BLAST/PSIBLAST alignment of GI: 254780430 and GI: 150395264 at iteration 1
>gi|150395264|ref|YP_001325731.1| scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419] Length = 188
>gi|150026779|gb|ABR58896.1| Scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419] Length = 188
 Score =  240 bits (612), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPGI  VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEALAGSPLAARLFSIPGITGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG PI+   G  +   +D     F E D A+V 
Sbjct: 61  FITVSKEAQEWQHLKPAILGSIMEHFMSGQPIMSGAGRAEQLDED--EEFFDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVESVESV 188