HHsearch alignment of GI: 254780430 and MMDB domain: 2k1h_A_

>2k1h_A (A:) Uncharacterized protein Ser13; structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Staphylococcus epidermidis atcc 12228}
Probab=99.94  E-value=9.8e-28  Score=193.64  Aligned_cols=89  Identities=21%  Similarity=0.429  Sum_probs=83.5

Q ss_pred             CEEECCCCCCHHHHHHHCCCEECCCCCEECCCHHHCCCCHHHHHHHHCCCCEEEEECCCEEEEEEC-CCCCHHHHHHHHH
Q ss_conf             910211488722435417975437886430696670134688987416881079980877998314-6682123489999
Q gi|254780430|r    1 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QYDWEHLRPPVLG   79 (189)
Q Consensus         1 m~I~~e~TPNPn~lKFi~~~~i~~~g~~~f~~~~~a~~spLa~~Lf~i~GV~~Vfi~~nFITVtK~-~~eW~~i~p~I~~   79 (189)
                      |||++|+|||||+|||++++.+.+.|+..|+ .+++..+|||++||+++||++||++.|||||+|+ +++|++|+|+|++
T Consensus         2 ~~i~~e~TPNPn~lKF~~~~~l~~~~~~~~~-~~~a~~spLa~~LF~i~gV~~Vf~~~dfItVtK~~~~dW~~l~~~I~~   80 (94)
T 2k1h_A            2 EIIAISETPNHNTMKVSLSEPRQDNSFTTYT-AAQEGQPEFINRLFEIEGVKSIFYVLDFISIDKEDNANWNELLPQIEN   80 (94)
T ss_dssp             CCCCCBCCSSSSCEEEECCCCCTTCCCCEEC-CCCTTSCHHHHHHHTSTTEEEEEEETTEEEEEECTTCCHHHHHHHHHH
T ss_pred             CEEEECCCCCCCCEEEECCCEEECCCCEEEC-CCCCCCCHHHHHHHCCCCCCEEEECCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             7797025889577787179716448714506-401014999999876889636997198899985899998999999999


Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999740143
Q gi|254780430|r   80 MIMEHFISGDP   90 (189)
Q Consensus        80 ~I~~~l~~g~~   90 (189)
                      +|++||.+|..
T Consensus        81 ~i~~~l~sg~~   91 (94)
T 2k1h_A           81 TFAKSNLEHHH   91 (94)
T ss_dssp             HHHHHC-----
T ss_pred             HHHHHCCCCCC
T ss_conf             98660530012