RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus
Liberibacter asiaticus str. psy62]
         (320 letters)



>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE.  Members
           of this protein family are exclusive to the
           Bacteroidetes phylum (previously
           Cytophaga-Flavobacteria-Bacteroides). GldC is a protein
           linked to a type of rapid surface gliding motility found
           in certain Bacteroidetes, such as Flavobacterium
           johnsoniae and Cytophaga hutchinsonii. GldE was
           discovered because of its adjacency to GldD in F.
           johnsonii. Overexpression of GldE partially supresses
           the effects of a GldB point mutant suggesting that GldB
           and GldE interact. Gliding motility appears closely
           linked to chitin utilization in the model species
           Flavobacterium johnsoniae. Not all Bacteroidetes with
           members of this protein family appear to have all of the
           genes associated with gliding motility and in fact some
           do not appear to express the gliding phenotype.
          Length = 408

 Score =  119 bits (301), Expect = 8e-28
 Identities = 67/246 (27%), Positives = 133/246 (54%), Gaps = 17/246 (6%)

Query: 71  SETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSL 130
           ++ E++I   I+ F       +M  R+ I A++ + +  E +    + G S +PVYK ++
Sbjct: 175 TKEEQKILQGIVSFGNTDTKQVMRPRLDIFALDIETSFSEIIPKIIENGYSRIPVYKETI 234

Query: 131 DNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQES 190
           DN  G+++++D++ ++       N  N + Q    +L++   FVP +  + DLL + QE 
Sbjct: 235 DNITGVLYIKDLLPHL-------NKKNFDWQ----SLLREPYFVPENKKLDDLLRDFQEK 283

Query: 191 RIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEE 250
           +  +A+V+DE+GGT GLV+ EDI+  ++ DI+ E   +  + S + DN ++ + +T L++
Sbjct: 284 KNHLAIVVDEYGGTSGLVTLEDIIEEIVGDISDEFDDEDLIYSKIDDNNYVFEGKTSLKD 343

Query: 251 LAKIIGTDCNCL---KGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCV 307
             KI+  + +     KGE   ++L G +  +    P +GE +     FE  I   D + +
Sbjct: 344 FYKILKLEEDMFDEVKGEA--ETLAGFLLEISGGFPKKGEKIT-FENFEFTIEAMDKKRI 400

Query: 308 RRVRIR 313
           ++V++ 
Sbjct: 401 KQVKVT 406


>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC;
           Provisional.
          Length = 292

 Score = 90.3 bits (224), Expect = 6e-19
 Identities = 59/227 (25%), Positives = 119/227 (52%), Gaps = 15/227 (6%)

Query: 88  RIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYIS 147
           R+ DIMI R  +  ++   T+ E + +  +   S  PV     D+  G++  +D++ ++ 
Sbjct: 68  RVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFM- 126

Query: 148 HMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGL 207
               +++    ++      +++  + VP S  V  +L   +  R  MA+VIDE GG  GL
Sbjct: 127 ----RSDAEAFSMD----KVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGL 178

Query: 208 VSYEDIVSVLMRDITSEHHSKKSM-ISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQ 266
           V+ EDI+ +++ +I  E+  +  +    +S +T+ V A   +E+  +  GT  +    ++
Sbjct: 179 VTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFS----DE 234

Query: 267 DVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIR 313
           +VD++GGL+      +PARGE + +I G++  +  AD R + +V ++
Sbjct: 235 EVDTIGGLVMQAFGHLPARGETI-DIDGYQFKVAMADSRRIIQVHVK 280


>gnl|CDD|183209 PRK11573, PRK11573, hypothetical protein; Provisional.
          Length = 413

 Score = 77.5 bits (191), Expect = 5e-15
 Identities = 65/241 (26%), Positives = 121/241 (50%), Gaps = 27/241 (11%)

Query: 81  ILRFRKIRIDDIMISR---VSINAVED-KATVYEAMLMFEKYGRSWMPVYKNSLDNPRGM 136
           +L   K+ +DDIM+ R   V I+  +D K+ + +  L    +GR  + +Y++SLD+   M
Sbjct: 181 VLDLEKVTVDDIMVPRNEIVGIDINDDWKSILRQ--LTHSPHGR--IVLYRDSLDDAISM 236

