RPSBLAST alignment for GI: 254780426 and conserved domain: pfam00571

>gnl|CDD|144238 pfam00571, CBS, CBS domain. CBS domains are small intracellular modules that pair together to form a stable globular domain. This family represents a single CBS domain. Pairs of these domains have been termed a Bateman domain. CBS domains have been shown to bind ligands with an adenosyl group such as AMP, ATP and S-AdoMet. CBS domains are found attached to a wide range of other protein domains suggesting that CBS domains may play a regulatory role making proteins sensitive to adenosyl carrying ligands. The region containing the CBS domains in Cystathionine-beta synthase is involved in regulation by S-AdoMet. CBS domain pairs from AMPK bind AMP or ATP. The CBS domains from IMPDH and the chloride channel CLC2 bind ATP. Length = 57
 Score = 39.1 bits (92), Expect = 0.002
 Identities = 13/52 (25%), Positives = 27/52 (51%)

Query: 168 IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMR 219
             +++ VP    + + L  ++E+ I    V+DE G   G+V+  D++  L+ 
Sbjct: 6   TPDVVTVPPDTSLEEALELMRENGISRLPVVDEDGKLVGIVTLRDLLRALLG 57