HHSEARCH alignment of GI: 254780430 and SCOP domain: d1th5a1

Alignment
>d1th5a1 d.52.8.1 (A:154-226) NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId: 4530]}
Probab=99.78  E-value=4.8e-20  Score=143.24  Aligned_cols=68  Identities=22%  Similarity=0.432  Sum_probs=63.0

Q ss_pred             HHHHHHHHHHHHHHHHHH-HCCCCEEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             889999999998777787-5289759996433479999636646666689999999999999978970035539
Q gi|254780430|r  117 VVQRIKEVLDNRVRPAVA-RDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV  189 (189)
Q Consensus       117 ~~~~i~~~l~~~IrP~l~-~dGG~i~~~~~~~g~v~v~~~GaC~~Cpss~~Tl~~gie~~l~~~vpev~~V~~v  189 (189)
                      ..++|+.+|+ +|||+++ +|||||+|+++++|+|+|+|+|||+||+    ||++|||++||+++|||+.|+.|
T Consensus         4 ~ee~V~~vL~-eirP~l~a~dGGdvelv~i~~~~v~v~l~GaC~gC~----Tl~~gIe~~L~~~iPei~~V~~v   72 (73)
T d1th5a1           4 NEENVEKVLN-EIRPYLAGTGGGGLQFLMIKGPIVKVRLTGPAAVVR----TVRIAVSKKLREKIPSIQIVQLL   72 (73)
T ss_dssp             SHHHHHHHHT-TTHHHHTTTTCCCCCCCEEETTEEEECCCSSSSSSS----SHHHHHHHHHHHHCTTCSEEEEC
T ss_pred             CHHHHHHHHH-HHCCCCCCCCCCEEEEEEECCCEEEEEECCCCCCCC----HHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             8999999999-855203206893399999509999999569876510----39999999999978986589945


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Fe-S cluster assembly (FSCA) domain-like
family: NifU C-terminal domain-like
domain: NifU-like protein 1, NIFUL1
species: Rice (Oryza sativa) [TaxId: 4530]