RPSBLAST alignment for GI: 254780426 and conserved domain: PRK15094

>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional. Length = 292
 Score = 90.3 bits (224), Expect = 6e-19
 Identities = 59/227 (25%), Positives = 119/227 (52%), Gaps = 15/227 (6%)

Query: 88  RIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS 147
           R+ DIMI R  +  ++   T+ E + +  +   S  PV     D+  G++  +D++ ++ 
Sbjct: 68  RVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFM- 126

Query: 148 HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
               +++    ++      +++  + VP S  V  +L   +  R  MA+VIDE GG  GL
Sbjct: 127 ----RSDAEAFSMD----KVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGL 178

Query: 208 VSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQ 266
           V+ EDI+ +++ +I  E+  +  +    +S +T+ V A   +E+  +  GT  +    ++
Sbjct: 179 VTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFS----DE 234

Query: 267 DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +VD++GGL+      +PARGE + +I G++  +  AD R + +V ++
Sbjct: 235 EVDTIGGLVMQAFGHLPARGETI-DIDGYQFKVAMADSRRIIQVHVK 280