BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein
[Candidatus Liberibacter asiaticus str. psy62]
         (189 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040107|gb|ACT56903.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 189

 Score =  387 bits (994), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/189 (100%), Positives = 189/189 (100%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF
Sbjct: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR
Sbjct: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV
Sbjct: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180

Query: 181 PEVKDIRTV 189
           PEVKDIRTV
Sbjct: 181 PEVKDIRTV 189


>gi|315122122|ref|YP_004062611.1| nitrogen fixation protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495524|gb|ADR52123.1| nitrogen fixation protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 190

 Score =  323 bits (828), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPGQVVLV G++HFSNAKEA ISPLASRIFSI GI SVY GYDF
Sbjct: 1   MFIQTEYTPNPATLKFIPGQVVLVRGSVHFSNAKEAGISPLASRIFSISGIVSVYLGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL-DDMGSGDFIESDSAVVQ 119
           ITV KD+YDWE L+P +LG+IMEHF+SGDPII NGGL  + + DD+G GDF ESDS +VQ
Sbjct: 61  ITVAKDKYDWEQLKPLILGVIMEHFMSGDPIISNGGLDAVNVNDDLGEGDFSESDSVIVQ 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK+VLDNRVRPAVARDGGDIVFKGYRDGIVFLSM GACSGCPSA+ETLKYGV N+LNHF
Sbjct: 121 KIKDVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMMGACSGCPSATETLKYGVINLLNHF 180

Query: 180 VPEVKDIRTV 189
           VPEVKDIRTV
Sbjct: 181 VPEVKDIRTV 190


>gi|325291785|ref|YP_004277649.1| scaffold protein Nfu/NifU [Agrobacterium sp. H13-3]
 gi|325059638|gb|ADY63329.1| putative scaffold protein Nfu/NifU [Agrobacterium sp. H13-3]
          Length = 187

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 146/190 (76%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G   F N  +A+ SPLA R+F+IPG+  VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLESGTAEFLNPAQAQASPLAERLFTIPGVTGVYFGFDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVVQ 119
           ITV KD  +W+HL+P +LG IMEHF+SG PI+      ++  ++   G+F E+ D  +V 
Sbjct: 61  ITVTKDDAEWQHLKPAILGSIMEHFMSGRPIMGTAIAAEVSDEE---GEFFEAGDETIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G+RDG VFL+M+GACSGCPS++ TLK+GV N+L HF
Sbjct: 118 TIKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCPSSTATLKHGVQNLLRHF 177

Query: 180 VPEVKDIRTV 189
           VPEV+++  V
Sbjct: 178 VPEVREVEAV 187


>gi|222084688|ref|YP_002543217.1| nitrogen fixation protein [Agrobacterium radiobacter K84]
 gi|221722136|gb|ACM25292.1| nitrogen fixation protein [Agrobacterium radiobacter K84]
          Length = 188

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 148/190 (77%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VV+  G   F +A EAE+SPLA+R+F IPG++ VYFGYDF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMESGTAEFRSADEAEVSPLAARLFDIPGVSGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVVQ 119
           I+V KD  +W+HL+P +LG IMEHF+SG P++    +     D   SG+F  E D+ +V 
Sbjct: 61  ISVSKDDQEWQHLKPAILGSIMEHFMSGKPVMGAASVLSEAQD--ASGEFFDEGDATIVL 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G+RDG V+L+M+G+C+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFRDGKVYLNMKGSCAGCPSSTATLKHGIQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+++  V
Sbjct: 179 VPEVQEVEAV 188


>gi|15887702|ref|NP_353383.1| hypothetical protein Atu0351 [Agrobacterium tumefaciens str. C58]
 gi|15155261|gb|AAK86168.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score =  240 bits (612), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 145/189 (76%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G + F NA +A+ SPLA R+F+IPG+  VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLESGTVEFLNASQAQASPLAERLFTIPGVTGVYFGFDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD  +W+HL+P +LG IMEHF+SG PI+  G     ++ D     F E D  +V  
Sbjct: 61  ITVTKDDAEWQHLKPAILGSIMEHFMSGRPIM--GTAIAAEVSDEEGEFFEEGDETIVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD RVRPAVA+DGGDI F+G+RDG VFL+M+GACSGCPS++ TLK+GV N+L HFV
Sbjct: 119 IKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCPSSTATLKHGVQNLLRHFV 178

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 179 PEVREVEAV 187


>gi|227820624|ref|YP_002824594.1| putative scaffold protein Nfu/NifU [Sinorhizobium fredii NGR234]
 gi|227339623|gb|ACP23841.1| putative scaffold protein Nfu/NifU [Sinorhizobium fredii NGR234]
          Length = 188

 Score =  240 bits (612), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPG++ VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEARTGSPLAARLFSIPGVSGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P VLG IMEHF+SG PI+   G    +  D     + E D A+V 
Sbjct: 61  FITVSKEGQEWQHLKPAVLGSIMEHFMSGQPIM--SGASRAEETDQEGEFYDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVESVESV 188


>gi|150395264|ref|YP_001325731.1| scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419]
 gi|150026779|gb|ABR58896.1| Scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419]
          Length = 188

 Score =  240 bits (612), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPGI  VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEALAGSPLAARLFSIPGITGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG PI+   G  +   +D     F E D A+V 
Sbjct: 61  FITVSKEAQEWQHLKPAILGSIMEHFMSGQPIMSGAGRAEQLDED--EEFFDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVESVESV 188


>gi|86356038|ref|YP_467930.1| nitrogen fixation protein [Rhizobium etli CFN 42]
 gi|86280140|gb|ABC89203.1| nitrogen fixation protein [Rhizobium etli CFN 42]
          Length = 188

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/188 (57%), Positives = 148/188 (78%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFDIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  +W+HL+P +LG IMEHF+SG P++   G   +  +D+ +GD  F E D ++V
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDVDAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|15964154|ref|NP_384507.1| hypothetical protein SMc01119 [Sinorhizobium meliloti 1021]
 gi|307301299|ref|ZP_07581061.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti BL225C]
 gi|307317970|ref|ZP_07597407.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti AK83]
 gi|15073330|emb|CAC41838.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896372|gb|EFN27121.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti AK83]
 gi|306903755|gb|EFN34342.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti BL225C]
          Length = 188

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPG+  VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEALAGSPLAARLFSIPGVTGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG PI+   G G  +  D     F E D A+V 
Sbjct: 61  FITVSKEAQEWQHLKPAILGSIMEHFMSGQPIM--SGAGRAEQTDEEDEFFDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVEAVESV 188


>gi|190890051|ref|YP_001976593.1| nitrogen fixation protein [Rhizobium etli CIAT 652]
 gi|218509253|ref|ZP_03507131.1| nitrogen fixation protein [Rhizobium etli Brasil 5]
 gi|190695330|gb|ACE89415.1| nitrogen fixation protein [Rhizobium etli CIAT 652]
          Length = 188

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/188 (57%), Positives = 146/188 (77%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAAEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  +W+HL+P +LG IMEHF+SG P++   G   +  +D  +GD  F E D ++V
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDADAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|209547636|ref|YP_002279553.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533392|gb|ACI53327.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 188

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 148/188 (78%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  +W+HL+P +LG IMEHF+SG P++   G   +  +D+ +GD  F E D ++V
Sbjct: 61  ISVSKDDAEWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDVDAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|218678782|ref|ZP_03526679.1| nitrogen fixation protein [Rhizobium etli CIAT 894]
          Length = 188

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 147/188 (78%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  +W+HL+P +LG IMEHF+SG P++   G   +  +D  +GD  F E D ++V
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDADAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|218461569|ref|ZP_03501660.1| Scaffold protein Nfu/NifU [Rhizobium etli Kim 5]
          Length = 188

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 147/188 (78%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EA+ SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAQASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  +W+HL+P +LG IMEHF+SG P++   G   +  +D  +GD  F E D ++V
Sbjct: 61  ISVSKDDAEWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDADAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|254470949|ref|ZP_05084352.1| nitrogen fixation protein [Pseudovibrio sp. JE062]
 gi|211960091|gb|EEA95288.1| nitrogen fixation protein [Pseudovibrio sp. JE062]
          Length = 186

 Score =  237 bits (605), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 146/189 (77%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +A+EA ISPLA ++FSIPG+  ++FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTRDFRSAEEAAISPLAEKLFSIPGVVGIFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD+ DW+H+RP +LG IME+F++  PI+     GD    D+G   F   D   V  
Sbjct: 61  ITVTKDETDWQHMRPAILGAIMENFMANTPILKGEETGD---GDIGEEFFDAEDEETVTM 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+GYR+GIV+LSMRGAC+GCPS++ TL +G+ N++ HF+
Sbjct: 118 IKELLETRVRPAVAQDGGDITFRGYREGIVYLSMRGACAGCPSSTATLSHGIQNLMRHFI 177

Query: 181 PEVKDIRTV 189
           PEV+++R +
Sbjct: 178 PEVQEVRQM 186


>gi|307942729|ref|ZP_07658074.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Roseibium
           sp. TrichSKD4]
 gi|307773525|gb|EFO32741.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Roseibium
           sp. TrichSKD4]
          Length = 186

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 148/191 (77%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G   F++  EA  SPLA ++F +PG+A+++FGYDF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLETGTYDFTSPTEAGASPLAEKLFQVPGVAAIFFGYDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVV 118
           ITV K +  DW+H++P +LG IME F+SG P++ +G     + +D   G+F E +D   V
Sbjct: 61  ITVTKKEDTDWQHMKPAILGAIMEQFMSGQPVMASG-----QAEDTEEGEFFEEADQETV 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++LD RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L H
Sbjct: 116 TVIKDLLDTRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLKH 175

Query: 179 FVPEVKDIRTV 189
           FVPEV+++R +
Sbjct: 176 FVPEVQEVRPI 186


>gi|222147346|ref|YP_002548303.1| hypothetical protein Avi_0430 [Agrobacterium vitis S4]
 gi|221734336|gb|ACM35299.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 186

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/189 (56%), Positives = 143/189 (75%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VV+  G   F + + A  SPLA ++F+IPG+ SV+FGYDF
Sbjct: 1   MFIQTESTPNPATLKFLPGKVVMDNGTAEFRDREAAMASPLAEKLFAIPGVTSVFFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  +W HL+P +LG IMEHF+SG PI+ +   GD   D+     F E D  +V  
Sbjct: 61  VTVTKDTAEWPHLKPAILGSIMEHFMSGAPIMGSAVAGDEASDEEF---FNEGDETIVAT 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G+RDG VFL+M+G+C+GCPS++ TLK+GV N+L HF+
Sbjct: 118 IKELLETRVRPAVAQDGGDITFRGFRDGKVFLNMKGSCAGCPSSTATLKHGVQNLLRHFI 177

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 178 PEVQEVEAV 186


>gi|118590483|ref|ZP_01547885.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614]
 gi|118436946|gb|EAV43585.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614]
          Length = 185

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 150/190 (78%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +  +A +SPLA ++F +PG+ +V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTYDFRSKADAGVSPLAQKLFDVPGVVAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVVQ 119
           +TV KD+ DW+H++P +LG+IME F+SG P++        + +++  G+F E+ D+  V 
Sbjct: 61  VTVTKDETDWQHMKPAILGVIMEQFMSGQPVMATS-----EAENIEEGEFFEAGDADTVS 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 116 TIKELLETRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLRHF 175

Query: 180 VPEVKDIRTV 189
           VPEV+++R +
Sbjct: 176 VPEVEEVRPI 185


>gi|110636361|ref|YP_676569.1| nitrogen-fixing NifU-like [Mesorhizobium sp. BNC1]
 gi|110287345|gb|ABG65404.1| nitrogen-fixing NifU-like protein [Chelativorans sp. BNC1]
          Length = 189

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/191 (56%), Positives = 144/191 (75%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG   F +A  A+ +SPLA+R+F +PG+  V+FG+D
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLEEGTADFRSADSAQAVSPLAARLFEVPGVTGVFFGFD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVV 118
           FITV KD  DW+HL+P +LG IMEHF+SG P++      D    +  S +F  E+D  +V
Sbjct: 61  FITVTKDGADWQHLKPAILGTIMEHFMSGQPVM---AANDGSERETASSEFYDEADEEIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+GY +G VFL M+GAC+GCPS++ TLK+G+ N+L+H
Sbjct: 118 TTIKELLETRVRPAVAQDGGDITFRGYENGTVFLHMKGACAGCPSSTATLKHGIQNLLHH 177

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 178 FVPEVQQVEQV 188


>gi|241202790|ref|YP_002973886.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856680|gb|ACS54347.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 188

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 145/188 (77%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F + +EA+ SPLA+R+F I G+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARLFEISGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVV 118
           I+V KD  DW+HL+P +LG IMEHF+SG P++   G   +  +D  +GD  F E D ++V
Sbjct: 61  ISVSKDNADWQHLKPAILGSIMEHFMSGKPVM---GDASILSEDADAGDEFFDEGDESIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L H
Sbjct: 118 LTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRH 177

Query: 179 FVPEVKDI 186
           FVPEV+++
Sbjct: 178 FVPEVQEV 185


>gi|49476032|ref|YP_034073.1| hypothetical protein BH13490 [Bartonella henselae str. Houston-1]
 gi|49238840|emb|CAF28122.1| hypothetical protein BH13490 [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  231 bits (590), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 142/184 (77%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG VVL EG + F +++EA + SPLA+++F+IP +  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGCVVLSEGVLEFRDSEEAAKNSPLAAKLFNIPNVNGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+SGDP+I+       +   +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPAILGTIMEHFLSGDPVINTNATRQAQTHALNEEFYNEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|319779939|ref|YP_004139415.1| Scaffold protein Nfu/NifU [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165827|gb|ADV09365.1| Scaffold protein Nfu/NifU [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 189

 Score =  231 bits (588), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 142/191 (74%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VLVEG   F +A  A + SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLVEGTADFRDADSAAVASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVV 118
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G      +   +G+F + +D  +V
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPA---AETSQTGEFYDKADEELV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L H
Sbjct: 118 ITIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRH 177

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 178 FVPEVQQVEQV 188


>gi|328545933|ref|YP_004306042.1| nitrogen-fixing NifU-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415673|gb|ADZ72736.1| Nitrogen-fixing NifU-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 185

 Score =  230 bits (587), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 146/190 (76%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G   F ++ EA  SPLA ++F++PG+ +V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLADGTYDFRSSDEAGASPLAEKLFAVPGVVAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVVQ 119
           ITV KD  DW+H++P +LG IME F+SG P++ +       +   G  +F +S D   V 
Sbjct: 61  ITVTKDDTDWQHMKPAILGAIMEQFMSGTPVMRSAA-----VQAGGEDEFFDSDDEETVT 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++L+ RVRPAVA+DGGDI FKG+++G+V+LSMRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 116 VIKDLLETRVRPAVAQDGGDITFKGFKEGVVYLSMRGACAGCPSSTATLQHGIQNLLRHF 175

Query: 180 VPEVKDIRTV 189
           VPEV+++R +
Sbjct: 176 VPEVEEVRAI 185


>gi|260462744|ref|ZP_05810949.1| Scaffold protein Nfu/NifU [Mesorhizobium opportunistum WSM2075]
 gi|259031388|gb|EEW32659.1| Scaffold protein Nfu/NifU [Mesorhizobium opportunistum WSM2075]
          Length = 189

 Score =  230 bits (586), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 108/191 (56%), Positives = 142/191 (74%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL+EG   F +A  A + SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAAVASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVV 118
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G      +   +G+F + +D  +V
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPA---AETSQTGEFYDKADEELV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L H
Sbjct: 118 ITIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRH 177

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 178 FVPEVQQVEQV 188


>gi|13474434|ref|NP_106002.1| hypothetical protein mll5315 [Mesorhizobium loti MAFF303099]
 gi|14025187|dbj|BAB51788.1| mll5315 [Mesorhizobium loti MAFF303099]
          Length = 189

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/191 (56%), Positives = 141/191 (73%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL+EG   F +A  A   SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAATASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVV 118
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G      +   +G+F + +D  +V
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKSGPA---AETSQTGEFYDKADEELV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L H
Sbjct: 118 ITIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRH 177

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 178 FVPEVQQVEQV 188


>gi|319409218|emb|CBI82862.1| NifU-related protein [Bartonella schoenbuchensis R1]
          Length = 196

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 140/184 (76%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G + F N+KEA + SPLA+++F+IP ++SV  G+D
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLAKGVLEFHNSKEADQNSPLAAKLFTIPNVSSVLLGHD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FI V K+  +W+HL+P +LG IMEHF+S DP + N      +  +     + E D+ +V 
Sbjct: 61  FIAVTKNDGEWQHLKPAILGTIMEHFLSNDPTVINDATLQTQAPEAYEEFYDEKDADIVM 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F+G+ DGIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKEILETRVRPAVANDGGDITFRGFEDGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|153007498|ref|YP_001368713.1| scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188]
 gi|151559386|gb|ABS12884.1| Scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188]
          Length = 190

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +A  A   SPLA+++FS+PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDASTAGNTSPLAAKLFSVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+  V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNSNADAAAAHGEEEFFDEADAETVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL+M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 IIKELIETRVRPAVAQDGGDITFRGFENGTVFLNMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|239830990|ref|ZP_04679319.1| Scaffold protein Nfu/NifU [Ochrobactrum intermedium LMG 3301]
 gi|239823257|gb|EEQ94825.1| Scaffold protein Nfu/NifU [Ochrobactrum intermedium LMG 3301]
          Length = 211

 Score =  227 bits (578), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 139/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   A   SPLA+++FS+PG+  V+FGYD
Sbjct: 22  MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPSTAGNTSPLAAKLFSVPGVTGVFFGYD 81

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  +W+HL+P +LG IMEHF+SG P +      D          F E+D+  V+
Sbjct: 82  FITVTKDDGEWQHLKPAILGTIMEHFMSGAPAMAGNSNADAAAAHGDEEFFDEADAETVE 141

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL+M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 142 IIKELIETRVRPAVAQDGGDITFRGFENGTVFLNMKGACSGCPSSTATLKHGIQNLLRHF 201

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 202 VPEVQQVEQI 211


>gi|254503238|ref|ZP_05115389.1| Scaffold protein Nfu/NifU N terminal domain protein [Labrenzia
           alexandrii DFL-11]
 gi|222439309|gb|EEE45988.1| Scaffold protein Nfu/NifU N terminal domain protein [Labrenzia
           alexandrii DFL-11]
          Length = 185

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 146/189 (77%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +  +A  SPLA ++F +PG+A+V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTYDFRSKADAGASPLAEKLFDVPGVAAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+H++P +LG+IME F+SG P+++ G   D++  +       E+    V  
Sbjct: 61  VTVTKDDTDWQHMKPAILGVIMEQFMSGQPVMNAGESEDIEEGEFFEEGDQET----VAT 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 117 IKELLETRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLRHFV 176

Query: 181 PEVKDIRTV 189
           PEV+++R +
Sbjct: 177 PEVEEVRPI 185


>gi|116250169|ref|YP_766007.1| nifU iron-sulphur cluster scaffold protein [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254817|emb|CAK05891.1| putative nifU iron-sulphur cluster scaffold protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 188

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 141/186 (75%), Gaps = 1/186 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F + +EA+ SPLA+R+F I G+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARLFEISGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  DW+HL+P +LG IMEHF+SG P++ +  +     D      F E D ++V  
Sbjct: 61  ISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADAD-DEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDI 186
           PEV+++
Sbjct: 180 PEVQEV 185


>gi|148251664|ref|YP_001236249.1| putative nifU protein [Bradyrhizobium sp. BTAi1]
 gi|146403837|gb|ABQ32343.1| putative nifU protein [Bradyrhizobium sp. BTAi1]
          Length = 189

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 143/187 (76%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + FS+ + A  SPLA R+F+I G+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVLPSGTMEFSSREAAARSPLAERLFAIGGVTGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K+  +W+HL+P +LG IMEH++SG P++ +G   +    D     + E+D+  V  
Sbjct: 61  ITVTKNDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDDATDEDDEFYDEADTETVGM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIR 187
           PEV ++R
Sbjct: 181 PEVVEVR 187


>gi|240850980|ref|YP_002972380.1| nitrogen fixation protein [Bartonella grahamii as4aup]
 gi|240268103|gb|ACS51691.1| nitrogen fixation protein [Bartonella grahamii as4aup]
          Length = 192

 Score =  224 bits (571), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 139/184 (75%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG + F + +EA + SPLA+++F+IP I  V+ GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSEGVLEFRDPEEAAKNSPLAAKLFNIPNINGVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+S +P+I        +   +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPVILGTIMEHFLSNEPVITTNATIQAQTHALNEEFYDEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|225626680|ref|ZP_03784719.1| NifU-related protein [Brucella ceti str. Cudo]
 gi|254707168|ref|ZP_05168996.1| NifU-related protein [Brucella pinnipedialis M163/99/10]
 gi|254709289|ref|ZP_05171100.1| NifU-related protein [Brucella pinnipedialis B2/94]
 gi|254713288|ref|ZP_05175099.1| NifU-related protein [Brucella ceti M644/93/1]
 gi|254716359|ref|ZP_05178170.1| NifU-related protein [Brucella ceti M13/05/1]
 gi|256030812|ref|ZP_05444426.1| NifU-related protein [Brucella pinnipedialis M292/94/1]
 gi|256158837|ref|ZP_05456694.1| NifU-related protein [Brucella ceti M490/95/1]
 gi|256254218|ref|ZP_05459754.1| NifU-related protein [Brucella ceti B1/94]
 gi|260169716|ref|ZP_05756527.1| NifU-related protein [Brucella sp. F5/99]
 gi|261218142|ref|ZP_05932423.1| scaffold protein Nfu/NifU [Brucella ceti M13/05/1]
 gi|261221368|ref|ZP_05935649.1| scaffold protein Nfu/NifU [Brucella ceti B1/94]
 gi|261314644|ref|ZP_05953841.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M163/99/10]
 gi|261316798|ref|ZP_05955995.1| scaffold protein Nfu/NifU [Brucella pinnipedialis B2/94]
 gi|261321011|ref|ZP_05960208.1| scaffold protein Nfu/NifU [Brucella ceti M644/93/1]
 gi|261759255|ref|ZP_06002964.1| nitrogen-fixing NifU [Brucella sp. F5/99]
 gi|265987868|ref|ZP_06100425.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M292/94/1]
 gi|265997328|ref|ZP_06109885.1| scaffold protein Nfu/NifU [Brucella ceti M490/95/1]
 gi|225618337|gb|EEH15380.1| NifU-related protein [Brucella ceti str. Cudo]
 gi|260919952|gb|EEX86605.1| scaffold protein Nfu/NifU [Brucella ceti B1/94]
 gi|260923231|gb|EEX89799.1| scaffold protein Nfu/NifU [Brucella ceti M13/05/1]
 gi|261293701|gb|EEX97197.1| scaffold protein Nfu/NifU [Brucella ceti M644/93/1]
 gi|261296021|gb|EEX99517.1| scaffold protein Nfu/NifU [Brucella pinnipedialis B2/94]
 gi|261303670|gb|EEY07167.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M163/99/10]
 gi|261739239|gb|EEY27235.1| nitrogen-fixing NifU [Brucella sp. F5/99]
 gi|262551796|gb|EEZ07786.1| scaffold protein Nfu/NifU [Brucella ceti M490/95/1]
 gi|264660065|gb|EEZ30326.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M292/94/1]
          Length = 190

