HHsearch results for GI: 254780429 and protein with PDBid: 3h3n_X

>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleotide-binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O
Probab=90.84  E-value=0.73  Score=24.47  Aligned_cols=63  Identities=19%  Similarity=0.263  Sum_probs=47.0

Q ss_pred             EEEEECCCHHHEEEEEECCCCEEEEEEEEECC-------------HHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCC
Q ss_conf             78862168012789997798139999998422-------------68999899999999976099987866543037
Q gi|254780429|r    3 VLALDTTGADCSVAIYDSHAGRILGSYFKNLG-------------RGHAEHLMPAIDYALKDSRLEVSQVDRVVTAL   66 (206)
Q Consensus         3 iLaIdTs~~~~sval~~~~~~~~~~~~~~~~~-------------r~hs~~L~~~i~~lL~~~~~~~~~id~iav~~   66 (206)
                      +|+||-.|...-++|++.+ ++++++...+.+             ..--+.+...+.+++++++++..+|.+|.++-
T Consensus         7 ~lgIDiGTts~Ka~l~d~~-g~~i~~~~~~~~~~~~~~g~~Eqd~~~~~~~~~~~~~~~~~~~~~~~~~I~aI~is~   82 (506)
T 3h3n_X            7 VMAIDQGTTSSRAIIFDRN-GKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFIESGIRPEAIAGIGITN   82 (506)
T ss_dssp             EEEEEECSSEEEEEEEETT-SCEEEEEEEECCCBCSSTTCCEECHHHHHHHHHHHHHHHHHHHTCCGGGEEEEEEEE
T ss_pred             EEEEECCCCCEEEEEECCC-CCEEEEEEEECCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEEEC
T ss_conf             9999832203100068189-999999998567165899818889999999999999999998599878868999978