HHsearch alignment of GI: 254780430 and MMDB domain: 1pqx_A_

>1pqx_A (A:) Conserved hypothetical protein; ZR18,structure, autostructure,spins,autoassign, northeast structural genomics consortium; NMR {Staphylococcus aureus subsp}
Probab=99.94  E-value=5.3e-28  Score=195.29  Aligned_cols=89  Identities=20%  Similarity=0.310  Sum_probs=83.2

Q ss_pred             CEEECCCCCCHHHHHHHCCCEECCCCCEECCCHHHCCCCHHHHHHHHCCCCEEEEECCCEEEEEEC-CCCCHHHHHHHHH
Q ss_conf             910211488722435417975437886430696670134688987416881079980877998314-6682123489999
Q gi|254780430|r    1 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QYDWEHLRPPVLG   79 (189)
Q Consensus         1 m~I~~e~TPNPn~lKFi~~~~i~~~g~~~f~~~~~a~~spLa~~Lf~i~GV~~Vfi~~nFITVtK~-~~eW~~i~p~I~~   79 (189)
                      |||++|+|||||+|||++++.+.. |...|.+.+++..+|||++||+++||++||++.|||||+|. +++|++|+|+|++
T Consensus         2 ~~I~~e~TPNPn~lKF~~~~~l~~-~~~~~~~~~~a~~spLA~~LF~i~gV~~Vf~~~dFItVtK~~~~dW~~i~p~I~~   80 (91)
T 1pqx_A            2 KIISISETPNHNTMKITLSESREG-MTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEA   80 (91)
T ss_dssp             CCCBCCCCSCSSEEEEECSCCSSC-CCCEEESSSCSSCCHHHHHHHHSTTEEEEEEETTEEEEEECTTSCSTTTHHHHHH
T ss_pred             CEEEECCCCCCCCEEEECCCCCCC-CCCEECCCHHHHCCHHHHHHHCCCCEEEEEEECCEEEEEECCCCCHHHHHHHHHH
T ss_conf             678703698920688815965047-8720217345405999999873678338998598999983799998999999999


Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999740143
Q gi|254780430|r   80 MIMEHFISGDP   90 (189)
Q Consensus        80 ~I~~~l~~g~~   90 (189)
                      +|++||.+|.+
T Consensus        81 ~i~~~l~sg~e   91 (91)
T 1pqx_A           81 VFELEHHHHHH   91 (91)
T ss_dssp             HTCSCCCCCCC
T ss_pred             HHHCCCCCCCC
T ss_conf             97120032469