 Score =  224 bits (571), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE  SPLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHSEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|115522240|ref|YP_779151.1| NifU domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115516187|gb|ABJ04171.1| nitrogen-fixing NifU domain protein [Rhodopseudomonas palustris
           BisA53]
          Length = 188

 Score =  224 bits (570), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 145/192 (75%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G + FS+   A  SPLA R+F +PG+  V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFLPGRAVLDSGTMEFSDRAAAARSPLAERLFEVPGVTGVFYGLDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG--DMKLDDMGSGDFIE-SDSAV 117
           ++V KD  DW+HL+P +LG IMEHF+SG+P++ +G +   D   DD    +F E +D+  
Sbjct: 61  VSVTKDDGDWQHLKPAILGAIMEHFMSGEPLMADGRVDGEDASEDD----EFFEKADTET 116

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IK++++ RVRPAVA DGGDI+F+G++DGIV+L MRGACSGCPS++ TL++G+ N+L 
Sbjct: 117 VVIIKDLIETRVRPAVANDGGDIIFRGFKDGIVYLHMRGACSGCPSSTATLQHGIQNLLK 176

Query: 178 HFVPEVKDIRTV 189
           HFVPEV ++R +
Sbjct: 177 HFVPEVVEVRPI 188


>gi|163868796|ref|YP_001610020.1| NifU-related protein [Bartonella tribocorum CIP 105476]
 gi|161018467|emb|CAK02025.1| NifU-related protein [Bartonella tribocorum CIP 105476]
          Length = 192

 Score =  224 bits (570), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 138/184 (75%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG + F + +EA + SPLA+++F+IP +  V+ GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSEGVLEFRDREEAAKNSPLAAKLFNIPNVNGVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+S +P+I            +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPVILGTIMEHFLSNEPVITTNATTQAHAHALNEEFYDEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|17988091|ref|NP_540725.1| NifU protein [Brucella melitensis bv. 1 str. 16M]
 gi|256045931|ref|ZP_05448803.1| NifU protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563213|ref|ZP_05833699.1| nitrogen-fixing NifU [Brucella melitensis bv. 1 str. 16M]
 gi|265992342|ref|ZP_06104899.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 1 str. Rev.1]
 gi|17983843|gb|AAL52989.1| nifu protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153229|gb|EEW88321.1| nitrogen-fixing NifU [Brucella melitensis bv. 1 str. 16M]
 gi|263003408|gb|EEZ15701.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 1 str. Rev.1]
          Length = 190

 Score =  224 bits (570), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE  SPLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+GV N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGVQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|163842411|ref|YP_001626815.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445]
 gi|163673134|gb|ABY37245.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445]
          Length = 190

 Score =  223 bits (569), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE  SPLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPPSAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEHGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|90421987|ref|YP_530357.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18]
 gi|90104001|gb|ABD86038.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18]
          Length = 188

 Score =  223 bits (569), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 144/190 (75%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++   A  SPLA RIF +PG+  V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFNDRATAARSPLAERIFEVPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL-GDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD  DW+HL+P +LG IMEH++SG+P++ +G + GD   +D     F ++D+  V 
Sbjct: 61  VTVTKDDSDWQHLKPSILGAIMEHYMSGEPLMADGRVDGDEPSED--DEFFDKADAETVD 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++ RVRPAVA DGGDI F+G++DGIV+L M+GACSGCPS++ TL++G+ N+L HF
Sbjct: 119 MIKDLIETRVRPAVANDGGDITFRGFKDGIVYLKMQGACSGCPSSTATLQHGIQNLLKHF 178

Query: 180 VPEVKDIRTV 189
           VP V ++R +
Sbjct: 179 VPAVVEVRPI 188


>gi|114706882|ref|ZP_01439782.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506]
 gi|114537830|gb|EAU40954.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506]
          Length = 187

 Score =  223 bits (568), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/188 (54%), Positives = 140/188 (74%), Gaps = 4/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G   F++  EA + SPLA+R+F + G+  V+FG+D
Sbjct: 1   MFIQTEVTPNPATLKFLPGRVVLEQGTEEFTSIDEAAQRSPLAARLFEVDGVTGVFFGFD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F+TV KDQ DW HL+P +L  +MEHF++  P++      +    + G   F E D   V 
Sbjct: 61  FVTVTKDQGDWAHLKPAILAGLMEHFVANRPVMAETSAMN---SEPGEEFFDEGDKETVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+GYRDGIV+L+MRGACSGCPS++ TLK+G+ N+L HF
Sbjct: 118 TIKELIETRVRPAVAQDGGDITFRGYRDGIVYLNMRGACSGCPSSTATLKHGIQNLLRHF 177

Query: 180 VPEVKDIR 187
           VPEV+++ 
Sbjct: 178 VPEVEEVE 185


>gi|23501052|ref|NP_697179.1| NifU-like protein [Brucella suis 1330]
 gi|62289118|ref|YP_220911.1| NifU-like protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699057|ref|YP_413631.1| nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar
           Abortus 2308]
 gi|148560296|ref|YP_001258173.1| NifU-like protein [Brucella ovis ATCC 25840]
 gi|161618129|ref|YP_001592016.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365]
 gi|189023393|ref|YP_001934161.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19]
 gi|225851675|ref|YP_002731908.1| NifU-related protein [Brucella melitensis ATCC 23457]
 gi|237814609|ref|ZP_04593607.1| NifU-related protein [Brucella abortus str. 2308 A]
 gi|254690444|ref|ZP_05153698.1| NifU-related protein [Brucella abortus bv. 6 str. 870]
 gi|254694934|ref|ZP_05156762.1| NifU-related protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696564|ref|ZP_05158392.1| NifU-related protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700949|ref|ZP_05162777.1| NifU-related protein [Brucella suis bv. 5 str. 513]
 gi|254705318|ref|ZP_05167146.1| NifU-related protein [Brucella suis bv. 3 str. 686]
 gi|254718357|ref|ZP_05180168.1| NifU-related protein [Brucella sp. 83/13]
 gi|254731477|ref|ZP_05190055.1| NifU-related protein [Brucella abortus bv. 4 str. 292]
 gi|256060282|ref|ZP_05450455.1| NifU-related protein [Brucella neotomae 5K33]
 gi|256112644|ref|ZP_05453565.1| NifU-related protein [Brucella melitensis bv. 3 str. Ether]
 gi|256258700|ref|ZP_05464236.1| NifU-related protein [Brucella abortus bv. 9 str. C68]
 gi|256264815|ref|ZP_05467347.1| nitrogen-fixing NifU [Brucella melitensis bv. 2 str. 63/9]
 gi|256368604|ref|YP_003106110.1| NifU-related protein [Brucella microti CCM 4915]
 gi|260546415|ref|ZP_05822155.1| nitrogen-fixing NifU [Brucella abortus NCTC 8038]
 gi|260567221|ref|ZP_05837691.1| nitrogen-fixing NifU [Brucella suis bv. 4 str. 40]
 gi|260755996|ref|ZP_05868344.1| scaffold protein Nfu/NifU [Brucella abortus bv. 6 str. 870]
 gi|260759220|ref|ZP_05871568.1| scaffold protein Nfu/NifU [Brucella abortus bv. 4 str. 292]
 gi|260760942|ref|ZP_05873285.1| scaffold protein Nfu/NifU [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885016|ref|ZP_05896630.1| scaffold protein Nfu/NifU [Brucella abortus bv. 9 str. C68]
 gi|261215272|ref|ZP_05929553.1| scaffold protein Nfu/NifU [Brucella abortus bv. 3 str. Tulya]
 gi|261324254|ref|ZP_05963451.1| scaffold protein Nfu/NifU [Brucella neotomae 5K33]
 gi|261751468|ref|ZP_05995177.1| scaffold protein Nfu/NifU [Brucella suis bv. 5 str. 513]
 gi|261756030|ref|ZP_05999739.1| scaffold protein Nfu/NifU [Brucella suis bv. 3 str. 686]
 gi|265983318|ref|ZP_06096053.1| scaffold protein Nfu/NifU [Brucella sp. 83/13]
 gi|265994085|ref|ZP_06106642.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 3 str. Ether]
 gi|297247534|ref|ZP_06931252.1| thioredoxin-like protein [Brucella abortus bv. 5 str. B3196]
 gi|306839588|ref|ZP_07472392.1| NifU-related protein [Brucella sp. NF 2653]
 gi|306842572|ref|ZP_07475223.1| NifU-related protein [Brucella sp. BO2]
 gi|306844409|ref|ZP_07476999.1| NifU-related protein [Brucella sp. BO1]
 gi|23346918|gb|AAN29094.1| NifU-related protein [Brucella suis 1330]
 gi|62195250|gb|AAX73550.1| NifU-related protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615158|emb|CAJ10095.1| Nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar
           Abortus 2308]
 gi|148371553|gb|ABQ61532.1| NifU-related protein [Brucella ovis ATCC 25840]
 gi|161334940|gb|ABX61245.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365]
 gi|189018965|gb|ACD71687.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19]
 gi|225640040|gb|ACN99953.1| NifU-related protein [Brucella melitensis ATCC 23457]
 gi|237789446|gb|EEP63656.1| NifU-related protein [Brucella abortus str. 2308 A]
 gi|255998762|gb|ACU47161.1| NifU-related protein [Brucella microti CCM 4915]
 gi|260096522|gb|EEW80398.1| nitrogen-fixing NifU [Brucella abortus NCTC 8038]
 gi|260156739|gb|EEW91819.1| nitrogen-fixing NifU [Brucella suis bv. 4 str. 40]
 gi|260669538|gb|EEX56478.1| scaffold protein Nfu/NifU [Brucella abortus bv. 4 str. 292]
 gi|260671374|gb|EEX58195.1| scaffold protein Nfu/NifU [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676104|gb|EEX62925.1| scaffold protein Nfu/NifU [Brucella abortus bv. 6 str. 870]
 gi|260874544|gb|EEX81613.1| scaffold protein Nfu/NifU [Brucella abortus bv. 9 str. C68]
 gi|260916879|gb|EEX83740.1| scaffold protein Nfu/NifU [Brucella abortus bv. 3 str. Tulya]
 gi|261300234|gb|EEY03731.1| scaffold protein Nfu/NifU [Brucella neotomae 5K33]
 gi|261741221|gb|EEY29147.1| scaffold protein Nfu/NifU [Brucella suis bv. 5 str. 513]
 gi|261745783|gb|EEY33709.1| scaffold protein Nfu/NifU [Brucella suis bv. 3 str. 686]
 gi|262765066|gb|EEZ10987.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 3 str. Ether]
 gi|263095225|gb|EEZ18894.1| nitrogen-fixing NifU [Brucella melitensis bv. 2 str. 63/9]
 gi|264661910|gb|EEZ32171.1| scaffold protein Nfu/NifU [Brucella sp. 83/13]
 gi|297174703|gb|EFH34050.1| thioredoxin-like protein [Brucella abortus bv. 5 str. B3196]
 gi|306275222|gb|EFM56972.1| NifU-related protein [Brucella sp. BO1]
 gi|306287428|gb|EFM58908.1| NifU-related protein [Brucella sp. BO2]
 gi|306405286|gb|EFM61561.1| NifU-related protein [Brucella sp. NF 2653]
 gi|326408161|gb|ADZ65226.1| Nitrogen-fixing NifU, C-terminal protein [Brucella melitensis M28]
 gi|326537871|gb|ADZ86086.1| NifU-related protein [Brucella melitensis M5-90]
          Length = 190

 Score =  223 bits (568), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE  SPLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|146337209|ref|YP_001202257.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp.
           ORS278]
 gi|146190015|emb|CAL74007.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp.
           ORS278]
          Length = 189

 Score =  223 bits (567), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 141/187 (75%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++   A  SPLA R+F++ G+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVLPAGTMEFASRDAAARSPLAERLFAVDGVTGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K   +W+HL+P +LG IMEH++SG P++ +G   +    D     F E+D+  V  
Sbjct: 61  ITVTKSDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDASADEDDEFFDEADTETVGM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIR 187
           PEV ++R
Sbjct: 181 PEVVEVR 187


>gi|298293916|ref|YP_003695855.1| Scaffold protein Nfu/NifU [Starkeya novella DSM 506]
 gi|296930427|gb|ADH91236.1| Scaffold protein Nfu/NifU [Starkeya novella DSM 506]
          Length = 184

 Score =  222 bits (565), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 138/192 (71%), Gaps = 11/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G     +A EA  SPLA+R+F +PG+  V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRTVLGHGTFEARDADEASRSPLAARLFEVPGVTGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD---FIESDSAV 117
           +TV K++ +W HL+P +LG IMEHF+SG P++          D     D   F E D+ V
Sbjct: 61  VTVTKEKGEWAHLKPAILGAIMEHFVSGQPVLPE--------DHAHVADDAFFEEKDAGV 112

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  I+E++D RVRPAVA DGGDI F+GY+DG+VFL+M+G+CSGCPS++ TLK G+ N+L 
Sbjct: 113 VDTIRELIDTRVRPAVANDGGDITFRGYKDGVVFLAMKGSCSGCPSSTATLKNGIENLLR 172

Query: 178 HFVPEVKDIRTV 189
           HFVP+V ++R V
Sbjct: 173 HFVPDVVEVRPV 184


>gi|294851540|ref|ZP_06792213.1| thioredoxin-like protein [Brucella sp. NVSL 07-0026]
 gi|294820129|gb|EFG37128.1| thioredoxin-like protein [Brucella sp. NVSL 07-0026]
          Length = 190

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 139/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE  SPLA+++F +PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFVVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|319898609|ref|YP_004158702.1| NifU-related protein [Bartonella clarridgeiae 73]
 gi|319402573|emb|CBI76118.1| NifU-related protein [Bartonella clarridgeiae 73]
          Length = 196

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 138/184 (75%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG +VL +G + F N +EA + SPLA+++F+IP + SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGCIVLPQGVLEFYNREEAAKNSPLAAKLFNIPNVKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I    +   +   +    F E D+ +V 
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEHFLSNDPVITTNVITQTEAHMLDKEFFDEKDADIVV 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 VIKELLETRIRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|154245767|ref|YP_001416725.1| scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2]
 gi|154159852|gb|ABS67068.1| Scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2]
          Length = 186

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 144/190 (75%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL EG +   +  +A++SPLA R+F + G+A+V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGRSVLGEGTLDLRSHDDADLSPLAQRLFDVRGVAAVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVVQ 119
           +TV K + +W  ++P +LG IMEHF+SG P++ +G    +K +   + +F E+ D+ +V 
Sbjct: 61  VTVTKAEAEWPQIKPAILGAIMEHFMSGAPVLSDG----VKPEVADADEFYEAKDAEIVA 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA DGGDI F+G++DGIVFL+M+G+CSGCPS++ TLK G+ N+L HF
Sbjct: 117 TIKELLDTRVRPAVANDGGDITFRGFKDGIVFLNMKGSCSGCPSSTATLKNGIENLLKHF 176

Query: 180 VPEVKDIRTV 189
           VPEV +++ V
Sbjct: 177 VPEVTEVQAV 186


>gi|220924300|ref|YP_002499602.1| Scaffold protein Nfu/NifU [Methylobacterium nodulans ORS 2060]
 gi|219948907|gb|ACL59299.1| Scaffold protein Nfu/NifU [Methylobacterium nodulans ORS 2060]
          Length = 187

 Score =  221 bits (562), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 101/191 (52%), Positives = 140/191 (73%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+VVL EG     +  +A  SPLA  +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPTTLKFLPGRVVLTEGTFEARSPDQAARSPLAQALFAVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF+SG P++  G  G+   ++     F E+D+  V
Sbjct: 61  ISVTKAEDGPEWPQVKPAVLGAIMEHFLSGAPVLEAGAAGEGTSEEF----FEEADADTV 116

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYR+G+V+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 117 ATIKDLLETRVRPAVAGDGGDITFRGYREGVVYLEMKGACSGCPSSTATLRQGVQNLFRH 176

Query: 179 FVPEVKDIRTV 189
           F+PEV+++++V
Sbjct: 177 FLPEVREVQSV 187


>gi|163757734|ref|ZP_02164823.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43]
 gi|162285236|gb|EDQ35518.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43]
          Length = 187

 Score =  221 bits (562), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 139/190 (73%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F +A+EA   S LA ++F IPG+  V++GYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKVVMQSGTADFRDAEEAGATSQLAGKLFGIPGVIGVFYGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ KD  DW+HL+P +LG IMEHF+SG P++        + ++         D  +V 
Sbjct: 61  FITITKDDADWQHLKPAILGTIMEHFMSGAPVMSGPVGEVPEGEEEFF---ESGDETIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L++RVRPAVA+DGGDI F+G+RDG VFL M+GAC+GCPS++ TLK+G+ N+L HF
Sbjct: 118 TIKELLESRVRPAVAQDGGDITFRGFRDGKVFLHMKGACAGCPSSTATLKHGIQNLLRHF 177

Query: 180 VPEVKDIRTV 189
           VPEV+++  V
Sbjct: 178 VPEVREVEAV 187


>gi|299133388|ref|ZP_07026583.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
 gi|298593525|gb|EFI53725.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
          Length = 187

 Score =  220 bits (561), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 138/187 (73%), Gaps = 2/187 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G + F++   A  SPLA ++F IPG+  V++G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGRTVLDSGTMEFTSRDSAARSPLAVKLFEIPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+HL+P +LG IMEH++SG PI+ +G   D          F E+D+  V  
Sbjct: 61  VTVTKDDGDWQHLKPAILGTIMEHYMSGGPILADGAQPDAG--PHAEEFFNEADAETVGI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++L+ RVRPAVA DGGDI F+G++DGIVFL M+G+CSGCPS++ TLK+G+ N+L H+V
Sbjct: 119 IKDILETRVRPAVASDGGDITFRGFKDGIVFLDMKGSCSGCPSSTATLKHGIQNLLKHYV 178

Query: 181 PEVKDIR 187
           P+V ++R
Sbjct: 179 PDVVEVR 185


>gi|319405374|emb|CBI78993.1| NifU-related protein [Bartonella sp. AR 15-3]
          Length = 190

 Score =  219 bits (558), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 141/184 (76%), Gaps = 7/184 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE+TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTENTPNPTTLKFLPGRIVLSQGVLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I      ++ + D    D  E D+ +V 
Sbjct: 61  FITITKNDGEWKHLKPAILGTIMEHFLSNDPVITT----EVHISDKEFFD--EKDTDIVV 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 115 VIKELLETRVRPAVANDGGDITFCGFANGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 174

Query: 180 VPEV 183
           +PEV
Sbjct: 175 IPEV 178


>gi|49474596|ref|YP_032638.1| hypothetical protein BQ10720 [Bartonella quintana str. Toulouse]
 gi|49240100|emb|CAF26539.1| hypothetical protein BQ10720 [Bartonella quintana str. Toulouse]
          Length = 192

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 134/184 (72%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G + F N++EA + SPLA+++F+IP +  V  GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSKGVLEFRNSEEAAKNSPLAAKLFNIPNVNGVLLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEHF+S  P+I        +   +    + E D  +V 
Sbjct: 61  FITVSKKDGEWQHLKPAILGTIMEHFLSDAPVIKTNATIQAQTHALNEEFYDEKDVDIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK G+ N+L HF
Sbjct: 121 TIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKTGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|319406947|emb|CBI80584.1| NifU-related protein [Bartonella sp. 1-1C]
          Length = 190

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/184 (54%), Positives = 138/184 (75%), Gaps = 7/184 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGRIVLPQGTLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I        + +      F E D+ +V 
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEHFLSNDPVI------TTETNIPNKEFFDEKDTDIVI 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 115 VIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 174

Query: 180 VPEV 183
           +PEV
Sbjct: 175 IPEV 178


>gi|304393809|ref|ZP_07375734.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Ahrensia
           sp. R2A130]
 gi|303294008|gb|EFL88383.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Ahrensia
           sp. R2A130]
          Length = 190

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 143/192 (74%), Gaps = 6/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PGQ V   G   FS+A +AE  SPLA+ +F+IP ++ V+FGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGQTVAENGPFEFSDAVDAEDRSPLAAGLFAIPSVSGVFFGYD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA-V 117
           F+T+ K D  DW+H++P VLG+IMEHF+SG P+++    G  ++   G   F+E  S  +
Sbjct: 61  FVTITKNDTADWQHVKPAVLGVIMEHFMSGAPVMNADAAGGTEVAPEG---FVEEGSEEI 117

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+L+ RVRPAVA+DGGDI F G++DG V+L MRGAC+GCPS++ TL++G+ N+L 
Sbjct: 118 VSTIKELLETRVRPAVAQDGGDITFHGFKDGRVYLKMRGACAGCPSSTATLQHGIQNLLK 177

Query: 178 HFVPEVKDIRTV 189
           HF+PEV+ +  V
Sbjct: 178 HFIPEVEAVEAV 189


>gi|312113945|ref|YP_004011541.1| Scaffold protein Nfu/NifU [Rhodomicrobium vannielii ATCC 17100]
 gi|311219074|gb|ADP70442.1| Scaffold protein Nfu/NifU [Rhodomicrobium vannielii ATCC 17100]
          Length = 184

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 144/190 (75%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL EG   F  + +AE +SPLA+R+F + G+ +V+ G D
Sbjct: 1   MFIQTEMTPNPATLKFLPGRTVLEEGTREFLTSDDAEGVSPLAARLFEVEGVTAVFLGSD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F++V KD+ DWE L+PPVLG+IMEHF+SG P++ +      +       DF ++D  VV 
Sbjct: 61  FVSVTKDRGDWESLKPPVLGVIMEHFMSGQPVLSD------ERHVAEDEDFDDADKEVVT 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA DGGDI FKG+RDG+V+L M+GACSGCPSA+ TL++G+ N+L HF
Sbjct: 115 TIKELIETRVRPAVANDGGDITFKGFRDGVVYLKMQGACSGCPSATATLRHGIENLLKHF 174

Query: 180 VPEVKDIRTV 189
           VPEV++++ V
Sbjct: 175 VPEVQEVQPV 184


>gi|126740480|ref|ZP_01756167.1| nifU domain protein [Roseobacter sp. SK209-2-6]
 gi|126718281|gb|EBA14996.1| nifU domain protein [Roseobacter sp. SK209-2-6]
          Length = 187

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA+ AE SPLA R+F+  G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPNAEAAENSPLAQRVFAAAGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEHF SG P+++ GG         G  +    D+ VV 
Sbjct: 61  VTVTKSEDVEWDHIKPAILGAIMEHFQSGQPVLNAGGA-----QSSGHAEHSGEDAEVVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKDLLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|316931562|ref|YP_004106544.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris DX-1]
 gi|315599276|gb|ADU41811.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris DX-1]
          Length = 188

 Score =  218 bits (555), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 141/187 (75%), Gaps = 2/187 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRSVLDSGTLEFTDAAQAARSPLAARLFDIDGVSGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+          D      + E D+  V+ 
Sbjct: 61  VTVTKDRGEWQHLKPAILGAIMEHYMSGAPIL--ADGKSDGDDGDDDEFYAEGDAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHFV 178

