BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780427|ref|YP_003064840.1| hypothetical protein CLIBASIA_01560 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780427|ref|YP_003064840.1| hypothetical protein CLIBASIA_01560 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 346 bits (888), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%) Query: 1 MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLV 60 MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLV Sbjct: 1 MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLV 60 Query: 61 FTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGK 120 FTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGK Sbjct: 61 FTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGK 120 Query: 121 EFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171 EFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD Sbjct: 121 EFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171 >gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 23.1 bits (48), Expect = 2.6, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query: 1 MSVKKVNLPRLDLQIAVENALWGDEIHLRTLC 32 +SV ++ +P+ L++A A+ DE L+ LC Sbjct: 259 ISVARILMPKSRLRLAAGRAMMSDE--LQALC 288 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.141 0.408 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,837 Number of Sequences: 1233 Number of extensions: 4575 Number of successful extensions: 9 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 171 length of database: 328,796 effective HSP length: 68 effective length of query: 103 effective length of database: 244,952 effective search space: 25230056 effective search space used: 25230056 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)