query: 72  ETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLD 131
           E E +IF N L F   ++ D MI R  INAV+   T+ E    F + G S + VY   +D
Sbjct: 194 EDEVKIFQNALDFSDTKVRDCMIPRTEINAVDMTCTLEELKNKFIESGNSKIIVYNEDID 253

Query: 132 NPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESR 191
           +  G +H        S M++K  +   +I        + +  VP +M    L+    + +
Sbjct: 254 HVVGYIHS-------SEMFSKPADWRTSI--------RELPIVPETMPAQKLMKTFLQQK 298

Query: 192 IRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEEL 251
             + +V+DE GGT GLVS EDIV  +  DI  EH + K + + V D+ +++ AR ++ ++
Sbjct: 299 KSIGIVVDEFGGTSGLVSLEDIVEEIFGDIEDEHDNAKYIATQVGDHEYVLSARLEIGKI 358

Query: 252 AKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR 311
            ++ G +   L    +  +LGGLI       P   E+V ++  FE  I+   +  +  VR
Sbjct: 359 NEMFGLN---LPESDEYMTLGGLILHEYQSFPKLHEIV-KVGNFEFKIIKNTMTKIELVR 414

Query: 312 IR 313
           ++
Sbjct: 415 LK 416


>gi|160889020|ref|ZP_02070023.1| hypothetical protein BACUNI_01440 [Bacteroides uniformis ATCC 8492]
 gi|270293863|ref|ZP_06200065.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317479301|ref|ZP_07938436.1| gliding motility-associated protein GldE [Bacteroides sp. 4_1_36]
 gi|156861487|gb|EDO54918.1| hypothetical protein BACUNI_01440 [Bacteroides uniformis ATCC 8492]
 gi|270275330|gb|EFA21190.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904589|gb|EFV26408.1| gliding motility-associated protein GldE [Bacteroides sp. 4_1_36]
          Length = 449

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 129/240 (53%), Gaps = 12/240 (5%)

Query: 74  EKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNP 133
           E  I   I+RF      ++M SR+ +  ++ +    + +    +   S +P+Y +S DN 
Sbjct: 208 ENNILEGIIRFGGETAKEVMTSRLDVVDLDIRTPFKDVVKCIVENVYSRIPIYADSRDNI 267

Query: 134 RGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIR 193
           +G+++++D++ +++    K +N          +LI+   FVP + ++ DLL + Q ++I 
Sbjct: 268 KGVLYIKDLLPHLN----KGDNFRWQ------SLIRPAYFVPETKMIDDLLRDFQANKIH 317

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAK 253
           +A+V+DE GGT G+V+ EDI+  ++ +I  E+  ++   + ++D+T++ +A+T L +  K
Sbjct: 318 IAIVVDEFGGTSGIVTMEDIIEEIVGEIHDEYDDEERTYAVLNDHTWVFEAKTQLTDFYK 377

Query: 254 IIGTDCNCL-KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           I   D     +   D D+L GL+  +    PA  E V     +E  +L+ D R + +V+ 
Sbjct: 378 ITKIDEETFDEVAGDADTLAGLLLELKGEFPALHEKV-TYGRYEFEVLEMDNRRILKVKF 436


>gi|239907244|ref|YP_002953985.1| magnesium and cobalt efflux protein CorC [Desulfovibrio magneticus
           RS-1]
 gi|239797110|dbj|BAH76099.1| magnesium and cobalt efflux protein CorC [Desulfovibrio magneticus
           RS-1]
          Length = 272

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 139/280 (49%), Gaps = 22/280 (7%)

Query: 34  FWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIM 93
           FW     AL K ++   +S  + I+    +A  EG     +  +  NILR    ++ DIM
Sbjct: 9   FWN----ALTKFFRQKSISLEELIQ----EARAEGSIIPEDASMLLNILRLESKQVSDIM 60

Query: 94  ISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT 153
           + R  I   E    +     + + +G S +PVY+ + DN  G+++ +D++S +  +  +T
Sbjct: 61  VPRPDIVCAEIDDGLDAVCALIKTHGHSRIPVYEGNRDNILGVLYAKDILSNMLPVCGET 120

Query: 154 NNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI 213
            ++          +++  LFVP ++ +  +L   +  +  MA+ +DE+GGT GL++ ED+
Sbjct: 121 PDLR--------AIMREALFVPETLDLKKMLLEFRSQKKHMAVALDEYGGTSGLLTLEDV 172

Query: 214 VSVLMRDITSEHH-SKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLG 272
           +  ++ +I  EH  SK   I  +      V  R  LE++   +G     L+ EQ V+++G
Sbjct: 173 LEEIVGEIEDEHDPSKPEEIRELRPGVHQVSGRAMLEDINTALGL---SLESEQ-VETIG 228

Query: 273 GLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           G +  +  R+P +G+    + G    + +AD R +R + I
Sbjct: 229 GFLTELAGRVPRQGD-AFTLDGRRFTVREADRRQIRSIVI 267


>gi|120597876|ref|YP_962450.1| CBS domain-containing protein [Shewanella sp. W3-18-1]
 gi|120557969|gb|ABM23896.1| CBS domain containing protein [Shewanella sp. W3-18-1]
 gi|319427329|gb|ADV55403.1| CBS domain containing protein [Shewanella putrefaciens 200]
          Length = 291

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 129/253 (50%), Gaps = 16/253 (6%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWM 123
           A    + ++  +E+   +L    +R+ DIMI R  I A++   TV E +      G S  
Sbjct: 41  AEQRDLITQDTREMIKGVLEVSDMRVRDIMIPRAQIVAIQIDNTVEELLSTVIGSGHSRF 100

Query: 124 PVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDL 183
           PV     D+  G++  +D+I Y           N +   S S +I+  + VP S  V  L
Sbjct: 101 PVVNEDKDHIEGILLAKDLIPY--------GFSNSDEPFSLSRVIRPAVVVPESKRVDVL 152

Query: 184 LTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSE--HHS-KKSMISAVSDNTF 240
           L   +  R  MA+V+DE+GG  GLV+ EDI+  ++ +I  E  H S +++ I  V +  +
Sbjct: 153 LKEFRSQRYHMAIVVDEYGGVSGLVTIEDILEEIVGEIEDEFDHDSAEETEIRKVGNTVY 212

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           +V A T +E+  +   TD +    +++ D++GGL+      +P R E ++ I G E  ++
Sbjct: 213 MVKALTPIEDFNEEFNTDFS----DEEFDTVGGLVSHAFGHLPERNESII-IEGIEFKVI 267

Query: 301 DADVRCVRRVRIR 313
           +AD R + ++R++
Sbjct: 268 NADTRRLIQLRVK 280


>gi|295702721|ref|YP_003595796.1| hypothetical protein BMD_0560 [Bacillus megaterium DSM 319]
 gi|294800380|gb|ADF37446.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 421

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 116/226 (51%), Gaps = 24/226 (10%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF--EKYGRSWMP 124
           EG  +  EKE+ +  L F  I +  I+  R+ + AV+  A +     MF  E+Y R  +P
Sbjct: 180 EGTINNIEKELVHRSLNFNDIVVGQILKPRIDVTAVDVNADIDSVCQMFLEERYSR--VP 237

Query: 125 VYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLL 184
           VY++ +DN  G++  R+ ++ +              ++S  +L++  +FV  SM +S LL
Sbjct: 238 VYEDHIDNIIGILSEREFLTCLIQ----------RKKISIRDLLRQPIFVVESMKISVLL 287

Query: 185 TNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDA 244
             +Q+S++ MA+V+DE GGT GLV+ EDI+  ++ +I  EH      +  + +  +  +A
Sbjct: 288 PELQKSKVHMAIVVDEFGGTAGLVTLEDILEEIVGEIWDEHDEAVKYVHQIGEKEYEFNA 347

Query: 245 RTDLEELAKIIGT---DCNCLKGEQDVDSLGGLIFSVLDRIPARGE 287
              ++E    I     D  C        +LGG I+   D IPA+G+
Sbjct: 348 DIPIDEFLTYIAVSSPDSTC-------HTLGGWIYEQFDHIPAKGD 386


>gi|153005042|ref|YP_001379367.1| hypothetical protein Anae109_2181 [Anaeromyxobacter sp. Fw109-5]
 gi|152028615|gb|ABS26383.1| protein of unknown function DUF21 [Anaeromyxobacter sp. Fw109-5]
          Length = 454

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 120/262 (45%), Gaps = 25/262 (9%)

Query: 67  EGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVY 126
           EG+  E ++E+ N++L F      +IM+ R  + A++  A   E   +  +   S MPVY
Sbjct: 187 EGVLDEVKEELLNSVL