Query: 181 PEVKDIR 187
           PEV ++R
Sbjct: 179 PEVVEVR 185


>gi|319403933|emb|CBI77521.1| NifU-related protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 190

 Score =  217 bits (553), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 140/185 (75%), Gaps = 9/185 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGRIVLPQGTLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVV 118
           FIT+ K+  +W+HL+P +LG IME+F+S DP+I           ++ + +F  E D+ +V
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEYFLSNDPVITTEA-------NLPNKEFFDEKDTDIV 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L H
Sbjct: 114 VVIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRH 173

Query: 179 FVPEV 183
           F+PEV
Sbjct: 174 FIPEV 178


>gi|209883678|ref|YP_002287535.1| nitrogen-fixing NifU domain protein [Oligotropha carboxidovorans
           OM5]
 gi|209871874|gb|ACI91670.1| nitrogen-fixing NifU domain protein [Oligotropha carboxidovorans
           OM5]
          Length = 187

 Score =  217 bits (552), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 138/187 (73%), Gaps = 2/187 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG++V+  G + F++      SPLA+++F IPG+  V++  DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRLVIESGTMEFTDRDSTARSPLAAKLFDIPGVTGVFYSSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K + DW+HL+P +LG IMEH++SG PI+ +G   D          F E+D+  V  
Sbjct: 61  ITVTKGEGDWQHLKPAILGTIMEHYMSGAPILADGAKPDAG--PHAEEFFNEADAETVTI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIVFL M+G+CSGCPS++ TLK+G+ N+L HFV
Sbjct: 119 IKDIIETRVRPAVASDGGDITFRGFKDGIVFLDMKGSCSGCPSSTATLKHGIQNLLKHFV 178

Query: 181 PEVKDIR 187
           P+V ++R
Sbjct: 179 PDVVEVR 185


>gi|260426420|ref|ZP_05780399.1| scaffold protein Nfu/NifU [Citreicella sp. SE45]
 gi|260420912|gb|EEX14163.1| scaffold protein Nfu/NifU [Citreicella sp. SE45]
          Length = 185

 Score =  216 bits (551), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 104/190 (54%), Positives = 134/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA  A+ SPLA R+FS+ G+  V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQAVLGAGTADFPNADGADASPLARRLFSVTGVTGVFLGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   DW+H++P VLG IMEHF SGDP++   G         G   F   D  +V 
Sbjct: 61  VTVTKDDGADWDHVKPAVLGAIMEHFQSGDPVMAGEG------GSSGHAAFDGEDKEIVG 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|260431494|ref|ZP_05785465.1| NifU domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415322|gb|EEX08581.1| NifU domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 187

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ AE SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPTAEAAENSPLAKRIFAVKGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD    W+H++P +LG +MEH+ SG PI     +GD      G  +    DS +V 
Sbjct: 61  VTVTKDDDVQWDHIKPAILGAVMEHYQSGQPI-----MGDGADAASGHAEHTGEDSEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|158426327|ref|YP_001527619.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571]
 gi|158333216|dbj|BAF90701.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571]
          Length = 186

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 136/189 (71%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G +   +  EA  SPL  R+F + G+  V+ G DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRTVLGDGTLEARSPAEAGRSPLVQRLFEVKGVGGVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV K   DW H++P +LG IMEHF+SG P++ +G   D    + G   F E+D  +V  
Sbjct: 61  VTVTKTDGDWAHMKPAILGAIMEHFMSGAPVLADGVAAD---QEDGEEFFNEADEEIVGT 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+++ RVRPAVA DGGDI F+G+R+G+V+L+M+G+CSGCPS++ TLK G+ N+L HFV
Sbjct: 118 IKELIETRVRPAVAADGGDITFRGFREGVVYLNMKGSCSGCPSSTATLKNGIENLLRHFV 177

Query: 181 PEVKDIRTV 189
           PEV ++R V
Sbjct: 178 PEVNEVRPV 186


>gi|121601928|ref|YP_989428.1| NifU family protein [Bartonella bacilliformis KC583]
 gi|120614105|gb|ABM44706.1| NifU family protein [Bartonella bacilliformis KC583]
          Length = 192

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 133/184 (72%), Gaps = 1/184 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+V+L EG + F +++ A + SPLA+++F I  ++ V  GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVILSEGVLEFRDSEAAALGSPLAAKLFQISNVSGVLLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEH +S  PI+  G     +        + E D+ +V 
Sbjct: 61  FITVTKSDGEWQHLKPVILGTIMEHLLSNAPIVSTGAAAHAQSHTHNEEFYDEKDADIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F+G+  GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRVRPAVANDGGDITFRGFEHGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEV 183
           +PEV
Sbjct: 181 IPEV 184


>gi|254461257|ref|ZP_05074673.1| NifU domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206677846|gb|EDZ42333.1| NifU domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 188

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 138/190 (72%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A++SPLA+RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAVGADVSPLAARIFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEHF SG  ++     GDM   + G  +    D  +V 
Sbjct: 61  VTVTKADAVEWDHIKPALLGAIMEHFQSGAAVM----AGDMAPPNSGHAEHTGEDGEIVV 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDSRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|99078069|ref|YP_611327.1| nitrogen-fixing NifU-like [Ruegeria sp. TM1040]
 gi|99035207|gb|ABF62065.1| nitrogen-fixing NifU-like protein [Ruegeria sp. TM1040]
          Length = 187

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAASKSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   +W+H++P VLG +MEH+ SG P+I+ G     +    G  +    D  +V 
Sbjct: 61  VTVTKDDSVEWDHIKPAVLGAVMEHYQSGQPVINEG-----QQQASGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|149202972|ref|ZP_01879943.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035]
 gi|149143518|gb|EDM31554.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035]
          Length = 187

 Score =  216 bits (549), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 140/190 (73%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+++  SPLA RIF +PG++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAEKSGSSPLAERIFRVPGVSGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEH+ SG P++    LG+  +   G  +    DSA+V 
Sbjct: 61  VTVTKGEAIEWDHIKPAILGAIMEHYQSGQPVM----LGESAVAS-GHAEHTGEDSAIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|294678745|ref|YP_003579360.1| NifU domain-containing protein [Rhodobacter capsulatus SB 1003]
 gi|294477565|gb|ADE86953.1| NifU domain protein [Rhodobacter capsulatus SB 1003]
          Length = 188

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 135/190 (71%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG  V+ EG   F++ + A++SPLA RIF + G+ +V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGLDVMPEGVADFTSVEAAQVSPLAGRIFRVAGVKAVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W H RP ++G IMEH+ SG P++     G        +G+    D A++ 
Sbjct: 61  VTVTKDEATEWAHARPAIMGAIMEHYQSGQPVLMGAAAGGHTTGGADTGE----DGAIIS 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVARDGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDTRVRPAVARDGGDITFHGFEKGVVYLHMQGACAGCPSSTYTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVSEVRAV 186


>gi|86138949|ref|ZP_01057520.1| nifU domain protein [Roseobacter sp. MED193]
 gi|85824180|gb|EAQ44384.1| nifU domain protein [Roseobacter sp. MED193]
          Length = 187

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 139/190 (73%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA+RIF++ G+A V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAETAGSSPLATRIFAVSGVAGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG PI++ GG         G  +    +S +V 
Sbjct: 61  VTVTKSDSVEWDHIKPAILGAIMEHYQSGQPIVNAGGE-----QSSGHAEHSGENSEIVD 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKDLLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254474955|ref|ZP_05088341.1| NifU domain protein [Ruegeria sp. R11]
 gi|214029198|gb|EEB70033.1| NifU domain protein [Ruegeria sp. R11]
          Length = 187

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAEAAGSSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEHF SG P+I  GG         G  +    D  +V 
Sbjct: 61  VTVTKADGVEWDHIKPAILGAVMEHFQSGQPVISEGGE-----QTSGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|83949998|ref|ZP_00958731.1| nifU domain protein [Roseovarius nubinhibens ISM]
 gi|83837897|gb|EAP77193.1| nifU domain protein [Roseovarius nubinhibens ISM]
          Length = 188

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 138/190 (72%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF I G+  V+FG+DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAAGKSPLAERIFKIAGVTGVFFGHDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P +LG IMEHF SG P++ + G GD +    G  +    D  +V 
Sbjct: 61  VTVTKDEGTEWDHVKPAILGAIMEHFQSGKPVMLDAG-GDPQ---SGHAEHTGEDGEIVN 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|163738966|ref|ZP_02146379.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107]
 gi|163741789|ref|ZP_02149179.1| nifU domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161384962|gb|EDQ09341.1| nifU domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161387771|gb|EDQ12127.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107]
          Length = 187

 Score =  215 bits (547), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A  A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPTADAAGSSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEHF SG P+I  GG         G  +    D  +V 
Sbjct: 61  VTVTKADTVEWDHIKPAILGAVMEHFQSGQPVISEGGE-----QTSGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|259415063|ref|ZP_05738985.1| NifU domain protein [Silicibacter sp. TrichCH4B]
 gi|259348973|gb|EEW60727.1| NifU domain protein [Silicibacter sp. TrichCH4B]
          Length = 187

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAASKSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   +W+H++P VLG +MEH+ SG P+I  G     +    G  +    D  +V 
Sbjct: 61  VTVTKDDSVEWDHIKPAVLGAVMEHYQSGQPVIDEG-----QQQASGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|85705721|ref|ZP_01036818.1| nifU domain protein [Roseovarius sp. 217]
 gi|85669711|gb|EAQ24575.1| nifU domain protein [Roseovarius sp. 217]
          Length = 187

 Score =  214 bits (546), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ AE SPLA RIF +PG++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPTAEGAEKSPLAERIFRVPGVSGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEH+ SG P++   G G       G  +    DS +V 
Sbjct: 61  VTVTKGEATEWDHIKPAILGAIMEHYQSGQPVMLGEGGGAS-----GHAEHSGEDSEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|300024980|ref|YP_003757591.1| Scaffold protein Nfu/NifU [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526801|gb|ADJ25270.1| Scaffold protein Nfu/NifU [Hyphomicrobium denitrificans ATCC 51888]
          Length = 184

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 102/189 (53%), Positives = 131/189 (69%), Gaps = 5/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G   F    EA  SPLA+R+F+I G+  V+ G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRDVLAGGTADFRTRNEAVASPLATRLFAIDGVDGVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V K   +W+HL+P VLG IMEH++SG P+       +   +D G+  +   D A V  
Sbjct: 61  ISVTKGNVEWQHLKPMVLGAIMEHYMSGAPVSD-----EEDSNDEGAESYDPEDEATVTT 115

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F G+RDG+V+L MRGACSGCPS++ TL+ G+ N+L HF 
Sbjct: 116 IKELLETRVRPAVAQDGGDITFSGFRDGVVYLHMRGACSGCPSSTATLRNGIENLLKHFC 175

Query: 181 PEVKDIRTV 189
           PEV  +  V
Sbjct: 176 PEVTSVEAV 184


>gi|163734126|ref|ZP_02141567.1| NifU-like domain protein [Roseobacter litoralis Och 149]
 gi|161392662|gb|EDQ16990.1| NifU-like domain protein [Roseobacter litoralis Och 149]
          Length = 187

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA RIF+I G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAETADKSPLAERIFAIEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++     GD      G  +    D  +V 
Sbjct: 61  VTVTKADSVDWDHIKPGLLGAIMEHFQSGQPVM----AGD-HTPTSGHAEHTGEDGVIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|110678955|ref|YP_681962.1| NifU-like domain-containing protein [Roseobacter denitrificans OCh
           114]
 gi|109455071|gb|ABG31276.1| NifU-like domain protein [Roseobacter denitrificans OCh 114]
          Length = 187

 Score =  214 bits (545), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAETADKSPLAERVFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++     GD      G  +    D  +V 
Sbjct: 61  VTVTKADNVDWDHIKPALLGAIMEHFQSGQPVM----AGD-HTPTSGHAEHTGDDGVIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|310815348|ref|YP_003963312.1| NifU domain protein [Ketogulonicigenium vulgare Y25]
 gi|308754083|gb|ADO42012.1| NifU domain protein [Ketogulonicigenium vulgare Y25]
          Length = 185

 Score =  214 bits (544), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 134/190 (70%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+ GYDF
Sbjct: 1   MFIQTESTPNPATLKFLPGQQVLELGTADFPSAEAATTSPLAKRLFAVDGVTGVFLGYDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  +W HL+P VLG IMEHF SG P++    +   +  D         D A+V+
Sbjct: 61  ITVTKTDNLEWPHLKPAVLGAIMEHFQSGQPVMEGEAVSAHRAHD-------GEDGAIVE 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+G+C+GCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGSCAGCPSSTLTLKMGIENLLRHY 173

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 174 IPEVLEVRPV 183


>gi|126725029|ref|ZP_01740872.1| nifU domain protein [Rhodobacterales bacterium HTCC2150]
 gi|126706193|gb|EBA05283.1| nifU domain protein [Rhodobacterales bacterium HTCC2150]
          Length = 187

 Score =  213 bits (543), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA+RIF I GIA V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPSAETADQSPLATRIFGIQGIAGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEHF SG P++          +        E D  +V 
Sbjct: 61  VTVTKAENSEWDHIKPAILGAIMEHFQSGQPVLSGENTAPAHAEAAN-----EEDKEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|89053356|ref|YP_508807.1| nitrogen-fixing NifU-like [Jannaschia sp. CCS1]
 gi|88862905|gb|ABD53782.1| nitrogen-fixing NifU-like protein [Jannaschia sp. CCS1]
          Length = 187

 Score =  213 bits (543), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ +E SPLASRIF++ G+  V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGQSVLEVGTADFPTAETSEKSPLASRIFAVEGVTGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEH+ SGDP+     +GD      G  +    D  +V 
Sbjct: 61  VTVTKADAVDWDHVKPAILGAIMEHYQSGDPV-----MGDGHEVSSGHAEHTGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKSLLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|83943871|ref|ZP_00956328.1| nifU domain protein [Sulfitobacter sp. EE-36]
 gi|83953512|ref|ZP_00962234.1| nifU domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83842480|gb|EAP81648.1| nifU domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83845118|gb|EAP82998.1| nifU domain protein [Sulfitobacter sp. EE-36]
          Length = 186

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 136/192 (70%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F   + A  SPLA+R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPAPEAASASPLATRLFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG--DFIESDSAV 117
           +T+ K D  +W+HL+P +LG IMEHF SG P++  G        D  SG  +    D A+
Sbjct: 61  VTITKADGIEWDHLKPALLGAIMEHFQSGQPVMETG-------HDHASGHAEHTGEDGAI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L 
Sbjct: 114 VGQIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLR 173

Query: 178 HFVPEVKDIRTV 189
           H++PEV ++R V
Sbjct: 174 HYIPEVTEVRPV 185


>gi|260574570|ref|ZP_05842574.1| Scaffold protein Nfu/NifU [Rhodobacter sp. SW2]
 gi|259023466|gb|EEW26758.1| Scaffold protein Nfu/NifU [Rhodobacter sp. SW2]
          Length = 186

 Score =  213 bits (541), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/190 (54%), Positives = 137/190 (72%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF+  G+ASV+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLELGTADFPSAEAAGKSPLAQRIFAAGGVASVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+H++P +LG IMEHF SG P+I        +    G  D    DS +V+
Sbjct: 61  VTVTKTDTAAWDHIKPGILGAIMEHFQSGAPVIEG------EQAASGHADHDGPDSDIVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R+V
Sbjct: 175 IPEVLEVRSV 184


>gi|91974729|ref|YP_567388.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5]
 gi|91681185|gb|ABE37487.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5]
          Length = 188

 Score =  212 bits (539), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/181 (54%), Positives = 139/181 (76%), Gaps = 5/181 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++ K+A  SPLA R+F + G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRKQAARSPLAERLFEVEGVSGVFYGSDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGL-GDMKLDDMGSGDFIESDSAVV 118
           +TV KD   DW+HL+P +LG IMEH++SG PI+ +G + GD   +D     F E D+  V
Sbjct: 61  VTVTKDGAGDWQHLKPAILGAIMEHYMSGAPIMADGRVDGDETDEDEF---FAERDAETV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + IK++++ RVRPAVA DGGDI F+G++DG+V+L+M+GACSGCPS++ TL++G+ N+L H
Sbjct: 118 EIIKDLIETRVRPAVANDGGDITFRGFKDGVVYLAMKGACSGCPSSTATLQHGIQNLLKH 177

Query: 179 F 179
           F
Sbjct: 178 F 178


>gi|254465238|ref|ZP_05078649.1| NifU domain protein [Rhodobacterales bacterium Y4I]
 gi|206686146|gb|EDZ46628.1| NifU domain protein [Rhodobacterales bacterium Y4I]
          Length = 188

 Score =  212 bits (539), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 136/190 (71%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A  SPLASRIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSADAAGKSPLASRIFAVDGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW+H++P +LG +MEH+ SG P++ +G          G  +    D+ +V 
Sbjct: 61  VTVTKAEGIDWDHIKPAILGAVMEHYQSGQPVMADGSADPAS----GHAEHSGEDAEIVN 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|46201919|ref|ZP_00054106.2| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum
           magnetotacticum MS-1]
          Length = 182

 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG VV+ +G   F+ A  A  SPLA+R+F+I G+ SV+ G DF
Sbjct: 1   MFIQTEPTPNPATLKFLPGTVVMGQGTADFAEASRASGSPLATRLFAIEGVGSVFLGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW+ ++P VL  IM+H+ SGDP+I+ G           SGD    D  +V 
Sbjct: 61  ITVAKADSADWQVVKPQVLAAIMDHYNSGDPVINPGSEAAS-----ASGD----DDGIVM 111

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F+ + DGIV+L ++GACSGCPS+S TLK+G+ N+L ++
Sbjct: 112 QIKELLDTRVRPAVAQDGGDIIFRAFEDGIVYLHLQGACSGCPSSSATLKHGIENMLKYY 171

Query: 180 VPEVKDIRTV 189
           VPEV  ++ V
Sbjct: 172 VPEVMAVQAV 181


>gi|39933530|ref|NP_945806.1| NifU-like domain-containing protein [Rhodopseudomonas palustris
           CGA009]
 gi|39647376|emb|CAE25897.1| possible NifU-like domain (residues 119-187) [Rhodopseudomonas
           palustris CGA009]
          Length = 188

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 137/179 (76%), Gaps = 2/179 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRSVLDSGTLEFTDASQAARSPLAARLFDIDGVSGVFYGTDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+ +G       D      + ++D+  V+ 
Sbjct: 61  VTVTKDKGEWQHLKPAILGAIMEHYMSGTPILADG--KSDGEDGDDDEFYADADAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHF 177


>gi|188582635|ref|YP_001926080.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001]
 gi|179346133|gb|ACB81545.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001]
          Length = 188

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 139/192 (72%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG     +A  AE SPLA+ +FS+PG++ VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTFEARDAAGAERSPLATALFSVPGVSGVYFGHDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLDDMGSGDFIESDSAV 117
           I+V K     +W  ++P VLG IM+HF SG P++  G  L + + ++     + E+D   
Sbjct: 61  ISVTKADGVNEWPQVKPAVLGAIMDHFQSGRPVLAEGTALAEDETEEF----YDEADHDT 116

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IK++L+ RVRPAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  
Sbjct: 117 VATIKDLLETRVRPAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFR 176

Query: 178 HFVPEVKDIRTV 189
           HF+P V++++ +
Sbjct: 177 HFLPSVREVQAI 188


>gi|192288888|ref|YP_001989493.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1]
 gi|192282637|gb|ACE99017.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1]
          Length = 188

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 137/179 (76%), Gaps = 2/179 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRRVLDSGTLEFTDASQAARSPLAARLFDIDGVSGVFYGTDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+ +G       D      + ++D+  V+ 
Sbjct: 61  VTVTKDKGEWQHLKPAILGAIMEHYMSGTPILADG--KSDGEDGDDDEFYADADAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHF 177


>gi|83313502|ref|YP_423766.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1]
 gi|82948343|dbj|BAE53207.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1]
          Length = 190

 Score =  211 bits (536), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG VV+ +G   F+ A  A  SPLA+R+F+I G+ SV+ G DF
Sbjct: 9   MFIQTEPTPNPATLKFLPGTVVMGQGTADFAEASRASGSPLATRLFAIDGVGSVFLGTDF 68

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW+ ++P VL  IM+H+ SGDP+I+ G           SGD    D  +V 
Sbjct: 69  ITVAKLDAADWQVVKPQVLAAIMDHYNSGDPVINPGSEAAA-----ASGD----DDGIVM 119

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F+ + DGIV+L ++GACSGCPS+S TLK+G+ N+L ++
Sbjct: 120 QIKELLDTRVRPAVAQDGGDIIFRAFEDGIVYLHLQGACSGCPSSSATLKHGIENMLKYY 179

Query: 180 VPEVKDIRTV 189
           VPEV  ++ V
Sbjct: 180 VPEVMAVQAV 189


>gi|86747711|ref|YP_484207.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2]
 gi|86570739|gb|ABD05296.1| Nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2]
          Length = 188

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 135/179 (75%), Gaps = 1/179 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++  +A  SPLA R+F + G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRSQAARSPLAERLFDVDGVSGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+HL+P +LG IMEH++SG PI+ +G       D+     F E D+  V+ 
Sbjct: 61  VTVTKDGGDWQHLKPAILGAIMEHYMSGAPILADGKTDGDAGDEDDEF-FAERDAETVEI 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HF
Sbjct: 120 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLAMKGACSGCPSSTATLQHGIQNLLKHF 178


>gi|114764450|ref|ZP_01443675.1| nifU domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114543017|gb|EAU46036.1| nifU domain protein [Roseovarius sp. HTCC2601]
          Length = 186

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+  + SPLA R+F + G+  V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLGAGTADFPSAEGTDASPLAKRLFGVTGVTGVFLGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P VLG IMEHF SG+P++   G         G   F   D  +V 
Sbjct: 61  VTVTKADGADWDHVKPAVLGAIMEHFQSGEPVMAGEGGAS------GHAAFEGEDEEIVG 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|126730479|ref|ZP_01746290.1| nifU domain protein [Sagittula stellata E-37]
 gi|126709212|gb|EBA08267.1| nifU domain protein [Sagittula stellata E-37]
          Length = 187

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A  SPLA R+F++ G+  ++FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDMGTADFPSADAAGASPLAQRLFAVDGVTGIFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++ +G          G  +    D  +V 
Sbjct: 61  VTVTKADTVDWDHMKPAILGAIMEHFQSGQPVMSDGAA-----QAGGHAEHEGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|84500284|ref|ZP_00998550.1| nifU domain protein [Oceanicola batsensis HTCC2597]
 gi|84392218|gb|EAQ04486.1| nifU domain protein [Oceanicola batsensis HTCC2597]
          Length = 187

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ +  SPLA+R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAETSGKSPLAARLFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D+  W+H++P +LG IMEH+ SG P++  G          G  D    D  +V 
Sbjct: 61  VTVTKADETQWDHIKPALLGAIMEHYQSGQPVMATG-----DQPTSGHADHEGEDQEIVV 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLYMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254510570|ref|ZP_05122637.1| NifU domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534281|gb|EEE37269.1| NifU domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 187

