HHsearch alignment of GI: 254780430 and MMDB domain: 2z51_A_1-81

>2z51_A (A:1-81) NIFU-like protein 2, chloroplast; CNFU, iron-sulfur cluster biosynthesis, metal transport; 1.35A {Arabidopsis thaliana} PDB: 2jnv_A
Probab=99.88  E-value=6.1e-23  Score=163.72  Aligned_cols=74  Identities=28%  Similarity=0.650  Sum_probs=70.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             268899999999987777875289759996433479999636646666689999999999999978970035539
Q gi|254780430|r  115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV  189 (189)
Q Consensus       115 ~~~~~~i~~~l~~~IrP~l~~dGG~i~~~~~~~g~v~v~~~GaC~~Cpss~~Tl~~gie~~l~~~vpev~~V~~v  189 (189)
                      +++.++|+++|++ |||+|++||||++|+++++|+|||+|+|||+|||||..||+++||.+||+++|+++.|+.|
T Consensus         3 ~~~~~~i~~~le~-IRP~L~~dGGdi~lv~v~~g~V~V~l~GaC~gC~~s~~Tl~~~Ie~~L~~~~p~~~~V~~v   76 (81)
T 2z51_A            3 PLTEENVESVLDE-IRPYLMSDGGNVALHEIDGNVVRVKLQGACGSCPSSTMTMKMGIERRLMEKIPEIVAVEAL   76 (81)
T ss_dssp             CSCHHHHHHHHHH-HHHHHHHTTEEEEEEEEETTEEEEEEEHHHHTCHHHHHHHHHHHHHHHHHHCTTCCEEEEC
T ss_pred             CCCHHHHHHHHHH-HCHHHHHCCCEEEEEEECCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8789999999998-5679885598479998019989999826878994379999999999999998753111001