RPSBLAST alignment for GI: 254780426 and conserved domain: TIGR03520

>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype. Length = 408
 Score =  119 bits (301), Expect = 8e-28
 Identities = 67/246 (27%), Positives = 133/246 (54%), Gaps = 17/246 (6%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E++I   I+ F       +M  R+ I A++ + +  E +    + G S +PVYK ++
Sbjct: 175 TKEEQKILQGIVSFGNTDTKQVMRPRLDIFALDIETSFSEIIPKIIENGYSRIPVYKETI 234

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G+++++D++ ++       N  N + Q    +L++   FVP +  + DLL + QE 
Sbjct: 235 DNITGVLYIKDLLPHL-------NKKNFDWQ----SLLREPYFVPENKKLDDLLRDFQEK 283

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +  +A+V+DE+GGT GLV+ EDI+  ++ DI+ E   +  + S + DN ++ + +T L++
Sbjct: 284 KNHLAIVVDEYGGTSGLVTLEDIIEEIVGDISDEFDDEDLIYSKIDDNNYVFEGKTSLKD 343

Query: 251 LAKIIGTDCNCL---KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
             KI+  + +     KGE   ++L G +  +    P +GE +     FE  I   D + +
Sbjct: 344 FYKILKLEEDMFDEVKGEA--ETLAGFLLEISGGFPKKGEKIT-FENFEFTIEAMDKKRI 400

Query: 308 RRVRIR 313
           ++V++ 
Sbjct: 401 KQVKVT 406