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 137/192 (71%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA+RIF + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAEAAEKSPLATRIFGVAGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES--DSAV 117
           +TV K D   W+H++P +LG +MEH+ SG P++           D G+G    S  D+ +
Sbjct: 61  VTVTKSDDMQWDHIKPAILGAVMEHYQSGQPVMGTDA-------DTGAGHAEHSGEDAEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IK++LD+RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L 
Sbjct: 114 VDQIKDLLDSRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTITLKMGIENLLR 173

Query: 178 HFVPEVKDIRTV 189
           H++PEV ++R V
Sbjct: 174 HYIPEVVEVRPV 185


>gi|56695297|ref|YP_165645.1| NifU domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56677034|gb|AAV93700.1| nifU domain protein [Ruegeria pomeroyi DSS-3]
          Length = 187

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA+RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEVGTADFPSAEAAEKSPLAARIFAVSGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG +MEH+ SG P+     +G       G  +    D+ VV 
Sbjct: 61  VTVTKAEGVEWDHIKPAILGAVMEHYQSGQPV-----MGADAQTGSGHAEHSGEDAEVVT 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKALLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|154254042|ref|YP_001414866.1| scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1]
 gi|154157992|gb|ABS65209.1| Scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1]
          Length = 201

 Score =  210 bits (534), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 135/190 (71%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL EG A  F  A+ A  SPLA R+F++  +  V+FG D
Sbjct: 16  MFIQTEATPNPATLKFLPGREVLGEGRAADFPTAEAAARSPLAMRLFAVENVTGVFFGSD 75

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEHF  G PI+ +    D        G+    D  +V 
Sbjct: 76  FITVTKSGGEWQHLKPALLGAIMEHFTGGAPILFSAAPDDDDAHAAHEGE----DGEIVT 131

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F+GY +G+VFL+M+GAC+GCPS++ TLK GV N+L H+
Sbjct: 132 QIKEILDTRVRPAVAQDGGDITFQGYEEGVVFLNMQGACAGCPSSTVTLKRGVENMLKHY 191

Query: 180 VPEVKDIRTV 189
           +PE+ ++R V
Sbjct: 192 IPEIVEVRQV 201


>gi|254487441|ref|ZP_05100646.1| NifU domain protein [Roseobacter sp. GAI101]
 gi|214044310|gb|EEB84948.1| NifU domain protein [Roseobacter sp. GAI101]
          Length = 203

 Score =  210 bits (534), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F   + A  SPLA+R+F++ G+  V+FG DF
Sbjct: 18  MFIQTESTPNPATLKFLPGQTVLEMGTADFPAPEAASSSPLATRLFAVDGVTGVFFGTDF 77

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+HL+P +LG IMEHF SG  ++  G          G  +    D A+V 
Sbjct: 78  VTVTKADTIEWDHLKPALLGAIMEHFQSGQSVMEQG-----HEHASGHAEHTGEDGAIVG 132

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 133 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 192

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 193 IPEVTEVRPV 202


>gi|89068101|ref|ZP_01155518.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516]
 gi|89046340|gb|EAR52397.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516]
          Length = 186

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F++ + A  SPLA RIFS+ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGEAVLDAGTADFASPEAANTSPLARRIFSVQGVTGVFFGTDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P +LG IMEH+ SG P++  G  G       G  +    D  +V 
Sbjct: 61  VTVTKDEATEWDHVKPAILGAIMEHYQSGAPVV-EGAEGAT-----GHAEHTGEDGEIVA 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRPV 184


>gi|163797123|ref|ZP_02191078.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199]
 gi|159177639|gb|EDP62192.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199]
          Length = 187

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 131/188 (69%), Gaps = 7/188 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNPATLKF+PG+ V+  G   F +  E   SPLA  +F + G+  V+ GYDF
Sbjct: 1   MFIQTEETPNPATLKFLPGRQVMESGTAEFKSEDETARSPLAQALFQVDGVTGVFLGYDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K D  +W  ++P VLG+IMEHF++G P I   G      +D G       D+ +V 
Sbjct: 61  ISVSKHDGKEWYLMKPGVLGVIMEHFVAGRPTIVEDGASASAPEDAGE------DTEIVS 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDI F+GY DG+V L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAMDGGDITFQGYEDGVVTLQMQGACSGCPSSTATLKMGIENMLRHY 174

Query: 180 VPEVKDIR 187
           +PEV+++R
Sbjct: 175 IPEVREVR 182


>gi|163852613|ref|YP_001640656.1| scaffold protein Nfu/NifU [Methylobacterium extorquens PA1]
 gi|218531454|ref|YP_002422270.1| Scaffold protein Nfu/NifU [Methylobacterium chloromethanicum CM4]
 gi|240139947|ref|YP_002964424.1| NifU-like protein [Methylobacterium extorquens AM1]
 gi|254562372|ref|YP_003069467.1| NifU-like [Methylobacterium extorquens DM4]
 gi|163664218|gb|ABY31585.1| Scaffold protein Nfu/NifU [Methylobacterium extorquens PA1]
 gi|218523757|gb|ACK84342.1| Scaffold protein Nfu/NifU [Methylobacterium chloromethanicum CM4]
 gi|240009921|gb|ACS41147.1| NifU-like protein [Methylobacterium extorquens AM1]
 gi|254269650|emb|CAX25622.1| NifU-like [Methylobacterium extorquens DM4]
          Length = 188

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 138/192 (71%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G     +   AE SPLA+ +F++PG++ VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLTDGTFEARDTASAERSPLATALFAVPGVSGVYFGHDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLDDMGSGDFIESDSAV 117
           I+V K     +W  ++P VLG IM+HF SG P++  G  L + + ++     + E+D   
Sbjct: 61  ISVTKADGVNEWPQVKPAVLGAIMDHFQSGRPVLAEGTALAEDETEEF----YDEADHDT 116

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IK++L+ RVRPAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  
Sbjct: 117 VVTIKDLLETRVRPAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFR 176

Query: 178 HFVPEVKDIRTV 189
           HF+P V++++ +
Sbjct: 177 HFLPSVREVQAI 188


>gi|332557651|ref|ZP_08411973.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides WS8N]
 gi|332275363|gb|EGJ20678.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides WS8N]
          Length = 186

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 137/190 (72%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+  + A  SPLA RIF++ G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATPEAAATSPLARRIFAVGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++     G+       S D  + D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLE----GEQAASGHASHDGPDED--VVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|90420546|ref|ZP_01228453.1| putative nitrogen-fixing NifU domain protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335274|gb|EAS49027.1| putative nitrogen-fixing NifU domain protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 191

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (70%), Gaps = 3/180 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHF-SNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL  G   F S    A  SPLA+R+  +PG+  V+FGYD
Sbjct: 1   MFIQTEVTPNPATLKFLPGRVVLESGTEEFLSKEDAANRSPLAARLMDVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F+TV KD  DW+HL+P +L  +MEHF+  +P++   G      D  G   F   D   V 
Sbjct: 61  FVTVSKDGPDWQHLKPAILAGLMEHFMGNEPVMTAQGSNAAMPD--GEEFFEPGDEGTVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+GYRDG V+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGYRDGTVYLNMRGACAGCPSSTATLKHGIQNLLRHF 178


>gi|149913250|ref|ZP_01901784.1| NifU-like domain protein [Roseobacter sp. AzwK-3b]
 gi|149813656|gb|EDM73482.1| NifU-like domain protein [Roseobacter sp. AzwK-3b]
          Length = 187

 Score =  208 bits (529), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 136/193 (70%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ ++ SPLA+R+F + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPTAEASDKSPLATRLFGVKGVRGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD-DMGSGDFIES--DSA 116
           +TV K D  +W+H++P +LG IMEHF SG P+        M +D +  SG       DS 
Sbjct: 61  VTVTKTDDAEWDHIKPSILGAIMEHFQSGQPV--------MAVDAEHASGHAAHEGEDSE 112

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L
Sbjct: 113 IVGQIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTITLKMGIENLL 172

Query: 177 NHFVPEVKDIRTV 189
            H++PEV ++R V
Sbjct: 173 RHYIPEVTEVRPV 185


>gi|170741563|ref|YP_001770218.1| scaffold protein Nfu/NifU [Methylobacterium sp. 4-46]
 gi|168195837|gb|ACA17784.1| Scaffold protein Nfu/NifU [Methylobacterium sp. 4-46]
          Length = 187

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 136/191 (71%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G     +  +A  SPLA  +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLTDGTFEARSPDQAAPSPLARALFAVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF+SG P++  G              F E+D+  V
Sbjct: 61  ISVTKAEDGSEWPQVKPAVLGAIMEHFLSGAPVLDAG----AAPAAPAEEFFAEADADTV 116

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYR+G+V+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 117 ATIKDLLETRVRPAVAGDGGDITFRGYREGVVYLEMKGACSGCPSSTATLRQGVQNLFRH 176

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 177 FLPEVREVQAV 187


>gi|159045379|ref|YP_001534173.1| hypothetical protein Dshi_2839 [Dinoroseobacter shibae DFL 12]
 gi|157913139|gb|ABV94572.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 187

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+ +V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPSAEAAGSSPLAGRIFAVNGVTAVFFGTDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P VLG +MEH+ SGD ++     G+      G       DS +V 
Sbjct: 61  VTVTKDEGVEWDHIKPAVLGAVMEHYQSGDAVM----TGEASAP-AGHAAHDGPDSEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVLEVRPV 185


>gi|126461658|ref|YP_001042772.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221638629|ref|YP_002524891.1| nitrogen-fixing NifU domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|126103322|gb|ABN76000.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159410|gb|ACM00390.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides KD131]
          Length = 186

 Score =  207 bits (527), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 136/190 (71%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+  + A  SPLA RIF+  G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATPEAAATSPLARRIFAAGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++     G+       S D  + D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLE----GEQAASGHASHDGPDED--VVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|217979031|ref|YP_002363178.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2]
 gi|217504407|gb|ACK51816.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2]
          Length = 187

 Score =  207 bits (526), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 134/190 (70%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP TLKF+PG+ V+  G +     ++A  SPLA  +F + G+  V+FG DF
Sbjct: 1   MFIETETTPNPKTLKFLPGRPVMSAGTLDIKEPEDARQSPLAEALFELDGVKGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVVQ 119
           ITV     DW+ L+P VLG IMEHF+SGDP+++          D G  +F  ESD+  V 
Sbjct: 61  ITVTNANEDWQELKPTVLGAIMEHFLSGDPLLNEHA---HVSPDAGEREFFEESDAETVT 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++  VRPAVA DGGDI F+GYRDGIV+L+M+G+CSGCPS++ TLK+G+ N+L H+
Sbjct: 118 AIKQLIETHVRPAVANDGGDIKFRGYRDGIVYLAMKGSCSGCPSSTATLKHGIQNLLKHY 177

Query: 180 VPEVKDIRTV 189
           VP+V+ + ++
Sbjct: 178 VPDVQSVESI 187


>gi|323138525|ref|ZP_08073593.1| Scaffold protein Nfu/NifU [Methylocystis sp. ATCC 49242]
 gi|322396159|gb|EFX98692.1| Scaffold protein Nfu/NifU [Methylocystis sp. ATCC 49242]
          Length = 187

 Score =  207 bits (526), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 141/190 (74%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL +GA+ F +   A  +PLA  + +I G+ +V +G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGQDVLGQGAMEFRSPDAAANAPLAQALLAIDGVQAVMYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVVQ 119
           ++V KD  DW HL+P +LG IMEHF SG P++  G  G  + +D   G+F + SD+  V 
Sbjct: 61  VSVTKDGADWAHLKPAILGTIMEHFASGAPLLTEGAAGAQQHED---GEFYDPSDAETVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA DGGDIVF+G+RDG+V+L+M+GACSGCPS++ TL+ G+ N+L HF
Sbjct: 118 TIKELIETRVRPAVAGDGGDIVFRGFRDGVVYLTMKGACSGCPSSTATLRNGIENLLRHF 177

Query: 180 VPEVKDIRTV 189
           +P++K +++ 
Sbjct: 178 LPQIKAVQSA 187


>gi|84683414|ref|ZP_01011317.1| nifU domain protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84668157|gb|EAQ14624.1| nifU domain protein [Rhodobacterales bacterium HTCC2654]
          Length = 186

 Score =  207 bits (526), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 134/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQEVLEAGTADFPSAEAAAKSPLAQRVFAVNGVKGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEHF SG P++  G       +  G       D+ +V 
Sbjct: 61  VTVTKADDVEWDHVKPAILGAIMEHFQSGAPVMGEGPREAAHAEHDGP------DAEIVV 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKDLLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLKHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|67633331|gb|AAY78582.1| predicted thioredoxin-like protein [uncultured bacterium
           MedeBAC82F10]
          Length = 185

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QTE TPNPATLKF+PG+ V+ EG I F N   A  SPLA  +F+I G+ SV+FG DF
Sbjct: 1   MFVQTEPTPNPATLKFLPGREVMKEGTIFFQNQDSAVNSPLAQNLFNIKGVESVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K +  +W  ++P +LG I+EHF    P+I        K        + E+DS VV+
Sbjct: 61  ITITKAEANEWTLMKPAILGCIIEHFTMNKPVIS-------KQAPRTEHTYDENDSDVVK 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD +VRPAVA DGGDI+F  Y +GIVFL M+GAC GCPS++ TLK G+ N+L H+
Sbjct: 114 KIKELLDTKVRPAVAMDGGDIIFDKYNEGIVFLQMQGACQGCPSSTATLKMGIENMLKHY 173

Query: 180 VPEVKDIRTV 189
           +PEV+++R V
Sbjct: 174 IPEVREVRPV 183


>gi|255264504|ref|ZP_05343846.1| NifU domain protein [Thalassiobium sp. R2A62]
 gi|255106839|gb|EET49513.1| NifU domain protein [Thalassiobium sp. R2A62]
          Length = 187

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDMGTADFPSAEAAEKSPLAKRIFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEH+ SG  +I     G+      G  +    D+ +V 
Sbjct: 61  VTVTKGDDIEWDHIKPAILGAVMEHYQSGAAVID----GEAPTSG-GHAEHTGEDAEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFLGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVLEVRPV 185


>gi|27375911|ref|NP_767440.1| hypothetical protein bll0800 [Bradyrhizobium japonicum USDA 110]
 gi|27349049|dbj|BAC46065.1| bll0800 [Bradyrhizobium japonicum USDA 110]
          Length = 189

 Score =  204 bits (519), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 138/187 (73%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VV+    + F++ + A  SPLA ++F +PG+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVVDGSPMEFASRESAARSPLAEKLFEVPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K   +W+ L+P +LG IMEH++SG P++ +G        D     F E+D+  V  
Sbjct: 61  ITVTKANGEWQQLKPAILGAIMEHYMSGAPLLADGAAQSDADLDDEDEFFDEADAETVDM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIR 187
           P+V ++R
Sbjct: 181 PDVVEVR 187


>gi|114769272|ref|ZP_01446898.1| nifU domain protein [alpha proteobacterium HTCC2255]
 gi|114550189|gb|EAU53070.1| nifU domain protein [alpha proteobacterium HTCC2255]
          Length = 186

 Score =  204 bits (519), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 132/190 (69%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ V+  G   F + +    SPLA RIF++ G  +V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVMNMGTADFPSPQAGSSSPLAKRIFAVDGATAVFLGPDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+ K +  DW+H++P +LG IMEHF SG P+I        + +  G  +    DS +V 
Sbjct: 61  VTITKTEDADWDHIKPALLGAIMEHFQSGQPVIEG------EDNSGGHAEHTGEDSDIVN 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKDLLDTRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTITLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|119383283|ref|YP_914339.1| NifU domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119373050|gb|ABL68643.1| nitrogen-fixing NifU domain protein [Paracoccus denitrificans
           PD1222]
          Length = 184

 Score =  203 bits (517), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F     A  SPLA RIF++PG+  V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGETVLGSGTADFPAPDTAAASPLARRIFAVPGVTGVFLGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W+HL+P VLG IMEH+ SG P I             G  D    D+ +V 
Sbjct: 61  VTVTKAEDAVWDHLKPSVLGAIMEHYQSGAPAIEGATAS-------GHNDQDGPDAEIVN 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 173

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 174 IPEVTEVRPV 183


>gi|296533479|ref|ZP_06896057.1| NifU domain protein [Roseomonas cervicalis ATCC 49957]
 gi|296266192|gb|EFH12239.1| NifU domain protein [Roseomonas cervicalis ATCC 49957]
          Length = 187

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/191 (53%), Positives = 135/191 (70%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL-VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFI+TE TPNPATLKF+PGQ V+   G   F+NA  A  SPLA R+F + G+A ++ G D
Sbjct: 1   MFIETEATPNPATLKFLPGQDVMGSRGTADFTNAGAAARSPLAERLFGLEGVARIFLGSD 60

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K +  +W+ L+P VLG IMEH ++G P++     GD  L+D        +D+ +V
Sbjct: 61  FITVTKAEGVEWQALKPQVLGAIMEHVMAGRPVVLEEE-GDAALEDSDP-----ADAEIV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L ++GACSGCPS+  TLK+GV N+L H
Sbjct: 115 AQIKELLDTRVRPAVAGDGGDIVFRGFRDGIVKLHLQGACSGCPSSRATLKHGVENMLRH 174

Query: 179 FVPEVKDIRTV 189
           +VPEV  +  V
Sbjct: 175 YVPEVMAVEQV 185


>gi|163744246|ref|ZP_02151606.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45]
 gi|161381064|gb|EDQ05473.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45]
          Length = 186

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/193 (50%), Positives = 130/193 (67%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F        SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPTPDAGATSPLAQRLFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPII---HNGGLGDMKLDDMGSGDFIESDSA 116
           +TV K D  +W+H++P +LG IMEHF SGD ++   H    G    D          D  
Sbjct: 61  VTVTKQDAVEWDHVKPALLGAIMEHFQSGDAVMASDHQPTSGHAAHDG--------EDGE 112

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L
Sbjct: 113 IVGQIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLL 172

Query: 177 NHFVPEVKDIRTV 189
            H++PEV ++R V
Sbjct: 173 RHYIPEVTEVRPV 185


>gi|75674208|ref|YP_316629.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255]
 gi|74419078|gb|ABA03277.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255]
          Length = 190

 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/180 (51%), Positives = 134/180 (74%), Gaps = 1/180 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G + F++A     SPLA ++F++ G+A V++G DF
Sbjct: 1   MFIQTEITPNPATLKFLPGRTVLGKGTMEFTSASTTARSPLAVKLFAVHGVAGVFYGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV KD+  DW+HL+P +LG+IMEH+++G P++ +G        D     F E+D+  V 
Sbjct: 61  ITVTKDEGSDWQHLKPAILGVIMEHYMAGAPLLADGEGCSEANADSDVEFFDEADAETVT 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++ RVRP VA DGGDI F+G+RDGIV+++M+GACSGCPS++ TL+ G+ N+L HF
Sbjct: 121 LIKDLIETRVRPGVADDGGDITFRGFRDGIVYVNMKGACSGCPSSTVTLRNGIQNLLKHF 180


>gi|84515908|ref|ZP_01003269.1| nifU domain protein [Loktanella vestfoldensis SKA53]
 gi|84510350|gb|EAQ06806.1| nifU domain protein [Loktanella vestfoldensis SKA53]
          Length = 187

 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA+ A+ SPLA RIF+  G++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPNAEAAQHSPLAQRIFAAGGVSGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG  ++      D K    G  +    D  +V 
Sbjct: 61  VTVTKADGAEWDHIKPGILGAIMEHYQSGQSVM----AADHKPVS-GHAEHSGEDGDIVT 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVIEVRPV 185


>gi|114326814|ref|YP_743971.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314988|gb|ABI61048.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis
           CGDNIH1]
          Length = 186

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG+ V+  G   F++A  A+ SPLA  +F +PGIA V+ G DF
Sbjct: 1   MFIETEGTPNPATLKFLPGRDVMPGGTADFASAATAQRSPLALALFELPGIARVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K    +W  L+P VL  +M+HF++G P++++         D+   D    D  +V 
Sbjct: 61  VTVTKSSDVEWPELKPQVLAALMDHFVTGRPVLND------TPSDVLEEDIRPEDREIVD 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+GYRDG+V L M+GACSGCPS+  TLK+G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAGDGGDIVFRGYRDGVVLLHMQGACSGCPSSRATLKHGIENMLRHY 174

Query: 180 VPEVKDIRTV 189
           VPEV  +  V
Sbjct: 175 VPEVLAVEQV 184


>gi|126734863|ref|ZP_01750609.1| NifU-like domain protein [Roseobacter sp. CCS2]
 gi|126715418|gb|EBA12283.1| NifU-like domain protein [Roseobacter sp. CCS2]
          Length = 187

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (68%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA RIF   G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPSAEAAENSPLAKRIFDAGGVTGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG  +     + +      G  +    D  +V 
Sbjct: 61  VTVTKADDVEWDHIKPGILGAIMEHYQSGQSV-----MAEDHKPVSGHAEHTGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|254453730|ref|ZP_05067167.1| NifU domain protein [Octadecabacter antarcticus 238]
 gi|198268136|gb|EDY92406.1| NifU domain protein [Octadecabacter antarcticus 238]
          Length = 186

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 131/190 (68%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F + + A  SPLA RIF + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPSVEAAGKSPLAGRIFGVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  +W+H++P +LG +MEH+ SG  ++     G       G  +    D+ +V 
Sbjct: 61  ITVTKADDVEWDHIKPAILGAVMEHYQSGAAVMTGEQAGS------GHAEHTGEDADIVN 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRPV 184


>gi|170747078|ref|YP_001753338.1| scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831]
 gi|170653600|gb|ACB22655.1| Scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831]
          Length = 188

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 142/191 (74%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL E      +A+ A  SPLA+ +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLAESTFEARDAEAAARSPLAAALFTVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF SG P++  GG G++   + G   + E+D   V
Sbjct: 61  ISVTKAEDGSEWAQVKPAVLGAIMEHFQSGAPVMAEGGHGEI---EPGDEFYDEADHDTV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GY++G+V+L M+GACSGCPS++ TL++GV N+  H
Sbjct: 118 VTIKDLLETRVRPAVAGDGGDITFRGYKEGVVYLEMKGACSGCPSSTATLRHGVQNLFRH 177

Query: 179 FVPEVKDIRTV 189
           F+PE+++++ +
Sbjct: 178 FLPEIREVQAI 188


>gi|254454487|ref|ZP_05067924.1| NifU domain protein [Octadecabacter antarcticus 238]
 gi|198268893|gb|EDY93163.1| NifU domain protein [Octadecabacter antarcticus 238]
          Length = 183

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 134/190 (70%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ++ TPNPATLKF+PG  V+ +G + F   ++A  SPLAS++F + G+  V+FG DF
Sbjct: 1   MFIQSQQTPNPATLKFLPGVAVMEQGTVSFPTREDAARSPLASQLFDVNGVDGVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW  L+P +LG IMEHF SG P+++     D  + D    D    D  +V 
Sbjct: 61  ITVTKTDDMDWTPLKPAILGAIMEHFTSGQPLLNE----DASMSDHAVSD---DDDELVT 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F G+  G+V+L ++GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDILFHGFERGVVYLQLQGACSGCPSSTATLKGGIENMLRHY 173