Query: 137 VHMRDVISYISHMYAKTNNINLNIQLSESNLIK---NILFVPSSMLVSDLLTNIQESRIR 193
           + +R+  +Y      K        + ++ N+++    I FVP    +S  L   Q ++ +
Sbjct: 237 LRVRE--AYRLMTEKK--------EFTKENMLRAADEIYFVPEGTPLSTQLVKFQRNKKK 286

Query: 194 MALVIDEHGGTDGLVSYEDIVSVLMRDI-TSEHHSKKSMISAVSDNTFIVDARTDLEELA 252
           + LV+DE+G   GLV+ EDI+  ++ D  TS   +    ++  +D + I+D   ++ E+ 
Sbjct: 287 VGLVVDEYGDIQGLVTVEDILEEIVGDFTTSMSPTLAEEVTPQNDGSVIIDGTANVREIN 346

Query: 253 KIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRI 312
           K      N    E D  ++ G+I   L+ IP  G  V  I  ++I ILD     +++V++
Sbjct: 347 KAF----NWHLPEDDARTVNGVILEALEEIPVAGTRV-RIGEYDIDILDVQDNMIKQVKV 401

Query: 313 R 313
            
Sbjct: 402 T 402


>gnl|CDD|162293 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase.
           This model describes a rather tightly conserved cluster
           of IMP dehydrogenase sequences, many of which are
           characterized. The model excludes two related families
           of proteins proposed also to be IMP dehydrogenases, but
           without characterized members. These are related
           families are the subject of separate models.
          Length = 450

 Score = 34.6 bits (80), Expect = 0.037
 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPR--GMVHMRDVISYISHMYAKTNNINLNIQLS 163
            TV + + + E+ G S +PV ++     +  G++  RD+       + K     ++  ++
Sbjct: 97  TTVADVLELMERKGISGIPVVEDGDMTGKLVGIITKRDI------RFVKDKGKPVSEVMT 150

Query: 164 ESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSV 216
              +I     VP  + + + L  + E RI    V+D++G   GL++ +DIV  
Sbjct: 151 REEVIT----VPEGIDLEEALKVLHEHRIEKLPVVDKNGELVGLITMKDIVKR 199


>gnl|CDD|180460 PRK06196, PRK06196, oxidoreductase; Provisional.
          Length = 315

 Score = 28.9 bits (65), Expect = 1.6
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 6/34 (17%)

Query: 282 IPARG-----EVVLEIPGFEIVILD-ADVRCVRR 309
           +PAR      E +  I G E+V+LD AD+  VR 
Sbjct: 55  VPARRPDVAREALAGIDGVEVVMLDLADLESVRA 88


>gnl|CDD|161821 TIGR00331, hrcA, heat shock gene repressor HrcA.  In Bacillus
           subtilis, hrcA is the first gene of the dnaK operon and
           so is itself a heat shock gene.
          Length = 337

 Score = 28.8 bits (65), Expect = 2.0
 Identities = 21/106 (19%), Positives = 42/106 (39%), Gaps = 10/106 (9%)

Query: 152 KTNNINLNIQLSESNL--IKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVS 209
           K   I L   +S+ +L    NIL        +D L     S IR  ++         +  
Sbjct: 157 KNKVIELPANISQEDLERAVNIL--------NDRLRGRTLSEIREQIIELLSQLKIEIEE 208

Query: 210 YEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKII 255
           +ED +  L+  I SE + ++  +   S+     +    +E + +++
Sbjct: 209 FEDELVDLIISIFSEFNEEELYVDGKSNLLEQPEFFDPIERIRELL 254


>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other
           proteins.  Domain present in all 3 forms of cellular
           life. Present in two copies in inosine monophosphate
           dehydrogenase, of which one is disordered in the crystal
           structure [3]. A number of disease states are associated
           with CBS-containing proteins including homocystinuria,
           Becker's and Thomsen disease.
          Length = 49

 Score = 28.6 bits (65), Expect = 2.5
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 174 VPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVL 217
           V     + + L  ++E  IR   V+DE G   G+V+  DI+  L
Sbjct: 5   VSPDTTLEEALELLREHGIRRLPVVDEEGRLVGIVTRRDIIKAL 48


>gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating
           P-type ATPase.  The calcium P-type ATPases have been
           characterized as Type IIA based on a phylogenetic
           analysis which distinguishes this group from the Type
           IIB PMCA calcium pump modelled by TIGR01517. A separate
           analysis divides Type IIA into sub-types, SERCA and PMR1
           the former of which is modelled by TIGR01116.
          Length = 884

 Score = 28.3 bits (63), Expect = 3.0
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 44/130 (33%)

Query: 165 SNLIKN--ILFVPSSMLVSDLLTNIQES-RIRMALVIDEHGGTDGLVSYEDIVSVLMRDI 221
           S  +KN  IL + +S ++S  + NI ++  I +A++I              +V+V     
Sbjct: 56  SQFVKNPLILLLIASAVISVFMGNIDDAVSITLAILI--------------VVTV---GF 98

Query: 222 TSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGG-------L 274
             E+ S+KS                 LE L K++  +C+ ++  +    L         +
Sbjct: 99  VQEYRSEKS-----------------LEALNKLVPPECHLIREGKLEHVLASTLVPGDLV 141

Query: 275 IFSVLDRIPA 284
             SV DR+PA
Sbjct: 142 CLSVGDRVPA 151


>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic
           pyrophosphatase; Provisional.
          Length = 546

 Score = 28.3 bits (64), Expect = 3.2
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 4/93 (4%)

Query: 167 LIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMR----DIT 222
            I   + V     + +    + E+ ++   V+DE G   GLVS  D+    M     +I 
Sbjct: 74  EIDKPVTVSPDTSLKEAWNLMDENNVKTLPVVDEEGKLLGLVSLSDLARAYMDILDPEIL 133

Query: 223 SEHHSKKSMISAVSDNTFIVDARTDLEELAKII 255
           S+  +    I    D   +V A  D  E  K++
Sbjct: 134 SKSPTSLENIIRTLDGEVLVGAEEDKVEEGKVV 166


>gnl|CDD|177609 PHA03372, PHA03372, DNA packaging terminase subunit 1; Provisional.
          Length = 668

 Score = 27.8 bits (62), Expect = 3.5
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 79  NNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSW--MPVYKNSLDNPRGM 136
           N +L +     D   +S  S+N  + KATV+   L+  ++G++W  +P+    L N  G+
Sbjct: 177 NRVLEYLLHVFDIEFLSESSLNIFKQKATVF---LVPRRHGKTWFIIPIISFLLKNIIGI 233

Query: 137 VHMRDVISYISH 148
                 I Y++H
Sbjct: 234 -----SIGYVAH 240


>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA
           synthetase/aspartyl/glutamyl-tRNA amidotransferase
           subunit C; Provisional.
          Length = 706

 Score = 27.6 bits (61), Expect = 4.6
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 64  ASLEGIFSETEKEIFNNILRFRKIRIDDIMIS----RVSINAVEDKATVYEAMLMFEKYG 119
           A    IF  T   IF  IL+ R  RI  I I     ++S N ++++    E    F   G
Sbjct: 311 ADATDIFENTRYGIFKQILQ-RGGRIKGINIKGQSEKLSKNVLQNE-YAKEIAPSFGAKG 368

Query: 120 RSWMPVYKNSLDN 132
            +WM      LD+
Sbjct: 369 MTWMRAEAGGLDS 381


>gnl|CDD|162590 TIGR01899, cas_TM1807_csm5, CRISPR-associated RAMP protein, Csm5
           family.  CRISPR is a term for Clustered Regularly
           Interspaced Short Palidromic Repeats. A number of
           protein families appear only in association with these
           repeats and are designated Cas (CRISPR associated)
           proteins. Members of this cas gene family are found in
           the mtube subtype of CRISPR/cas locus and designated
           Csm5, for CRISPR/cas Subtype Mtube, protein 5.
          Length = 365

 Score = 26.7 bits (59), Expect = 7.7
 Identities = 19/113 (16%), Positives = 31/113 (27%), Gaps = 10/113 (8%)

Query: 56  GIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMF 115
           G    R +    GI +   K+  N++ R   +++ D    R     V      Y      
Sbjct: 152 GRAFERKELKKNGISNTIPKDPVNDVFRA--LKVSDSRPLRTDRLIVHRIKLNY------ 203

Query: 116 EKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNI