HHsearch alignment for GI: 254780430 and conserved domain: PRK11190

>PRK11190 putative DNA uptake protein; Provisional.
Probab=99.91  E-value=4.6e-24  Score=171.11  Aligned_cols=79  Identities=30%  Similarity=0.643  Sum_probs=74.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE-ECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC-CCEEEEE
Q ss_conf             54402688999999999877778752897599964-334799996366466666899999999999999789-7003553
Q gi|254780430|r  111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP-EVKDIRT  188 (189)
Q Consensus       111 ~~~~~~~~~~i~~~l~~~IrP~l~~dGG~i~~~~~-~~g~v~v~~~GaC~~Cpss~~Tl~~gie~~l~~~vp-ev~~V~~  188 (189)
T Consensus       101 ~~~d~~l~~~i~~vl~~~i~P~l~~hGG~v~l~~i~~~~~~~~~~~G~C~gC~~~~~Tlk~gvE~~l~~~~P~ei~~V~d  180 (192)
T PRK11190        101 VADDAPLMERVEYVLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPGELKGVRD  180 (192)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHHHHCCCEEEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCHHHCEEEE
T ss_conf             68875599999999987319567637987999998279889999666578986889999999999999869786705787


Q ss_pred             C
Q ss_conf             9
Q gi|254780430|r  189 V  189 (189)
Q Consensus       189 v  189 (189)
T Consensus       181 ~  181 (192)
T PRK11190        181 L  181 (192)
T ss_pred             C
T ss_conf             6