Query: 180 VPEVKDIRTV 189
           +P+V ++R +
Sbjct: 174 IPDVIEVRAI 183


>gi|146278315|ref|YP_001168474.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556556|gb|ABP71169.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 186

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/190 (53%), Positives = 136/190 (71%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F++A+ A  SPLA RIF   G+ASV+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFASAEAAATSPLARRIFGAGGVASVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I V K D+  W+H++P +LG IMEH+ SG P++     G+       + D    D  +V+
Sbjct: 61  IAVTKEDEVVWDHVKPAILGAIMEHYQSGAPVLE----GEQAASGHATHD--GPDEEIVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|77462766|ref|YP_352270.1| nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1]
 gi|77387184|gb|ABA78369.1| Nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1]
          Length = 186

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+ A+ A  SPLA RIF+  G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATAEAAATSPLARRIFAAGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++     G+       S D  + D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLE----GEQAASGHASHDGPDED--VVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|83594860|ref|YP_428612.1| nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170]
 gi|83577774|gb|ABC24325.1| Nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170]
          Length = 183

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 136/190 (71%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPA+LKF+PG+ VL  G   F++   A  SPLA R+F+I G+  +Y G DF
Sbjct: 1   MFIQTERTPNPASLKFLPGKAVLPGGGRDFADVGAAGPSPLARRLFAIDGVTGIYLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K +  DW+ ++P VLG IMEHF SG+P++  G       +  GS +    D  VV+
Sbjct: 61  ITVSKAEAEDWQVIKPLVLGAIMEHFTSGEPVLIAG----TAAESAGSAE----DDEVVR 112

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+++L+ RVRPAVA+DGGDIVF  ++DG+V+L +RG+CSGCPS++ TLK+G+ N+L H+
Sbjct: 113 QIRDLLETRVRPAVAQDGGDIVFDRFQDGVVYLHLRGSCSGCPSSTATLKHGIENMLRHY 172

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 173 IPEVEAVEAV 182


>gi|92115649|ref|YP_575378.1| nitrogen-fixing NifU-like [Nitrobacter hamburgensis X14]
 gi|91798543|gb|ABE60918.1| nitrogen-fixing NifU-like protein [Nitrobacter hamburgensis X14]
          Length = 191

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 131/181 (72%), Gaps = 2/181 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G + F+    A  S LA R+F++ G+  V++G DF
Sbjct: 1   MFIQTEVTPNPATLKFLPGRTVLGKGTMEFNGPDTAGRSQLAVRLFAVHGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG--DMKLDDMGSGDFIESDSAVV 118
           ITV KD  DW+HL+P +LG+IMEH++SG P++ +G     D    D     F E+D+  V
Sbjct: 61  ITVTKDASDWQHLKPAILGVIMEHYMSGAPLLADGETAGNDEANKDEAVEFFDEADAETV 120

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++++ RVRP VA DGGDI F+G++DG+V+++M+G+CSGCPS++ TL+ G+ N+L H
Sbjct: 121 TLIKDLIETRVRPGVADDGGDITFRGFKDGVVYVNMKGSCSGCPSSTVTLRNGIQNLLKH 180

Query: 179 F 179
           F
Sbjct: 181 F 181


>gi|329114732|ref|ZP_08243489.1| Scaffold Protein Nfu/NifU [Acetobacter pomorum DM001]
 gi|326695863|gb|EGE47547.1| Scaffold Protein Nfu/NifU [Acetobacter pomorum DM001]
          Length = 186

 Score =  198 bits (503), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 136/192 (70%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TE TPNPATLKF+PGQ V+ + G I F +A   A  SPLA  +F++PG++ V+ G 
Sbjct: 1   MFIETEGTPNPATLKFLPGQAVMGDAGTIDFIDADAVAGRSPLAEALFALPGVSRVFLGN 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D  DWE LRP +L  +M+HF++G P++  G    + + +  +      D  +
Sbjct: 61  DFVSVTKADSEDWEELRPQILSTLMDHFVAGHPVVAEG----VAVTEDATA---PEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+LD RVRPAVA DGGDIVF+GYR+GIV L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VTQIKELLDTRVRPAVAGDGGDIVFRGYRNGIVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|209965893|ref|YP_002298808.1| NifU-like domain protein [Rhodospirillum centenum SW]
 gi|209959359|gb|ACI99995.1| NifU-like domain protein [Rhodospirillum centenum SW]
          Length = 186

 Score =  197 bits (502), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNPATLKF+PG+ VL  G   F+  + A  SPLA+R+F + G+  V+ G DF
Sbjct: 1   MFIQTEETPNPATLKFLPGRDVLGRGTADFAGPETAGPSPLAARLFEVEGVTRVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW  L+P VLG++MEHF +G P++  G       DD  +      D  VV 
Sbjct: 61  VTVTKTEDKDWYALKPSVLGVLMEHFTAGRPVLLEG-----TADDGHAEAANAEDEEVVA 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDIRVRPAVAQDGGDITFHGFDKGVVYLHMKGACAGCPSSTATLKAGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRQV 185


>gi|295687469|ref|YP_003591162.1| Scaffold protein Nfu/NifU [Caulobacter segnis ATCC 21756]
 gi|295429372|gb|ADG08544.1| Scaffold protein Nfu/NifU [Caulobacter segnis ATCC 21756]
          Length = 191

 Score =  197 bits (500), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 129/190 (67%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VLVEGA  F  A+E E SPLA  +F +  +  V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLVEGAREFRTAEEGEASPLAKALFDLGDVTRVFFGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +   G    +D   G + E  S +V 
Sbjct: 61  LTVTKGEAAQWPHLKAPILAAIMDHFTSGRPLLLDAEPGGGHDED---GVYDEEASQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +  + G+V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 118 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKAGVENMLK 177

Query: 178 HFVPEVKDIR 187
           H+VPEV  + 
Sbjct: 178 HYVPEVTRVE 187


>gi|85714190|ref|ZP_01045179.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A]
 gi|85699316|gb|EAQ37184.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A]
          Length = 190

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/181 (49%), Positives = 135/181 (74%), Gaps = 3/181 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +  + F++A     SPLA ++F++ G+  V++G DF
Sbjct: 1   MFIQTEITPNPATLKFLPGRTVLGKDTMEFTSASTTARSPLAVKLFAVHGVTGVFYGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVV 118
           ITV KD   DW+HL+P +LG+IMEH++SG P++ + G G+ + +     +F  E+D+  V
Sbjct: 61  ITVTKDDASDWQHLKPAILGVIMEHYMSGAPLLADDG-GNTEPNAENDVEFFDEADAETV 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++++ RVRP VA DGGDI F+G++DG+V+++M+GACSGCPS++ TL+ G+ N+L H
Sbjct: 120 TLIKDLIETRVRPGVADDGGDITFRGFKDGVVYVNMKGACSGCPSSTVTLRNGIQNLLKH 179

Query: 179 F 179
           F
Sbjct: 180 F 180


>gi|288959669|ref|YP_003450010.1| thioredoxin [Azospirillum sp. B510]
 gi|288911977|dbj|BAI73466.1| thioredoxin [Azospirillum sp. B510]
          Length = 185

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F+  ++A  SPLA R+F I G+  V+ G DF
Sbjct: 1   MFIQTEQTPNPATLKFLPGRDVLGRGTADFTGREDAARSPLAQRLFEIEGVVGVFLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K D  DW  L+P +LG+IMEHF +  P++        +  D  +      D  +V+
Sbjct: 61  ITITKTDARDWFLLKPSILGVIMEHFTADRPVLLE------EGGDGHAAAASADDEEIVE 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRP+VA+DGGDI F+G+  G+V+L+M+GACSGCPS++ TLK+G+ N+L H+
Sbjct: 115 QIKELLDTRVRPSVAQDGGDITFQGFERGVVYLAMKGACSGCPSSTATLKHGIENMLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRAV 184


>gi|197106919|ref|YP_002132296.1| thioredoxin-like protein [Phenylobacterium zucineum HLK1]
 gi|196480339|gb|ACG79867.1| thioredoxin-like protein [Phenylobacterium zucineum HLK1]
          Length = 191

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 129/190 (67%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL EG   F + +EA+ SPLA+ IF I G+  V+FG DF
Sbjct: 1   MFIQTEATPNPEVLKFLPGRAVLGEGTRDFGSMEEAQASPLAADIFDIEGVTRVFFGPDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TVGK   +DW HL+ PVL  IM+HF SG P+    G      D+   G +    + +V 
Sbjct: 61  LTVGKHPSFDWPHLKAPVLAAIMDHFTSGRPLFAEAGEQAGGHDE---GAYEGETAQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IK++LD R+RPAVA+DGGDI+F  +    G+V+L+MRGACSGCPS++ TLK GV N+L 
Sbjct: 118 EIKDLLDTRIRPAVAQDGGDILFHKFEPDTGVVWLNMRGACSGCPSSTATLKAGVENMLK 177

Query: 178 HFVPEVKDIR 187
           H+VPEV  + 
Sbjct: 178 HYVPEVTRVE 187


>gi|258541120|ref|YP_003186553.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632198|dbj|BAH98173.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635255|dbj|BAI01224.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638310|dbj|BAI04272.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641364|dbj|BAI07319.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644419|dbj|BAI10367.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647474|dbj|BAI13415.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650527|dbj|BAI16461.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653518|dbj|BAI19445.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 186

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/192 (51%), Positives = 132/192 (68%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TE TPNPATLKF+PGQ V+ + G I F +A   A  S LA  +F++PG++ V+ G 
Sbjct: 1   MFIETEGTPNPATLKFLPGQAVMGDAGTIDFIDADAVAGRSSLAEALFALPGVSRVFLGN 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D  DWE LRP +L  +M+HF++G P++  G         +        D  +
Sbjct: 61  DFVSVTKADSEDWEELRPQILSTLMDHFVAGHPVVAEGVA-------VTEDAIAPEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+LD RVRPAVA DGGDIVF+GYR+GIV L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VTQIKELLDTRVRPAVAGDGGDIVFRGYRNGIVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|148555295|ref|YP_001262877.1| scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1]
 gi|148500485|gb|ABQ68739.1| Scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1]
          Length = 192

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F +  EA  SPLA  +FS+  +  V+FG DF
Sbjct: 4   MLIETEPTPNPATLKFLPGRPVMTTGTRDFVDPDEASASPLAEALFSLGDVTGVFFGRDF 63

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAV 117
           ++V   +  +W  L+P VLG++++HF S  P+   G   ++ +DD    DF +  +D+ +
Sbjct: 64  VSVTAAEGVEWTGLKPQVLGVLLDHFSSEAPLFTGGSAAEIAIDD---SDFTDDPADADI 120

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IK+++D RVRPAVARDGGDIV++G++ G V+LSM+GACSGCPS++ TLK G+  +L 
Sbjct: 121 VAQIKDLIDTRVRPAVARDGGDIVYRGFQRGTVYLSMQGACSGCPSSAATLKQGIETLLK 180

Query: 178 HFVPEVKDIR 187
           H+VPEV ++R
Sbjct: 181 HYVPEVTEVR 190


>gi|294085162|ref|YP_003551922.1| nitrogen-fixing NifU domain-containing protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664737|gb|ADE39838.1| nitrogen-fixing NifU domain protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 187

 Score =  193 bits (491), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 129/189 (68%), Gaps = 6/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNPATLKFIPG  VL +G   F  A  A  SP+A R+F + G+A V+ G DF
Sbjct: 1   MFIQTQDTPNPATLKFIPGVPVLEQGTADFPAADSAGSSPMARRLFQVDGVAGVFLGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I V K D+ DW  L+P +L  IMEHF SG P+I +   G+M   +       + D   V+
Sbjct: 61  IAVTKVDEMDWFALKPSILAGIMEHFASGLPVIEDNA-GNMTDANTDD----DEDDDTVK 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD RVRPAVA DGGDIVF+ + DG+V L MRGAC GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKHLLDTRVRPAVAMDGGDIVFQDFDDGVVTLQMRGACQGCPSSTATLKMGIENMLKHY 175

Query: 180 VPEVKDIRT 188
           +P+V+++R 
Sbjct: 176 IPQVREVRA 184


>gi|221232999|ref|YP_002515435.1| mitochondrial-type Fe-S cluster assembly protein NFU [Caulobacter
           crescentus NA1000]
 gi|220962171|gb|ACL93527.1| mitochondrial-type Fe-S cluster assembly protein NFU [Caulobacter
           crescentus NA1000]
          Length = 190

 Score =  191 bits (486), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 128/190 (67%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL +GA  F   +E + SPLA  +F +  ++ V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLGDGAREFRTPEEGDASPLAKALFELGDVSRVFFGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +        D+   GD+ E  S +V 
Sbjct: 61  LTVTKGEDAQWPHLKAPILAAIMDHFTSGRPLLLDQTAESGGHDE---GDYDEETSQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +  + G+V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 118 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKSGVENMLK 177

Query: 178 HFVPEVKDIR 187
           H+VPEV  + 
Sbjct: 178 HYVPEVTRVE 187


>gi|16124317|ref|NP_418881.1| NifU-like domain-containing protein [Caulobacter crescentus CB15]
 gi|13421157|gb|AAK22049.1| NifU-like domain protein [Caulobacter crescentus CB15]
          Length = 224

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/189 (50%), Positives = 128/189 (67%), Gaps = 6/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL +GA  F   +E + SPLA  +F +  ++ V+FG DF
Sbjct: 35  MFIQTETTPNPEVLKFLPGREVLGDGAREFRTPEEGDASPLAKALFELGDVSRVFFGPDF 94

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +        D+   GD+ E  S +V 
Sbjct: 95  LTVTKGEDAQWPHLKAPILAAIMDHFTSGRPLLLDQTAESGGHDE---GDYDEETSQIVA 151

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +  + G+V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 152 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKSGVENMLK 211

Query: 178 HFVPEVKDI 186
           H+VPEV  +
Sbjct: 212 HYVPEVTRV 220


>gi|23006361|ref|ZP_00048716.1| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum
           magnetotacticum MS-1]
          Length = 184

 Score =  190 bits (483), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 91/179 (50%), Positives = 125/179 (69%), Gaps = 5/179 (2%)

Query: 13  TLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ--YDW 70
           TLKF+PG+VVL EG     +A  AE SPLAS +F++PG++ VYFG+DFI+V K     +W
Sbjct: 9   TLKFLPGRVVLTEGTFEARDASSAERSPLASALFAVPGVSGVYFGHDFISVTKADGVNEW 68

Query: 71  EHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVR 130
             ++P VLG IM+HF SG P++  G       +D     + E+D   V  IK++L+ RVR
Sbjct: 69  PQVKPAVLGAIMDHFQSGRPVLAEG---TALAEDDAEEFYDEADHDTVATIKDLLETRVR 125

Query: 131 PAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           PAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  HF+P V++++ V
Sbjct: 126 PAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPSVREVQAV 184


>gi|167643992|ref|YP_001681655.1| scaffold protein Nfu/NifU [Caulobacter sp. K31]
 gi|167346422|gb|ABZ69157.1| Scaffold protein Nfu/NifU [Caulobacter sp. K31]
          Length = 189

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 126/190 (66%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL EGA  F  A+E + SPLA  +F +  +  V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLGEGAREFKTAEEGDASPLAEALFRLGDVNRVFFGPDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W HL+ P+L  IM+HF SG P++    L   +      G + E  S +V 
Sbjct: 61  LTVTKAEGAEWPHLKAPILAAIMDHFTSGRPLL----LDQAESGHDNDGVYDEETSQIVA 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IK++LD R+RPAVA+DGGDIVF  +    G+V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 117 EIKDLLDTRIRPAVAQDGGDIVFSKFEPATGVVWLHMRGACSGCPSSSATLKAGVENMLK 176

Query: 178 HFVPEVKDIR 187
           H+VPEV  + 
Sbjct: 177 HYVPEVTRVE 186


>gi|296282499|ref|ZP_06860497.1| hypothetical protein CbatJ_02705 [Citromicrobium bathyomarinum
           JL354]
          Length = 192

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 134/190 (70%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M+I+TE TPNPATLKF+P + V+ +G   F+N ++AE SPLA  +F    +  V+FG DF
Sbjct: 1   MYIETETTPNPATLKFLPQRQVMPQGTRDFANPEDAEASPLAQALFDTGEVTGVFFGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL--DDMGSGDFIESDSAV 117
           ++V K +   W  L+P ++ ++++HF+S  P+ H G    +++  +D  + +   +D+ +
Sbjct: 61  VSVTKGEGTQWTELKPQIVAVLLDHFVSEAPLFHGGSAAGIEVPAEDTLTVEEDPADADI 120

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+L+ R+RPAVA DGGDI ++GYRDG+V L ++GAC GCPS++ TLK+G+  +L 
Sbjct: 121 VDQIKELLETRIRPAVAGDGGDIAYRGYRDGVVHLQLQGACDGCPSSTATLKHGIEGLLK 180

Query: 178 HFVPEVKDIR 187
           H+VPEV ++R
Sbjct: 181 HYVPEVVEVR 190


>gi|103487552|ref|YP_617113.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256]
 gi|98977629|gb|ABF53780.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256]
          Length = 190

 Score =  188 bits (477), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 136/191 (71%), Gaps = 3/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F++A+EAE SPLAS +FS+  +  V+FG DF
Sbjct: 1   MLIETESTPNPATLKFLPGRTVMETGTRDFASAEEAEASPLASALFSLGDVTGVFFGRDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-MKLDDMGSGDFIESDSAVV 118
           ++V      +W  ++P VLG++M+HF++G P+ +    G  +  +D G  D   +D+ ++
Sbjct: 61  VSVTIAPGAEWADVKPDVLGIVMDHFLAGVPLFNAASAGSAVPPEDAGFAD-DPADADII 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++IKE+++ RVRPAVA DGGDIV++G+  G V+L M+GAC+GCPS++ TLK G+ ++L H
Sbjct: 120 EQIKELIETRVRPAVANDGGDIVYRGFDKGNVYLKMQGACAGCPSSTATLKNGIESLLKH 179

Query: 179 FVPEVKDIRTV 189
           +VPEV  +  V
Sbjct: 180 YVPEVTAVHAV 190


>gi|326403969|ref|YP_004284051.1| hypothetical protein ACMV_18220 [Acidiphilium multivorum AIU301]
 gi|325050831|dbj|BAJ81169.1| hypothetical protein ACMV_18220 [Acidiphilium multivorum AIU301]
          Length = 185

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNPATLKF+PG+ VL +G+  F +A  A  SPLA  +F++PG+  V+ G DF
Sbjct: 1   MFIETDVTPNPATLKFLPGREVLGQGSADFDSADAAAASPLAEALFALPGVVRVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V +D+  +W  L+P VLG IMEH++SG P++        ++D+    D   +D  +  
Sbjct: 61  VSVTRDEGTEWTSLKPQVLGAIMEHYLSGRPVMAGA---QAEVDE----DVDPADREIAD 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDMRVRPAVAGDGGDIVFRGFRDGIVSLHMQGACSGCPSSTATLKMGIENLLKHY 173

Query: 180 VPEVKDIRTV 189
           VPEVK +R V
Sbjct: 174 VPEVKSVRQV 183


>gi|144900396|emb|CAM77260.1| NifU domain protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 182

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 140/191 (73%), Gaps = 12/191 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNP+TLKF+PG+ V+  G   F +A+ A  SPLA+++F++ G+ASV+ G DF
Sbjct: 1   MFIQTENTPNPSTLKFLPGREVMPAGTADFGSAEAAIRSPLAAKLFTVDGVASVFLGGDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITVGK +   W  L+P +L  IM+ F +G  P+I+ G       + +  G+  E+D  +V
Sbjct: 61  ITVGKTEAATWGTLKPLLLSAIMDFFTAGLLPVINEG------TEKVSDGE--ETD--IV 110

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++IKE+LD RVRPAVA+DGGDI+F+ + DGIV++ ++GACSGCPS++ TLK+G+ N+L +
Sbjct: 111 RQIKELLDTRVRPAVAQDGGDIIFRSFDDGIVYVHLQGACSGCPSSTATLKHGIENMLKY 170

Query: 179 FVPEVKDIRTV 189
           +VPEV  ++ V
Sbjct: 171 YVPEVVAVQAV 181


>gi|94498004|ref|ZP_01304568.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58]
 gi|94422587|gb|EAT07624.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58]
          Length = 194

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 135/192 (70%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KFIPG+VV+  G   F++ +EAE SPLAS +F++  +  V+FG DF
Sbjct: 4   MLIETEPTPNPATVKFIPGRVVMGAGTRDFASPEEAEASPLASALFTLGDVTGVFFGGDF 63

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL--DDMGSGDFIESDSAV 117
           I+V   +  DW  ++P VL +++EHF +  P+   G  G++ +  DD    +  E D+ +
Sbjct: 64  ISVTIGEGSDWRDVKPEVLSILLEHFSANMPLFVAGSAGEIHVPADDDAFAENPE-DAEI 122

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +I+E++D RVRPAVA DGGDI+++G+  G V+L M+GAC+GCPS+S TLK G+  +L 
Sbjct: 123 VDQIRELIDTRVRPAVANDGGDIIYRGFDKGTVYLKMQGACAGCPSSSATLKNGIEQLLK 182

Query: 178 HFVPEVKDIRTV 189
           H+VPEV ++R V
Sbjct: 183 HYVPEVTEVRAV 194


>gi|148260770|ref|YP_001234897.1| NifU domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146402451|gb|ABQ30978.1| nitrogen-fixing NifU domain protein [Acidiphilium cryptum JF-5]
          Length = 185

 Score =  186 bits (473), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 136/190 (71%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNPATLKF+PG+ VL +G+  F +A  A  SPLA  +F++PG+  V+ G DF
Sbjct: 1   MFIETDVTPNPATLKFLPGREVLGQGSADFDSADAAAASPLAEALFALPGVVRVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V +D   +W  L+P VLG IMEH++SG P++        ++D+    D   +D  +  
Sbjct: 61  VSVTRDDGTEWTSLKPQVLGAIMEHYLSGRPVMAGA---QAEVDE----DVDPADREIAD 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDMRVRPAVAGDGGDIVFRGFRDGIVSLHMQGACSGCPSSTATLKMGIENLLKHY 173

Query: 180 VPEVKDIRTV 189
           VPEVK +R V
Sbjct: 174 VPEVKSVRQV 183


>gi|149186788|ref|ZP_01865099.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21]
 gi|148829696|gb|EDL48136.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21]
          Length = 193

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 131/191 (68%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPA+LKF+PG+ V+ +G   F+N + AE SPLA  IF    + +V+FG DF
Sbjct: 1   MFIETETTPNPASLKFLPGRPVMGQGTREFANPEAAEASPLAQAIFDTGEVVNVFFGGDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA--- 116
           ITV       W  L+P VL ++++HF+S  P+   G  G + +        +E ++A   
Sbjct: 61  ITVTSAPGVSWSDLKPQVLSILLDHFVSEAPLFVPGTAGGIAVPAEDEALLVEENAADAD 120

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +I E+L+ RVRPAVA DGGDI ++G++DG+V+L ++GACSGCPS++ TLK+G+  +L
Sbjct: 121 IVAQINELLETRVRPAVAGDGGDIQYRGFKDGVVYLQLQGACSGCPSSTATLKHGIEGLL 180

Query: 177 NHFVPEVKDIR 187
            H+VPEV ++R
Sbjct: 181 KHYVPEVVEVR 191


>gi|190571129|ref|YP_001975487.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018533|ref|ZP_03334341.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357401|emb|CAQ54835.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995484|gb|EEB56124.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 190

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 133/191 (69%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA  +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFEILSEGETADFSNADEIKNSKLAVNLFQIEHVVRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D+ +W+ ++  +L  IM+HF SG       G+ D K+  +    F E+D  +V
Sbjct: 61  FISVTKSDRMNWDIVKVEILTTIMDHFTSGGKAFDKEGVSDNKM--LEEEFFNENDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 119 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 178

Query: 179 FVPEVKDIRTV 189
            +PEV  I T+
Sbjct: 179 HIPEVSGIETM 189


>gi|330991171|ref|ZP_08315124.1| NFU1 iron-sulfur cluster scaffold-like protein [Gluconacetobacter
           sp. SXCC-1]
 gi|329761757|gb|EGG78248.1| NFU1 iron-sulfur cluster scaffold-like protein [Gluconacetobacter
           sp. SXCC-1]
          Length = 187

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/193 (49%), Positives = 128/193 (66%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH--FSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++  GA     S    A  S LA  +F + G+A V+FG 
Sbjct: 1   MFIETEDTPNPATLKFLPGREIMANGATADFISPDSVAGRSRLAELLFDLDGVARVFFGA 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSA 116
           DF+ V + D  +WE LRP VL ++ ++  +G  ++ +        D     D I   D  
Sbjct: 61  DFVAVTRSDSVEWEGLRPQVLAVLADYLATGQAVVES--------DAQVVEDLIAPGDEE 112

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +VQ+IKE+LD RVRPAVA DGGDIVF+GYRDG+V L+M+GACSGCPS+  TLK+GV N+L
Sbjct: 113 IVQQIKELLDTRVRPAVAGDGGDIVFRGYRDGVVRLTMQGACSGCPSSRATLKHGVENML 172

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 173 RHYVPEVVSVEQV 185


>gi|329847368|ref|ZP_08262396.1| scaffold protein Nfu/NifU [Asticcacaulis biprosthecum C19]
 gi|328842431|gb|EGF92000.1| scaffold protein Nfu/NifU [Asticcacaulis biprosthecum C19]
          Length = 188

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 129/194 (66%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  +KF+PGQVVL +G   F +  EA++SPLA  +F I G+++++FG DF
Sbjct: 1   MFIQTEATPNPDVIKFLPGQVVLAQGTKQFVSEDEAKVSPLAEALFKIDGVSALFFGSDF 60

Query: 61  ITVGKD---QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV +D      W  L+PP+L  IM+ + SG PI+      ++K + +  G+       +
Sbjct: 61  LTVRRDPDATLIWAQLKPPILAAIMDFYTSGQPILRE---TEVKTETVYEGEL----GQI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +  IK++LD RVRPAVA+DGGDI F  +    G ++L MRGAC+GCPS+S TL+ GV ++
Sbjct: 114 IAEIKDLLDTRVRPAVAQDGGDIEFDSFDMESGTLYLHMRGACAGCPSSSATLRQGVESL 173

Query: 176 LNHFVPEVKDIRTV 189
           + H+VPEV+ I  V
Sbjct: 174 MKHYVPEVRHIEAV 187


>gi|225629714|ref|ZP_03787679.1| NifU domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591431|gb|EEH12506.1| NifU domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 194

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 131/191 (68%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFAILNEGETADFSNADEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F E+D  +V
Sbjct: 65  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNISD--EEFFDENDIEIV 122

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 123 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 182

Query: 179 FVPEVKDIRTV 189
            +PEV  I T 
Sbjct: 183 HIPEVAGIETT 193


>gi|307108001|gb|EFN56242.1| hypothetical protein CHLNCDRAFT_48753 [Chlorella variabilis]
          Length = 209

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/192 (47%), Positives = 129/192 (67%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L FIPGQ VL  G+  F++A+EA  SPLA ++F+I G+  V+FG DF
Sbjct: 1   MFIQTQPTPNPASLMFIPGQKVLEGGSKSFTSAREAMASPLAKKLFAIDGVTQVFFGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAV 117
           +TV K + Y W  L+P V   IM+H+ SG+ + ++         D G+ + +  E D  V
Sbjct: 61  VTVTKSEDYGWAVLKPDVFAAIMDHYSSGEALFYDE-------QDTGAAEHMIHEDDDEV 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+L+ R+RPAV  DGGDIVF+ +    G+V L M GACSGCPS++ TLK G+ N+
Sbjct: 114 VAMIKELLETRIRPAVQEDGGDIVFRTWDPESGVVKLKMMGACSGCPSSAVTLKSGIENM 173

Query: 176 LNHFVPEVKDIR 187
           L H++PEV+ + 
Sbjct: 174 LMHYIPEVRGVE 185


>gi|326386713|ref|ZP_08208334.1| nitrogen-fixing NifU-like protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208766|gb|EGD59562.1| nitrogen-fixing NifU-like protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 191

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 132/190 (69%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG++V+ +G   F++A+EA ISPLA  +FS+  +  V FG +F
Sbjct: 1   MFIETETTPNPATLKFLPGEIVMADGTREFTSAEEAAISPLADALFSLGDVTGVLFGREF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPII--HNGGLGDMKLDDMGSGDFIESDSAV 117
           ++V       W   +P VL ++++HF+S  P+    + G      +D   GD   +D+ +
Sbjct: 61  VSVTIAPGSAWSDTKPQVLAVLLDHFVSQAPLFVAASAGFSVPAEEDEDFGD-DPADADI 119

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +I ++++ R+RPAVA DGGDI ++G+RDG+V+L M+GACSGCPS+S TLK G+  +L 
Sbjct: 120 VDQILDLIETRIRPAVANDGGDISYRGFRDGVVYLRMQGACSGCPSSSATLKNGIEALLK 179

Query: 178 HFVPEVKDIR 187
           H+VPEV ++R
Sbjct: 180 HYVPEVNEVR 189


>gi|255088633|ref|XP_002506239.1| predicted protein [Micromonas sp. RCC299]
 gi|226521510|gb|ACO67497.1| predicted protein [Micromonas sp. RCC299]
          Length = 298

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 131/188 (69%), Gaps = 9/188 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT+ TPNPA+L F+PG+ V  EG   +F+N +E   SPLA ++F I G+ SV+FG D
Sbjct: 94  IFIQTQTTPNPASLMFMPGKPVYEEGGTKNFANPREGMASPLAKKLFLIDGVTSVFFGQD 153

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+TV K ++++W  L+P V   IM+++ SG+PII +    + +L + G+    E D  +V
Sbjct: 154 FVTVTKSEEHEWGTLKPEVFAAIMDYYASGEPIITD----EAELANAGTA-ITEDDDEIV 208

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ R+RPAVA DGGDIVFKG+    G+V + M+GAC GCPS+S TLK G+ N+L
Sbjct: 209 AMIKELLETRIRPAVAEDGGDIVFKGWNADTGVVTVKMQGACDGCPSSSVTLKSGIENML 268

Query: 177 NHFVPEVK 184
            H+VPEV 
Sbjct: 269 RHYVPEVN 276


>gi|83944990|ref|ZP_00957356.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851772|gb|EAP89627.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633]
          Length = 186

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/192 (48%), Positives = 125/192 (65%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTEDTPNP TLKF+PGQ V ++    F+  +EAE S LA  +F + G+  V+ G DF
Sbjct: 1   MFIQTEDTPNPDTLKFLPGQSVSLDAPRDFATPEEAESSYLARELFRVEGVIRVFAGQDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K +  DW H++P VLG IM+   SG  +  +        DD G   +    + +V+
Sbjct: 61  ISVTKAEGVDWPHIKPAVLGAIMDCLESGKSLFSDA-------DDDGHAAYEGEAAGIVK 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
            IK+V+D RVRPAVARDGGDIVF  Y +  G+V L MRGAC+GCPS++ TLK G+ N+L 
Sbjct: 114 EIKDVIDTRVRPAVARDGGDIVFHSYDEATGVVNLHMRGACAGCPSSTMTLKQGIENLLK 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVSSVEAV 185


>gi|308802059|ref|XP_003078343.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
 gi|116056795|emb|CAL53084.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
          Length = 244

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 127/191 (66%), Gaps = 11/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QT+ TPNP +L F PG+ V  EG+ +F +A+EA +SPLA R+F+I G+ +V+ G DF
Sbjct: 40  MFVQTQATPNPESLMFQPGRDVYAEGSRNFGSAREAMVSPLARRLFAIDGVTNVFLGVDF 99

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVV 118
           ITV KD  +DWE ++P     IM+ + SG+ ++    L        G G  IE  D  VV
Sbjct: 100 ITVTKDADHDWETVKPRTFEAIMDFYASGEAVVDEASL-------EGHGTAIEEDDDEVV 152

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ R+RPAVA DGGDIVFK Y    G+V + + GAC GCPS+S TLK G+ N+L
Sbjct: 153 AMIKELLETRIRPAVAEDGGDIVFKAYDQETGVVSVQLMGACDGCPSSSVTLKSGIENML 212

Query: 177 NHFVPEVKDIR 187
            H+VPEVK ++
Sbjct: 213 MHYVPEVKGVQ 223


>gi|162147187|ref|YP_001601648.1| nitrogen fixation protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544240|ref|YP_002276469.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785764|emb|CAP55335.1| putative nitrogen fixation protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531917|gb|ACI51854.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5]
          Length = 187

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 128/192 (66%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH--FSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++   A     S    A  S LA  +F  PG+A V+ G 
Sbjct: 1   MFIETEDTPNPATLKFLPGRTIVPGRATADFVSPDAVAGRSKLADALFGQPGVARVFLGG 60

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF+ V KD+  DW  L+P +L ++++ F+SG P I +    + +L           D  +
Sbjct: 61  DFVAVTKDEATDWSVLKPQLLSVLVDFFVSGMPAIEDDAAVEEEL-------IAPEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V++IKE+LD RVRPAVA DGGDIVF+GYRDG+V L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VRQIKELLDTRVRPAVAGDGGDIVFRGYRDGVVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|182678037|ref|YP_001832183.1| scaffold protein Nfu/NifU [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633920|gb|ACB94694.1| Scaffold protein Nfu/NifU [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 187

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 139/189 (73%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ V+  G +    A  A+ SPLA  +F++ G++ V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRPVMRLGTLDIREADGAKKSPLAEALFALEGVSGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V + Q DW+ ++P VLG IMEH++SG P++ +    D++  + G   + E+D+  V  
Sbjct: 61  ISVTRQQGDWQDIKPAVLGAIMEHYLSGAPLLTDE--ADLQPQNDGEEFYAEADAHTVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++ VRPAVA+DGGDI F+G+R+G V+L+M+G+CSGCPS+S TL++GV N+L H+V
Sbjct: 119 IKQLIESHVRPAVAKDGGDIKFRGFREGTVYLAMKGSCSGCPSSSATLRHGVQNLLKHYV 178

Query: 181 PEVKDIRTV 189
           PEV  +  +
Sbjct: 179 PEVVSVEQI 187


>gi|114571567|ref|YP_758247.1| NifU domain-containing protein [Maricaulis maris MCS10]
 gi|114342029|gb|ABI67309.1| nitrogen-fixing NifU domain protein [Maricaulis maris MCS10]
          Length = 187

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 131/192 (68%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+ +  +G   F + ++A  +PLA+ +F + G++ V+FG DF
Sbjct: 1   MFIQTEATPNPNTLKFLPGREIAPDGPREFESEEDAASAPLAADLFLVDGVSGVFFGEDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I + K D Y+W+H++P +LG IM+   SG P++ +      + ++ G  ++   +  +V+
Sbjct: 61  IAITKTDAYEWDHIKPFLLGTIMDGLQSGRPLVGS------ETNETGHANYAGENEGLVK 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            I E++D RVRPAVA+DGGDI+F  Y    GIV L MRGACSGCPS++ TLK G+ N+L 
Sbjct: 115 EIIELIDTRVRPAVAQDGGDILFHSYLADSGIVRLKMRGACSGCPSSTMTLKSGIENLLK 174

Query: 178 HFVPEVKDIRTV 189
           H++PE++ +  V
Sbjct: 175 HYIPEIQSVEAV 186


>gi|58699011|ref|ZP_00373859.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630807|ref|YP_002727598.1| NifU domain protein [Wolbachia sp. wRi]
 gi|58534475|gb|EAL58626.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592788|gb|ACN95807.1| NifU domain protein [Wolbachia sp. wRi]
          Length = 194

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 131/191 (68%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFEILNEGETTDFSNANEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F ++D  +V
Sbjct: 65  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNIPD--EEFFDKNDIEIV 122

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 123 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 182

Query: 179 FVPEVKDIRTV 189
            +PE+  I T 
Sbjct: 183 HIPEIAGIETT 193


>gi|58697437|ref|ZP_00372735.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536136|gb|EAL59746.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans]
          Length = 190

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 131/191 (68%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFEILNEGETTDFSNANEIKNSKLAANLFQIEHVVRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F ++D  +V
Sbjct: 61  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNIPD--EEFFDKNDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 119 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 178

Query: 179 FVPEVKDIRTV 189
            +PE+  I T 
Sbjct: 179 HIPEIAGIETT 189


>gi|85374519|ref|YP_458581.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594]
 gi|84787602|gb|ABC63784.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594]
          Length = 192

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 132/194 (68%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP+TLKF+PGQ V+  G   F++ +EAE SPLA  IF    + +V+FG DF
Sbjct: 1   MFIETETTPNPSTLKFLPGQQVMPGGTREFTSPEEAEASPLAQAIFDTGEVTNVFFGSDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNG---GLGDMKLDDMGSGDFIES--- 113
           ++V      DW  L+  V+ ++++HF+S  P+   G   G+     DD+     +E    
Sbjct: 61  VSVSAAPGADWSSLKGMVVSILLDHFVSQAPLFVGGDASGISVPAEDDL----LVEENAD 116

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           D+ +V +I E+L+ RVRPAVA DGGDI ++G++DG+V+L+++GACSGCPS++ TLK G+ 
Sbjct: 117 DADIVAQINELLETRVRPAVAGDGGDIAYRGFKDGVVYLTLQGACSGCPSSTATLKQGIE 176

Query: 174 NILNHFVPEVKDIR 187
            +L H+VPEV ++R
Sbjct: 177 GLLKHYVPEVVEVR 190


>gi|42520881|ref|NP_966796.1| NifU domain-containing protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410621|gb|AAS14730.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 191

 Score =  180 bits (456), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 130/191 (68%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFEILNEGETADFSNANEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D  +W+ L+  VL  IM HF SG        L   +++D     F ++D  +V
Sbjct: 65  FISVTKLDGINWDILKVEVLTTIMNHFTSGGK-----ALDKEEVNDPDEEFFDKNDIEIV 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 120 NRIKELMESHIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 179

Query: 179 FVPEVKDIRTV 189
            +PE+  I T 
Sbjct: 180 HIPEIAGIETT 190


>gi|85709112|ref|ZP_01040178.1| possible NifU-like domain protein [Erythrobacter sp. NAP1]
 gi|85690646|gb|EAQ30649.1| possible NifU-like domain protein [Erythrobacter sp. NAP1]
          Length = 193

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 131/197 (66%), Gaps = 16/197 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP++LKF+PG+ V+  G   F++ + AE SPLA  IF    + +V++G+DF
Sbjct: 1   MFIETETTPNPSSLKFLPGRAVMPSGTREFASPEAAEASPLAQAIFDTGEVVNVFYGWDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL---------GDMKLDDMGSGDF 110
           +TV      DW  L+P V  ++++HF+S  P+   G            +M ++D      
Sbjct: 61  VTVTAAPGVDWSALKPQVHAILLDHFVSEAPLFVGGTADGISVPPEEAEMVVEDR----- 115

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D+ ++  I E+L+ RVRPAVA DGGDI ++G+ DG+V+L+++GAC+GCPS++ TLK+
Sbjct: 116 -EEDAEIIASINELLETRVRPAVAGDGGDIAYRGFSDGVVYLTLQGACAGCPSSTATLKH 174

Query: 171 GVANILNHFVPEVKDIR 187
           G+ ++L H+VPEV ++R
Sbjct: 175 GIESLLKHYVPEVVEVR 191


>gi|307293136|ref|ZP_07572982.1| Scaffold protein Nfu/NifU [Sphingobium chlorophenolicum L-1]
 gi|306881202|gb|EFN12418.1| Scaffold protein Nfu/NifU [Sphingobium chlorophenolicum L-1]
          Length = 190

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KF+PG+VV+  G   F+  +EAE SPLA  +F +  +  V+FG DF
Sbjct: 1   MLIETEATPNPATVKFLPGRVVMGMGTRDFATPEEAEASPLADALFGLGDVTGVFFGGDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V       W  ++P +L +++EHF    P+   G  GD+ + +         D+ +V 
Sbjct: 61  ISVTIAPGAQWSDVKPDILSILLEHFSVNMPLFAPGSAGDIFVPEEEEFADDPEDAEIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D RVRPAVA DGGDIV++G+  G V+L M+GACSGCPS++ TLK G+  +L H+
Sbjct: 121 QIRELIDTRVRPAVANDGGDIVYRGFDKGTVYLRMQGACSGCPSSTATLKNGIEQLLKHY 180

Query: 180 VPEVKDIRTV 189
           VPEV ++R V
Sbjct: 181 VPEVTEVRAV 190


>gi|159465189|ref|XP_001690805.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158279491|gb|EDP05251.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 319

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 127/191 (66%), Gaps = 12/191 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F+PG+ V+  G + F +A+E   SPLA ++F++ GI SV+FG DF
Sbjct: 84  MFIQTQPTPNPNSLMFVPGKPVMQSGTMEFGSAREGMKSPLAKKLFAVDGITSVFFGSDF 143

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAV 117
           +T+  KD+Y W  L+P V   IME + SG+ +I +        D + + D      DS V
Sbjct: 144 VTITKKDEYSWPVLKPDVFAAIMEFYASGEALISDA-------DALAASDTAIHPDDSEV 196

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+L+ R+RPAV  DGGDIVFKG+ +  G+V + + GACS CPS++ TLK G+ N+
Sbjct: 197 VAMIKELLETRIRPAVQEDGGDIVFKGFEEDTGMVQVKLVGACSTCPSSTVTLKNGIENM 256

Query: 176 LNHFVPEVKDI 186
           L H++PEVK +
Sbjct: 257 LMHYIPEVKGV 267


>gi|58584670|ref|YP_198243.1| NifU family protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418986|gb|AAW71001.1| NifU family protein containing thioredoxin-like domain [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 190

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 128/191 (67%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L E     FSN  E + S LA+ +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFAILNERETADFSNPDEIKNSKLAADLFQIEHVIRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D   W+ L+  +L  +M+HF SG   +   G+ D  + D     F E+D  +V
Sbjct: 61  FISVTKSDGISWDILKVEILTTVMDHFTSGGKALDRKGVNDNNIPD--EEFFDENDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE+++N ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L +
Sbjct: 119 NRIKELMENYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLCY 178

Query: 179 FVPEVKDIRTV 189
            +PEV  I T 
Sbjct: 179 HIPEVSGIETT 189


>gi|294012036|ref|YP_003545496.1| nitrogen-fixing NifU-like protein [Sphingobium japonicum UT26S]
 gi|292675366|dbj|BAI96884.1| nitrogen-fixing NifU-like protein [Sphingobium japonicum UT26S]
          Length = 190

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 125/190 (65%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KFIPG+VV+  G   F+  +EAE SPLA  +F +  +  V+FG DF
Sbjct: 1   MLIETEATPNPATVKFIPGRVVMGMGTRDFATPEEAEASPLADALFGLGDVTGVFFGGDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V       W  ++P +L +++EHF +  P+   G  G++ +           D  +V 
Sbjct: 61  ISVTIAPGAQWSDVKPDILSILLEHFSANMPLFRPGSAGEIFVPQEEEFADDPEDEEIVA 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D RVRPAVA DGGDI+++G+  G V+L M+GACSGCPS++ TLK G+  +L H+
Sbjct: 121 QIRELIDTRVRPAVANDGGDIIYRGFDKGTVYLRMQGACSGCPSSTATLKNGIEQLLKHY 180

Query: 180 VPEVKDIRTV 189
           VPEV ++R V
Sbjct: 181 VPEVTEVRAV 190


>gi|145344446|ref|XP_001416743.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144576969|gb|ABO95036.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 206

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (65%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V  EG+ +FSNA+EA  SPLA R+F+I G+ +V+FG DF
Sbjct: 1   MFIQTQTTPNPMSLMFQPGREVYAEGSKNFSNAREAMASPLAKRLFAIEGVTNVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVV 118
           +TV K +  +WE ++P     I   + SG+ ++    L         SG  I E D  +V
Sbjct: 61  VTVTKGEDAEWETVKPQTFEAITNFYASGETVMDEEKLA-------ASGTAIAEDDDEIV 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ R+RPAVA DGGDIVFK +    G+V + ++G+C GCPS+S TLK G+ N+L
Sbjct: 114 AMIKELLETRIRPAVAEDGGDIVFKAFDPESGLVTVQLQGSCDGCPSSSVTLKSGIENML 173

Query: 177 NHFVPEVKDI 186
            H+VPEVK +
Sbjct: 174 MHYVPEVKGV 183


>gi|329891163|ref|ZP_08269506.1| scaffold protein Nfu/NifU family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328846464|gb|EGF96028.1| scaffold protein Nfu/NifU family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 185

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 126/193 (65%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V V+  + +    EA  SPLA  +F + G+  V+FG D+
Sbjct: 1   MFIQTEATPNPNALKFLPGRDVAVQDVLEYRTIDEAAASPLAEALFELEGVEGVFFGADY 60

Query: 61  ITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +++ +  +  DW  ++ P+L +IM+HF+SG P++     G+   +D G       D+ +V
Sbjct: 61  VSITRAAHGPDWTEMKAPILSVIMDHFVSGAPLVRE---GETATEDAG------EDTEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +  G++ L MRGAC+GCPS+S TLK GV  ++
Sbjct: 112 AEIKSLLDSRIRPAVAQDGGDILFDHFDEETGVLRLRMRGACAGCPSSSATLKAGVEQMM 171

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 172 RHYVPEVTSVEQV 184


>gi|197128017|gb|ACH44515.1| putative iron-sulfur cluster scaffold protein Nfu variant 3
           [Taeniopygia guttata]
          Length = 252

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 121/189 (64%), Gaps = 9/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 55  MFIQTQDTPNPNSLKFIPGRAVLESRTMEFSTPAAAYCSPLARQLFRIEGVKSVFFGPDF 114

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++ +      + D   S    E D  VV
Sbjct: 115 ITITKESEDLDWNLLKPDIYATIMDFFASGLPVVTDEA---SRTDTAAS----EEDDEVV 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 168 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVLLKLQGSCTSCPSSLITLKSGIQNMLQF 227

Query: 179 FVPEVKDIR 187
           ++PEV+ + 
Sbjct: 228 YIPEVEGVE 236


>gi|321470871|gb|EFX81846.1| hypothetical protein DAPPUDRAFT_49825 [Daphnia pulex]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 126/192 (65%), Gaps = 11/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MF+QT+DTPNP +LKF+PG QVVL    + F     A+ SPLA  +F I G+ SV+ G D
Sbjct: 1   MFVQTQDTPNPNSLKFLPGVQVVLESETMDFPTLSSAQCSPLAKLLFRIEGVKSVFLGPD 60

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  ++ DW+ ++  V   IM+ F SG P+++ G    +   D G+    E D+  
Sbjct: 61  FITITKIDEETDWKTIKAEVFATIMDFFTSGLPVVNEG----INQPDNGN----EEDNDT 112

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD+R+RP V  DGGD+VFKG++DGIV+L ++G+C+ CPS+  TLK GV N+L 
Sbjct: 113 VLMIKELLDSRIRPTVQEDGGDLVFKGFKDGIVYLKLQGSCTSCPSSMVTLKNGVQNMLQ 172

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 173 FYIPEVIAVEQV 184


>gi|194763845|ref|XP_001964043.1| GF20932 [Drosophila ananassae]
 gi|263505256|sp|B3MRT7|NFU1_DROAN RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|190618968|gb|EDV34492.1| GF20932 [Drosophila ananassae]
          Length = 286

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  H F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVEVLGKGNTHDFPSGTTAHGSPLAKLLFRVEGVRAVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 127 FITISKEEGAEWSLIKPEVFAVIMDFFASGLPILHESTPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +GIV L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|224080725|ref|XP_002196481.1| PREDICTED: putative iron-sulfur cluster scaffold protein Nfu
           variant 3 [Taeniopygia guttata]
          Length = 252

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 9/188 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 55  MFIQTQDTPNPNSLKFIPGRAVLESRTMEFSTPAAAYCSPLARQLFRIEGVKSVFFGPDF 114

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++ +      + D   S    E D  VV
Sbjct: 115 ITITKESEDLDWNLLKPDIYATIMDFFASGLPVVTDEA---PRTDTAAS----EEDDEVV 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 168 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVLLKLQGSCTSCPSSLITLKSGIQNMLQF 227

Query: 179 FVPEVKDI 186
           ++PEV+ +
Sbjct: 228 YIPEVEGV 235


>gi|302832552|ref|XP_002947840.1| hypothetical protein VOLCADRAFT_88148 [Volvox carteri f.
           nagariensis]
 gi|300266642|gb|EFJ50828.1| hypothetical protein VOLCADRAFT_88148 [Volvox carteri f.
           nagariensis]
          Length = 314

 Score =  177 bits (449), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 12/191 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F+PG+ V+  G + FS+A+E   SPLA ++F+I GI SV+FG DF
Sbjct: 82  MFIQTQPTPNPNSLMFVPGKPVMESGTLEFSSAREGMKSPLAKKLFAIDGITSVFFGSDF 141

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAV 117
           +TV K D + W  L+P +   IM+ + SG+P++ +          + S D      DS V
Sbjct: 142 VTVTKRDDFTWPVLKPDIFAAIMDFYSSGEPLVSDAAA-------LASSDTAIHPDDSEV 194

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+L+ R+RPAV  DGGDIV+KG+ +  G+V + + GACS CPS++ TLK G+ N+
Sbjct: 195 VAMIKELLETRIRPAVQEDGGDIVYKGFEEDTGMVMVKLVGACSTCPSSTVTLKNGIENM 254

Query: 176 LNHFVPEVKDI 186
           L H++PEVK +
Sbjct: 255 LMHYIPEVKGV 265


>gi|241156886|ref|XP_002407882.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215494245|gb|EEC03886.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 260

 Score =  177 bits (449), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 123/191 (64%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP  LKF+P   VL +G   F     A+ SPLA  +F + G+ +V+FG DF
Sbjct: 48  MFIQTQETPNPNCLKFLPNVKVLEQGTRDFPTLASAKDSPLAKHLFRVEGVKAVFFGSDF 107

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D+ +W+ L+P +   IM+ F +G P+++  G   +  D        E DS  V
Sbjct: 108 ITVTKADDETEWQVLKPHLYAAIMDFFTTGLPVVNEDGTEPVAEDTRPK----EDDSETV 163

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGGDIV+ G+ DG+V L ++G+C+GCPS+S TLK G+ N+L  
Sbjct: 164 LMIKELIETRIRPTVQEDGGDIVYMGFEDGVVKLKLQGSCTGCPSSSVTLKAGIQNMLQF 223

Query: 179 FVPEVKDIRTV 189
           +VPEVKD+  V
Sbjct: 224 YVPEVKDVEQV 234


>gi|296114423|ref|ZP_06833077.1| Scaffold protein Nfu/NifU [Gluconacetobacter hansenii ATCC 23769]
 gi|295979184|gb|EFG85908.1| Scaffold protein Nfu/NifU [Gluconacetobacter hansenii ATCC 23769]
          Length = 187

 Score =  177 bits (448), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 96/193 (49%), Positives = 131/193 (67%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++  GA   F +A   A  S LA  +F + G++ V+FG 
Sbjct: 1   MFIETEDTPNPATLKFLPGRELMPNGATADFIDADSVAGRSRLAEVLFDLEGVSRVFFGG 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+ V K D   W+ L+P VL ++ ++  +G  P+ H   + +   D +  GD       
Sbjct: 61  DFVAVTKADTVAWDELKPQVLSVVADYLATGQAPVEHEAVVIE---DAIAPGD-----EE 112

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V++IKE+LD RVRPAVA DGGDIVF+GYRDGIV L+M+GACSGCPS+  TLK+GV N+L
Sbjct: 113 IVKQIKELLDTRVRPAVAGDGGDIVFRGYRDGIVRLTMQGACSGCPSSRATLKHGVENML 172

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 173 RHYVPEVVSVEQV 185


>gi|87199010|ref|YP_496267.1| nitrogen-fixing NifU-like [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134691|gb|ABD25433.1| nitrogen-fixing NifU-like protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 195

 Score =  176 bits (447), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 128/190 (67%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG+ V+  G   F + +EAE SPLA  +F +  +  V FG DF
Sbjct: 4   MFIETETTPNPATLKFLPGEQVMASGTREFVSHEEAEASPLAQALFDLGDVTGVLFGRDF 63

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V       W  L+P VL ++++HF++  P+   G  G + +      DF +  +    
Sbjct: 64  VSVTAAPGVAWADLKPQVLSLLLDHFVAQAPLFAPGSAGGIVVPADADEDFADDPADADI 123

Query: 120 --RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
             +IK++++ RVRPAVA DGGDI+++G+R+G+V+L M+GACSGCPS++ TLK G+ ++L 
Sbjct: 124 IDQIKDLIETRVRPAVANDGGDIIYRGFREGVVYLKMQGACSGCPSSTATLKNGIESLLK 183

Query: 178 HFVPEVKDIR 187
           H+VPEV ++R
Sbjct: 184 HYVPEVSEVR 193


>gi|58039243|ref|YP_191207.1| NifU protein [Gluconobacter oxydans 621H]
 gi|58001657|gb|AAW60551.1| NifU protein [Gluconobacter oxydans 621H]
          Length = 212

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/192 (48%), Positives = 123/192 (64%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAK-EAEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ V  +   + F +A   A  S LAS +F  P +  V+ G 
Sbjct: 26  MFIETEDTPNPATLKFLPGRSVTGDARPVDFGDADVAAGRSELASALFDQPNVRRVFLGG 85

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D   W  L+P VLG I   F SG P++                D    D+ V
Sbjct: 86  DFVSVTKSDDISWGDLKPVVLGTITTFFESGRPVLSGTQAAPEH-------DVSPEDAEV 138

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V RI+++LD RVRPAVA DGGDI F+GY+DG+V+L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 139 VSRIQDLLDTRVRPAVAGDGGDIAFRGYKDGVVYLAMQGACSGCPSSRATLKHGVENMLR 198

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 199 HYVPEVASVEQV 210


>gi|332188730|ref|ZP_08390443.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. S17]
 gi|332011236|gb|EGI53328.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. S17]
          Length = 190

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 129/191 (67%), Gaps = 3/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F++ +EA  SPLA  IF++  +  V+FG DF
Sbjct: 1   MLIETEPTPNPATLKFLPGRKVMDSGTRDFASPEEAAASPLAEAIFNLGDVTGVFFGRDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG-DMKLDDMGSGDFIESDSAVV 118
           ++V      DW  ++P VLG++++HF +  P+   G     +  ++    D  E D+ +V
Sbjct: 61  VSVTIAPGVDWSDVKPDVLGILLDHFSAQMPLFKQGAADFAVPAEEETFADNPE-DADIV 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +I+E++D RVRPAVA DGGDIV++G+  G V+L M+GAC+GCPS++ TLK G+  +L H
Sbjct: 120 AQIRELIDTRVRPAVANDGGDIVYRGFDKGKVYLKMQGACAGCPSSTATLKNGIEQLLRH 179

Query: 179 FVPEVKDIRTV 189
           +VPEV ++R V
Sbjct: 180 YVPEVTEVRAV 190


>gi|91089707|ref|XP_974909.1| PREDICTED: similar to AGAP000598-PA [Tribolium castaneum]
 gi|270011317|gb|EFA07765.1| hypothetical protein TcasGA2_TC005319 [Tribolium castaneum]
          Length = 244

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 125/193 (64%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT++TPNP +LKF+PG  VL EG  I F N + A  SPL   +F I G+ SV+ G +
Sbjct: 49  MFIQTQETPNPNSLKFLPGVKVLEEGQTIDFPNGQAAYCSPLGKLLFRIEGVKSVFLGPE 108

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL-GDMKLDDMGSGDFIESDSA 116
           FITV K  D+ +W+ ++P +   IM+ F SG P++++     D +++        E DS 
Sbjct: 109 FITVTKTDDEIEWKIIKPEIFATIMDFFASGLPVLNDATPNADTQIN--------EDDSE 160

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +VQ IKE+LD R+RP V  DGGDI+F GY DGIV L ++GAC+ CPS+  TLK GV N+L
Sbjct: 161 IVQMIKELLDTRIRPTVQEDGGDIIFMGYDDGIVKLKLQGACTSCPSSIVTLKNGVQNML 220

Query: 177 NHFVPEVKDIRTV 189
             ++PEV  +  V
Sbjct: 221 QFYIPEVLGVEQV 233


>gi|315497209|ref|YP_004086013.1| scaffold protein nfu/nifu [Asticcacaulis excentricus CB 48]
 gi|315415221|gb|ADU11862.1| Scaffold protein Nfu/NifU [Asticcacaulis excentricus CB 48]
          Length = 188

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 127/194 (65%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKFIPG+ VL +G++ F    +AE SPLA  +F I G++ VYFG DF
Sbjct: 1   MFIQTEATPNPDVLKFIPGREVLGKGSMEFRTETDAEKSPLALSLFQIDGVSGVYFGSDF 60

Query: 61  ITVGKDQYD---WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV +D      W  ++ P+L  IM+ + SG  I++  G  + +  +   G+  +    +
Sbjct: 61  LTVKRDAEAGLIWAQIKAPILAAIMDFYASGRAILNEEGAVNERTYE---GEVAQ----I 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IK++LD RVRPAVA+DGGDI F+ +    G ++L MRGACSGCPS+S TL+ GV ++
Sbjct: 114 VLEIKDLLDTRVRPAVAQDGGDIEFEHFDIESGTLYLHMRGACSGCPSSSATLRQGVESL 173

Query: 176 LNHFVPEVKDIRTV 189
           + H+VPEVK I  V
Sbjct: 174 MKHYVPEVKTIEQV 187


>gi|224097626|ref|XP_002311017.1| predicted protein [Populus trichocarpa]
 gi|222850837|gb|EEE88384.1| predicted protein [Populus trichocarpa]
          Length = 198

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 121/190 (63%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ ++  G+  F NA+ A  SPLA  I+ I GI  V+FG DF
Sbjct: 4   MFIQTQSTPNPLSLMFHPGKPIMDVGSADFPNARSAMNSPLAKSIYEIDGITRVFFGSDF 63

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   WE L P +   IM+ + SG+P+  +      K   +      E DS  V 
Sbjct: 64  VTVTKSDDASWEFLEPEIFAAIMDFYSSGEPLFQDSKTASAKDTAIS-----EDDSETVT 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+ +  G+V L+M+GACSGCPS+S TLK G+ N+L 
Sbjct: 119 MIKELLETRIRPAVQDDGGDIEYRGFDEETGVVKLTMQGACSGCPSSSVTLKSGIENMLM 178

Query: 178 HFVPEVKDIR 187
           H+VPEVK + 
Sbjct: 179 HYVPEVKGVE 188


>gi|312384995|gb|EFR29592.1| hypothetical protein AND_01304 [Anopheles darlingi]
          Length = 214

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL  G  + F N   A+ SPLA  +F I G+ SV+FG D
Sbjct: 1   MFIQTQDTPNPHSLKFLPGVTVLDAGQTMDFPNVSSAQCSPLAKLLFRIEGVRSVFFGAD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P    +IM+ F SG P++      +       S    E D   V
Sbjct: 61  FVTISKVEDAEWSIIKPETFAVIMDFFASGLPVVTGANPNN-------STQINEDDDETV 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IKE+LD R+RP V  DGGDI+F G+ DG+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 114 QMIKELLDTRIRPTVQEDGGDIIFMGFDDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 173

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 174 YIPEVVSVEQV 184


>gi|291386642|ref|XP_002709869.1| PREDICTED: HIRA interacting protein 5 [Oryctolagus cuniculus]
          Length = 255

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 60  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPASAFRSPLARQLFRIEGVKSVFFGPDF 119

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           IT+ KD  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 120 ITITKDNEELDWNLLKPDIYATIMDFFASGLPLV---------TEETSSGEAGSEEDDEV 170

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 171 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 230

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 231 FYIPEVEGVEQV 242


>gi|57529447|ref|NP_001006305.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Gallus
           gallus]
 gi|53136898|emb|CAG32778.1| hypothetical protein RCJMB04_35n21 [Gallus gallus]
          Length = 232

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 121/189 (64%), Gaps = 9/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS+   A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKEVLESRTMEFSSPAAAFCSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++        + D   S    E D  VV
Sbjct: 95  ITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEA---PRTDTAQS----EEDDEVV 147

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 148 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 207

Query: 179 FVPEVKDIR 187
           ++PEV+ + 
Sbjct: 208 YIPEVEGVE 216


>gi|170016007|ref|NP_001116180.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Danio
           rerio]
 gi|169158109|emb|CAQ14737.1| HIRA interacting protein 5 [Danio rerio]
          Length = 243

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 124/191 (64%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG+ VL  G + F+  ++A  SPLA ++F I G+ SV+FG DF
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAFCSPLARQLFRIDGVKSVFFGPDF 110

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   + +W+ ++P V   IM+ F SG P+I+     D    D       E D  VV
Sbjct: 111 ITITKTSGETEWKVIKPDVFATIMDFFTSGLPVINEA---DAPRADTAPS---EDDDEVV 164

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 165 AMIKELLDTRIRPTVQEDGGDVLYHGFEDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQF 224

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 225 YVPEVEGVEQV 235


>gi|195392814|ref|XP_002055049.1| GJ19011 [Drosophila virilis]
 gi|263505537|sp|B4M375|NFU1_DROVI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194149559|gb|EDW65250.1| GJ19011 [Drosophila virilis]
          Length = 298

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 75  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPSGSAAHCSPLAKLLFRVEGVRAVFFGGD 134

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG P+IH               + +E D   V
Sbjct: 135 FITISKEESGEWGLIKPEVFAVIMDFFASGLPVIHEARPN-------ADTEILEDDDETV 187

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +GIV L M+G+CS CPS+  TLK GV N+L  
Sbjct: 188 MMIKELLDTRIRPTVQEDGGDIVFMGYENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 247

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 248 YIPEVESVEQV 258


>gi|37681825|gb|AAQ97790.1| HIRA interacting protein 5 [Danio rerio]
 gi|62205090|gb|AAH92670.1| HIRA interacting protein 5 [Danio rerio]
 gi|182891738|gb|AAI65097.1| Hirip5 protein [Danio rerio]
          Length = 243

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 124/191 (64%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG+ VL  G + F+  ++A  SPLA ++F I G+ SV+FG DF
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAFCSPLARQLFRIDGVKSVFFGPDF 110

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   + +W+ ++P V   IM+ F SG P+++     D    D       E D  VV
Sbjct: 111 ITITKTSGETEWKVIKPDVFATIMDFFTSGLPVVNEA---DAPRADTAPS---EDDDEVV 164

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 165 AMIKELLDTRIRPTVQEDGGDVLYHGFEDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQF 224

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 225 YVPEVEGVEQV 235


>gi|195447128|ref|XP_002071076.1| GK25604 [Drosophila willistoni]
 gi|263505026|sp|B4NE93|NFU1_DROWI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194167161|gb|EDW82062.1| GK25604 [Drosophila willistoni]
          Length = 289

 Score =  174 bits (440), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+ SV+FG D
Sbjct: 68  MFIQTQDTPNPESLKFLPGVEVLGKGNTYDFPSVAAAHCSPLAKLLFRVEGVRSVFFGSD 127

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H          +    + +E D   V
Sbjct: 128 FITISKEEAAEWGLIKPEVFAVIMDFFASGLPILHEA-------RNNADTEILEDDDETV 180

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 181 MMIKELLDTRIRPTVQEDGGDIVFMSYDNGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 240

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 241 YIPEVESVEQV 251


>gi|170593029|ref|XP_001901267.1| r10h10-like protein TO42 [Brugia malayi]
 gi|158591334|gb|EDP29947.1| r10h10-like protein TO42, putative [Brugia malayi]
          Length = 220

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 127/193 (65%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ ++TPNPATLKFIPG++++ +G   + F N   A+ SPLA  +F I GI SV+FG 
Sbjct: 1   MFIQVQETPNPATLKFIPGKMIMGKGKGTLDFGNFMSAKKSPLAMELFRINGIKSVFFGE 60

Query: 59  DFITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           D++T+ K +   DW  L+P +  ++M++  S  PI++   +    L      +    DS 
Sbjct: 61  DYVTITKQKEIDDWTLLKPEIFAVLMDYLQSEKPIVNESEM----LKGPEDTEIHPEDSD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L+ R++P V  DGGD+++KG+ DG+V L M+G+C+GCPS+S TL+ G+ N+L
Sbjct: 117 TVAMIKELLECRIKPMVQEDGGDVIYKGFLDGVVHLKMQGSCTGCPSSSVTLQSGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEVKD+  V
Sbjct: 177 QFYVPEVKDVMEV 189


>gi|238231487|ref|NP_001154157.1| HIRA-interacting protein 5 [Oncorhynchus mykiss]
 gi|225704456|gb|ACO08074.1| HIRA-interacting protein 5 [Oncorhynchus mykiss]
          Length = 250

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 123/191 (64%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG++VL +G + F+  +EA  SPLA ++F I G+  V+ G DF
Sbjct: 56  MFIQTQDTPNPNSLKFLPGRMVLEQGTMDFTAPREAYCSPLARQLFRIDGVKGVFLGPDF 115

Query: 61  ITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   D  W+ ++P V   IM+ F SG P+++     D    D    D    D  V+
Sbjct: 116 ITITKTDVDLEWKLIKPDVFAAIMDFFTSGLPVVNEE---DTPRADTAPSD---DDDEVI 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVLYCGFEDGIVKLKLQGSCTSCPSSMVTLKSGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 230 YVPEVEGVEQV 240


>gi|302381462|ref|YP_003817285.1| Scaffold protein Nfu/NifU [Brevundimonas subvibrioides ATCC 15264]
 gi|302192090|gb|ADK99661.1| Scaffold protein Nfu/NifU [Brevundimonas subvibrioides ATCC 15264]
          Length = 185

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 125/193 (64%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V   G+  F +  +A  SPLA  +F +  ++ V+FG D 
Sbjct: 1   MFIQTEPTPNPNALKFLPGRDVAPGGSREFLSIDQATASPLAEALFQLEDVSGVFFGGDH 60

Query: 61  ITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V + ++  DW  ++P +L +IM+HF+SG P++  G           + D  E DS +V
Sbjct: 61  ISVTRAEHGRDWSEMKPEILSVIMDHFVSGQPLMREGA---------DAVDHAEDDSEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +  G++ L MRGAC+GCPS++ TLK GV  ++
Sbjct: 112 AEIKSLLDSRIRPAVAQDGGDILFDAFDEESGVLRLRMRGACAGCPSSAMTLKAGVEQMM 171

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 172 RHYVPEVTSVEQV 184


>gi|326497811|dbj|BAJ94768.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326521670|dbj|BAK00411.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 268

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/189 (47%), Positives = 123/189 (65%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 68  MFIQTQSTPNPQSLMFHPGKPVMDVGSSDFPNARTAMTSPLAKALFAIEGVTRVFFGSDF 127

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D+  W++L+P V   IM+ + SG P+  +       +D        E DS +V 
Sbjct: 128 VTVTKSDETSWDYLKPEVFAAIMDFYSSGQPLFLDSNTA-AAMDTA----IHEDDSEIVA 182

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 183 MIKELLETRIRPAVQDDGGDIEYRGFEPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 242

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 243 HYVPEVKGV 251


>gi|149727512|ref|XP_001491099.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Equus
           caballus]
          Length = 253

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 118 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVT---------EETSSGEAGSEEDDEV 168

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 169 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 228

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 229 FYIPEVEGVEQV 240


>gi|71021777|ref|XP_761119.1| hypothetical protein UM04972.1 [Ustilago maydis 521]
 gi|46100569|gb|EAK85802.1| hypothetical protein UM04972.1 [Ustilago maydis 521]
          Length = 293

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 126/195 (64%), Gaps = 12/195 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKF+PG+ V+  G   F + + +  SPLA ++F+IPG+ SV++G DF
Sbjct: 72  MFIQTESTPNEDSLKFLPGRQVMESGTHEFLDTRSSMASPLAKKLFNIPGVVSVFYGPDF 131

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAV 117
           +TV KD ++ W  L+P +   IME F SG P+  +           GS D   +++DS V
Sbjct: 132 VTVSKDAEHQWSILKPEIYSSIMEFFTSGHPLFTDPESA------AGSQDTVILDTDSEV 185

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY---RDGIVFLSMRGACSGCPSASETLKYGVAN 174
           V  IKE+LD RVRPA+  DGGD+ ++G+    DGIV + ++G+C GC S++ TLK G+  
Sbjct: 186 VAMIKELLDTRVRPAIQEDGGDLEYRGFGEDTDGIVKVKLKGSCRGCDSSTVTLKSGIER 245

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEVK +  V
Sbjct: 246 MLMHYIPEVKGVEQV 260


>gi|157167461|ref|XP_001654807.1| hypothetical protein AaeL_AAEL002148 [Aedes aegypti]
 gi|108882432|gb|EAT46657.1| conserved hypothetical protein [Aedes aegypti]
          Length = 263

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 124/192 (64%), Gaps = 11/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F     A  SPLA  +F I G+ SV+FG D
Sbjct: 55  MFIQTQDTPNPDSLKFLPGVAVLEKGQTMDFPTQAAALCSPLAKLLFRIEGVRSVFFGAD 114

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG-LGDMKLDDMGSGDFIESDSAV 117
           F+T+ K ++ +W  ++P V  +IM+ F SG P++ +   +GD +++        E D   
Sbjct: 115 FVTISKHEEAEWRLIKPEVFAVIMDFFASGLPVVTDAKPMGDTQIN--------EDDDET 166

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD+++RP V  DGGDI+F  + DG+V L M+G+CS CPS+  TLK GV N+L 
Sbjct: 167 VQMIKELLDSKIRPTVQEDGGDIIFMAFEDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQ 226

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 227 FYIPEVVAVEQV 238


>gi|224110188|ref|XP_002315442.1| predicted protein [Populus trichocarpa]
 gi|222864482|gb|EEF01613.1| predicted protein [Populus trichocarpa]
          Length = 279

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 122/190 (64%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F NA+ A  SPLA  I+ I GI  V+FG DF
Sbjct: 78  MFIQTQSTPNPSSLMFYPGKPVMDVGSADFPNARSAMNSPLAKAIYGIDGINRVFFGPDF 137

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K D   WE L+P +   IM+ + SG+P+  +      K   +      E DS  V 
Sbjct: 138 ITITKSDDATWEFLKPEIFAAIMDFYSSGEPLFLDSQTAAAKDTAIS-----EDDSETVA 192

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+ +  GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 193 MIKELLETRIRPAVQDDGGDIEYQGFDEETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 252

Query: 178 HFVPEVKDIR 187
           H+VPEVK + 
Sbjct: 253 HYVPEVKGVE 262


>gi|195132295|ref|XP_002010579.1| GI14603 [Drosophila mojavensis]
 gi|193909029|gb|EDW07896.1| GI14603 [Drosophila mojavensis]
          Length = 259

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 40  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGAAAHCSPLAKLLFRVEGVRAVFFGGD 99

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 100 FITISKEESGEWGLIKPEVFAIIMDFFASGLPILHEARAN-------ADTEILEDDDETV 152

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 153 MMIKELLDTRIRPTVQEDGGDIVFMGYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 212

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 213 YIPEVESVEQV 223


>gi|281346707|gb|EFB22291.1| hypothetical protein PANDA_002901 [Ailuropoda melanoleuca]
          Length = 186

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 4   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 63

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 64  ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVT---------EETSSGEAGSEEDDEV 114

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 115 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 174

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 175 FYIPEVEGVEQV 186


>gi|73970249|ref|XP_855433.1| PREDICTED: similar to HIRA interacting protein 5 isoform 2 [Canis
           familiaris]
          Length = 253

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 118 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLV---------TEETSSGEAGSEEDDEV 168

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 169 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 228

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 229 FYIPEVEGVEQV 240


>gi|195059008|ref|XP_001995543.1| GH17809 [Drosophila grimshawi]
 gi|263505270|sp|B4JWR9|NFU1_DROGR RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|193896329|gb|EDV95195.1| GH17809 [Drosophila grimshawi]
          Length = 298

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +A  A  SPLA  +F + G+ +V+FG D
Sbjct: 79  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSATAAHCSPLAKLLFRVEGVRAVFFGSD 138

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 139 FITISKEENGEWGLIKPEVFAVIMDFFASGLPILHEARPN-------ADTEILEDDDETV 191

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 192 MMIKELLDTRIRPTVQEDGGDIVFISYEKGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 251

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 252 YIPEVESVEQV 262


>gi|312070286|ref|XP_003138076.1| hypothetical protein LOAG_02490 [Loa loa]
 gi|307766755|gb|EFO25989.1| hypothetical protein LOAG_02490 [Loa loa]
          Length = 220

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 126/193 (65%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ  +TPNPATLKFIPG++++ +G   + F N   A+ SPLA  +F I G+ SV+FG 
Sbjct: 1   MFIQVHETPNPATLKFIPGRMIMGKGRGTLDFGNFLSAKRSPLAMELFRINGVKSVFFGE 60

Query: 59  DFITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           D++T+ K     DW  L+P +  ++M++  S  PII  G +     D     +    DS 
Sbjct: 61  DYVTITKQNEVDDWALLKPEIFAVLMDYLQSEKPIISEGEMPKGPED----TEIHPEDSD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L+ R++P V  DGGD+++KG+ DG+V L M+G+C+GCPS+S TL++G+ N+L
Sbjct: 117 TVAMIKELLECRIKPMVQEDGGDVIYKGFHDGVVHLKMQGSCTGCPSSSVTLQFGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEVKD+  V
Sbjct: 177 QFYVPEVKDVLEV 189


>gi|66543732|ref|XP_395826.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Apis mellifera]
          Length = 275

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 122/187 (65%), Gaps = 12/187 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  +L +G    F NA +   SPLA  +F I G+ SV+FG D
Sbjct: 64  MFIQTQDTPNPNSLKFLPGVKILEQGQTKDFPNAIDGYCSPLAKMLFRIDGVKSVFFGPD 123

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG-LGDMKLDDMGSGDFIESDSA 116
           FIT+ K  +  +W+ L+P +  +IM+ F SG P++ +     D ++ D         DS 
Sbjct: 124 FITITKADEDVEWKLLKPEIFAVIMDFFASGLPVLTDEQPAADTQISD--------DDSE 175

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TLK GV N++
Sbjct: 176 IVQMIKELLDTRIRPTVQEDGGDIVFMGFEEGIVKLKMQGSCTSCPSSVITLKNGVQNMM 235

Query: 177 NHFVPEV 183
             ++PEV
Sbjct: 236 QFYIPEV 242


>gi|195482335|ref|XP_002102005.1| GE15286 [Drosophila yakuba]
 gi|263505516|sp|B4PZ52|NFU1_DROYA RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194189529|gb|EDX03113.1| GE15286 [Drosophila yakuba]
          Length = 283

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P V  +IM+ F SG P++H+              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLHDA-------QPNADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|254295433|ref|YP_003061456.1| Scaffold protein Nfu/NifU [Hirschia baltica ATCC 49814]
 gi|254043964|gb|ACT60759.1| Scaffold protein Nfu/NifU [Hirschia baltica ATCC 49814]
          Length = 190

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 125/190 (65%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+ V  +    F N KEA  SPLA+ +F++ G+ +V+ G DF
Sbjct: 1   MFIQTEATPNPETLKFLPGREVSPKTPYEFLNEKEAGSSPLAAFLFTLKGVKTVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + + K Q  DW  L+P  L  IM+HF+SG P++ +        + +  G+    ++ +V 
Sbjct: 61  VALTKTQETDWAILKPQALAAIMDHFVSGMPVMADYSDPAPVEEVIYEGE----NAEIVA 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+++ RVRPAVA DGGDI+F+ +    G+V L MRGAC+GCPS++ TLK G+ N+L 
Sbjct: 117 EIKELIETRVRPAVANDGGDIIFEKFDVDTGVVTLQMRGACAGCPSSTMTLKSGIENMLR 176

Query: 178 HFVPEVKDIR 187
           H+VPEV  + 
Sbjct: 177 HYVPEVTAVE 186


>gi|111035797|emb|CAL29424.1| NifU-related protein [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 194

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 132/192 (68%), Gaps = 6/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ ++TPN  TLKF+PG ++L EG  + FS+A E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIKETPNLNTLKFLPGFMILNEGETVDFSSANETKNSKLAANLFRIEHVIRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAV 117
           FI+V K D  +W  L+  VL  IM+HF S    +   G  D   +D+   +F + SD+ +
Sbjct: 65  FISVTKSDDINWNTLKVEVLTTIMDHFASSGKALDREGTND---NDILEEEFFDKSDTEI 121

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V RI+E++++ ++PAV +DGGDI F+GY++GIV++ ++GACSGCPSA+ TLK G+ N+L 
Sbjct: 122 VSRIRELMESYIKPAVVQDGGDIKFRGYKNGIVYVELQGACSGCPSATITLKQGIQNMLC 181

Query: 178 HFVPEVKDIRTV 189
           + +PE+  I T+
Sbjct: 182 YHIPEILGIDTI 193


>gi|332813521|ref|XP_003309120.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           [Pan troglodytes]
 gi|5738608|emb|CAB53015.1| HIRA-interacting protein HIRIP5 [Homo sapiens]
 gi|62822279|gb|AAY14828.1| unknown [Homo sapiens]
 gi|189054196|dbj|BAG36716.1| unnamed protein product [Homo sapiens]
          Length = 196

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (63%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPSGEAGS----EEDDEVV 112

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 113 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 172

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 173 YIPEVEGVEQV 183


>gi|326932642|ref|XP_003212423.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Meleagris gallopavo]
          Length = 233

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 121/189 (64%), Gaps = 9/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS+   A  SPLA ++F I G+ S++FG DF
Sbjct: 36  MFIQTQDTPNPNSLKFIPGKEVLDSRTMEFSSPAAAFCSPLARQLFRIEGVKSIFFGPDF 95

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++        + D   S    E D  VV
Sbjct: 96  ITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEA---PRTDTAQS----EEDDEVV 148

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 149 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 208

Query: 179 FVPEVKDIR 187
           ++PEV+ + 
Sbjct: 209 YIPEVEGVE 217


>gi|114577877|ref|XP_001137587.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 7 [Pan troglodytes]
          Length = 230

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 95  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 145

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 146 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 205

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 206 FYIPEVEGVEQV 217


>gi|50593025|ref|NP_056515.2| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 1
           [Homo sapiens]
 gi|32967071|gb|AAP92373.1| cytosolic iron-sulfur cluster scaffold protein Nfu [Homo sapiens]
 gi|119620256|gb|EAW99850.1| HIRA interacting protein 5, isoform CRA_b [Homo sapiens]
          Length = 230

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 95  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 145

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 146 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 205

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 206 FYIPEVEGVEQV 217


>gi|241761631|ref|ZP_04759718.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753996|ref|YP_003226889.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241373939|gb|EER63472.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258553359|gb|ACV76305.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 183

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+  + V+   + +F N +EA  SPLA  +F +  + +V++G DF
Sbjct: 1   MLIETEKTPNPATLKFLLHRPVMERESRYFVNKEEAADSPLAVALFDLQHVTAVFYGRDF 60

Query: 61  ITVGKDQYD-WEHLRPPVLGMIMEHFISGDPI-IHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V  D    W +L   ++ +I +HF +  P+ + N    + K       D  E D  ++
Sbjct: 61  ISVTLDSPSLWSNLESKIIMIISDHFDNDIPLLVENSEKNETK-------DHDEEDDVIL 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IK+++D+RVRPAVARDGGDIVF+ + DGIV+LSMRGAC+GCPS+  TLK GV  +L H
Sbjct: 114 Q-IKDLIDSRVRPAVARDGGDIVFQKFEDGIVYLSMRGACAGCPSSVATLKQGVETLLKH 172

Query: 179 FVPEVKDIRTV 189
           FVPE+K++R +
Sbjct: 173 FVPEIKEVRAI 183


>gi|254420655|ref|ZP_05034379.1| Scaffold protein Nfu/NifU N terminal [Brevundimonas sp. BAL3]
 gi|196186832|gb|EDX81808.1| Scaffold protein Nfu/NifU N terminal [Brevundimonas sp. BAL3]
          Length = 185

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 121/190 (63%), Gaps = 13/190 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V     + +     A  SPLA  +F + G+  V+FG D+
Sbjct: 1   MFIQTEPTPNPNVLKFLPGREVSPLAVLDYRTIDAATASPLAEALFELEGVDGVFFGADY 60

Query: 61  ITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ++V + +   DW  ++ P+LG+IM+HF+SG P+   G   +   +D         DS +V
Sbjct: 61  VSVTRQERGPDWSEMKAPILGVIMDHFVSGRPLTVAGSETETHAED---------DSEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +  G++ L MRGACSGCPS+S TLK GV  ++
Sbjct: 112 AEIKALLDSRIRPAVAQDGGDILFDAFDEATGVLSLRMRGACSGCPSSSATLKAGVEQMM 171

Query: 177 NHFVPEVKDI 186
            H+VPEV  +
Sbjct: 172 RHYVPEVTRV 181


>gi|194897711|ref|XP_001978709.1| GG17526 [Drosophila erecta]
 gi|263504966|sp|B3NYF7|NFU1_DROER RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|190650358|gb|EDV47636.1| GG17526 [Drosophila erecta]
          Length = 283

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P V  +IM+ F SG P++H+              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLHDA-------QPNADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|55596270|ref|XP_525775.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 8 [Pan troglodytes]
 gi|332813518|ref|XP_001137508.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 6 [Pan troglodytes]
          Length = 254

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 169

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 170 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 229

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 230 FYIPEVEGVEQV 241


>gi|242086973|ref|XP_002439319.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor]
 gi|241944604|gb|EES17749.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor]
          Length = 268

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 124/189 (65%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  ++FG DF
Sbjct: 71  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRIFFGSDF 130

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V   IM+ + SG P+  +       +D        E DS +V 
Sbjct: 131 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQPLFLDSNAA-ASMDTA----IHEDDSEIVA 185

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+   +GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 186 MIKELLETRIRPAVQDDGGDIEYRGFDPENGIVKLKMQGACSGCPSSSVTLKSGIENMLM 245

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 246 HYVPEVKGV 254


>gi|301758232|ref|XP_002914967.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 420

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 225 MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 284

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 285 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLV---------TEETSSGEAGSEEDDEV 335

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 336 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 395

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 396 FYIPEVEGVEQV 407


>gi|47212055|emb|CAF90173.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 196

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 123/191 (64%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QT+DTPNP +LKF+PG  VL  G ++F + ++A  SPLA ++F + G+ SV  G DF
Sbjct: 1   MFVQTQDTPNPNSLKFLPGCTVLETGTMNFDSPRDAHCSPLARQLFRVDGVKSVLLGPDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K     DW+ ++P V   IM+ F SG P++  G     +++D    D    D  +V
Sbjct: 61  ITISKIDANIDWKVIKPDVFATIMDFFTSGLPVVSEGS---KQIEDTAPSD---DDDELV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+  G+V L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVLYRGFEGGVVKLKLQGSCTSCPSSIITLKSGIQNMLQF 174

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 175 YIPEVESVEQV 185


>gi|34500319|gb|AAQ73784.1| NifU-like protein HIRIP5 [Homo sapiens]
 gi|194374137|dbj|BAG62381.1| unnamed protein product [Homo sapiens]
          Length = 254

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLV---------TEETPSGEAGSEEDDEV 169

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 170 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 229

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 230 FYIPEVEGVEQV 241


>gi|114577887|ref|XP_001137189.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 248

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (63%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPSGEAGS----EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|50593021|ref|NP_001002755.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 2
           [Homo sapiens]
 gi|205371805|sp|Q9UMS0|NFU1_HUMAN RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; AltName: Full=HIRA-interacting protein 5;
           Flags: Precursor
 gi|32967069|gb|AAP92372.1| iron-sulfur cluster scaffold protein Nfu [Homo sapiens]
 gi|109731123|gb|AAI13693.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo
           sapiens]
 gi|109731125|gb|AAI13695.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo
           sapiens]
 gi|119620255|gb|EAW99849.1| HIRA interacting protein 5, isoform CRA_a [Homo sapiens]
 gi|261860742|dbj|BAI46893.1| NFU1 iron-sulfur cluster scaffold homolog [synthetic construct]
 gi|313884030|gb|ADR83501.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae)
           [synthetic construct]
          Length = 254

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLV---------TEETPSGEAGSEEDDEV 169

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 170 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 229

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 230 FYIPEVEGVEQV 241


>gi|114053059|ref|NP_001040031.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Bos
           taurus]
 gi|86823819|gb|AAI05370.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Bos
           taurus]
 gi|296482427|gb|DAA24542.1| HIRA interacting protein 5 [Bos taurus]
          Length = 253

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (63%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPATAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 118 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPSGEAGS----EDDDEVV 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 230 YIPEVEGVEQV 240


>gi|332226734|ref|XP_003262547.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 3 [Nomascus leucogenys]
          Length = 230

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           IT+ K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 95  ITITKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 145

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 146 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 205

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 206 FYIPEVEGVEQV 217


>gi|126304005|ref|XP_001381686.1| PREDICTED: similar to iron-sulfur cluster scaffold protein Nfu
           [Monodelphis domestica]
          Length = 235

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+ G DF
Sbjct: 40  MFIQTQDTPNPNSLKFIPGKSVLGSQTMDFPTPATAFRSPLARQLFRIEGVKSVFLGPDF 99

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG PI+          +   S    E D  VV
Sbjct: 100 ITVTKESEDLDWNLLKPDIYATIMDFFASGLPILTE--------ETPSSETATEEDDEVV 151

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 152 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 211

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 212 YIPEVEGVEQV 222


>gi|31874276|emb|CAD98142.1| hypothetical protein [Homo sapiens]
          Length = 242

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (63%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPSGEAGS----EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|17541876|ref|NP_501917.1| LiPid Depleted family member (lpd-8) [Caenorhabditis elegans]
 gi|3879150|emb|CAA94609.1| C. elegans protein R10H10.1, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 222

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 120/190 (63%), Gaps = 13/190 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA--IHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L + +    FS+A  A+ SPLA ++  + G+  V+FG 
Sbjct: 16  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAIKLLRVDGVKRVFFGE 75

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+TV K  +  DW  LRP +   I +H  +G P+I+               D +E D  
Sbjct: 76  DFVTVTKSDETVDWALLRPEIFSTIADHIQTGKPVINEAA---------TVSDQVEEDDE 126

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 127 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 186

Query: 177 NHFVPEVKDI 186
             +VPEVK++
Sbjct: 187 TFYVPEVKEV 196


>gi|332226730|ref|XP_003262545.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 1 [Nomascus leucogenys]
 gi|332226732|ref|XP_003262546.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 2 [Nomascus leucogenys]
          Length = 254

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 123/192 (64%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           IT+ K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 119 ITITKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 169

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 170 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 229

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 230 FYIPEVEGVEQV 241


>gi|283856470|ref|YP_163150.2| scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775474|gb|AAV90039.2| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 183

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 128/191 (67%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+  + V+   + +F N +EA  SPLA  +F +  + +V++G DF
Sbjct: 1   MLIETEKTPNPATLKFLLHRPVMERESRYFVNKEEAADSPLAVALFDLQHVTAVFYGRDF 60

Query: 61  ITVGKDQYD-WEHLRPPVLGMIMEHFISGDPI-IHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V  D    W +L   ++ +I +HF +  P+ + N    ++K       D  E D  ++
Sbjct: 61  ISVTLDSPSLWSNLESKIIMIISDHFDNDIPLLVENFEKNEIK-------DHDEEDDVIL 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IK+++D+RVRPAVARDGGDIVF+ + DGIV+LSMRGAC+GCPS+  TLK GV  +L H
Sbjct: 114 Q-IKDLIDSRVRPAVARDGGDIVFQKFEDGIVYLSMRGACAGCPSSVATLKQGVETLLKH 172

Query: 179 FVPEVKDIRTV 189
           FVPE+K++R +
Sbjct: 173 FVPEIKEVRAI 183


>gi|158288625|ref|XP_310479.4| AGAP000598-PA [Anopheles gambiae str. PEST]
 gi|157018658|gb|EAA06366.4| AGAP000598-PA [Anopheles gambiae str. PEST]
          Length = 226

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A+ SPLA  +F + G+ +V+FG D
Sbjct: 11  MFIQTQDTPNPDSLKFLPGVPVLEKGQTMDFPSVSAAQCSPLAKLLFRVEGVRAVFFGGD 70

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P V  +IM+ F SG P++ +               F E D   V
Sbjct: 71  FVTISKQEDAEWRIIKPEVFAVIMDFFASGLPVVTDAKPN-------PDTQFNEDDDETV 123

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IKE+LD R+RP V  DGGDI+F G+ DG+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 124 QMIKELLDTRIRPTVQEDGGDIIFMGFDDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 183

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 184 YIPEVVSVEQV 194


>gi|322798976|gb|EFZ20436.1| hypothetical protein SINV_01605 [Solenopsis invicta]
          Length = 226

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 13/188 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  SPLA  +F I G+ +++FG D
Sbjct: 15  MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPSAKDAYCSPLAKMLFRIEGVKAIFFGPD 74

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG--LGDMKLDDMGSGDFIESDS 115
           FITV K  +  +W+ L+P V   IM+ F +G P++        D +++          D 
Sbjct: 75  FITVTKIDEDVEWKLLKPEVFATIMDFFATGLPVMDETSQPAADTQIN--------AEDD 126

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TL+ GV N+
Sbjct: 127 EIVQMIKELLDTRIRPTVQEDGGDIVFVGFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNM 186

Query: 176 LNHFVPEV 183
           +  ++PEV
Sbjct: 187 MQFYIPEV 194


>gi|324510498|gb|ADY44390.1| NFU1 iron-sulfur cluster scaffold [Ascaris suum]
          Length = 213

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 127/193 (65%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ ++TPNP TLKF+PG+ VL    G + F++   A+ SPLA ++F + G+ S++FG 
Sbjct: 1   MFIQVQETPNPLTLKFLPGEPVLGPGRGTMDFTSVSAAKRSPLALQLFRVDGVKSIFFGE 60

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DFITV K  ++ DW  ++P +   IM+   +G  I+++G + D  +D M        D  
Sbjct: 61  DFITVTKADEETDWAVMKPEIFATIMDFLQTGKAIVNDGEVPDGPMDTM----IHPEDDD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L++RV+P V  DGGDI++KG+ DGIV L ++G+C+GCPS+  TLK G+ N+L
Sbjct: 117 TVAMIKELLESRVKPMVQEDGGDIIYKGFHDGIVHLKLKGSCTGCPSSLVTLKSGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEV D+  V
Sbjct: 177 QFYVPEVVDVIEV 189


>gi|26324295|dbj|BAC24985.1| unnamed protein product [Mus musculus]
          Length = 200

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +      G     E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT-----EETPPPPGEAGSSEEDDEVV 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 116 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 175

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 176 YIPEVEGVEQV 186


>gi|307215410|gb|EFN90079.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 265

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/186 (48%), Positives = 119/186 (63%), Gaps = 13/186 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F NAK+A  SPLA  +F I G+ +++FG D
Sbjct: 56  MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPNAKDAYCSPLAKMLFRIEGVKAIFFGPD 115

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P +   IM+ F SG PI+    L     D   S D    D  V
Sbjct: 116 FITVTKLDEDIEWKLLKPEIFATIMDFFASGLPIMDESQLA---ADTQISTD----DDEV 168

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGDI   G+ +GIV L M+G+C+ CPS+  TL+ GV N++ 
Sbjct: 169 VQMIKELLDTRIRPTVQEDGGDI---GFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNMMQ 225

Query: 178 HFVPEV 183
            ++PEV
Sbjct: 226 FYIPEV 231


>gi|195357024|ref|XP_002044916.1| GM13534 [Drosophila sechellia]
 gi|263505008|sp|B4IMF6|NFU1_DROSE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194124051|gb|EDW46094.1| GM13534 [Drosophila sechellia]
          Length = 283

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K +  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDA-------QPNADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|282154799|ref|NP_001100076.2| NFU1 iron-sulfur cluster scaffold homolog precursor [Rattus
           norvegicus]
 gi|149036647|gb|EDL91265.1| histone cell cycle regulation defective interacting protein 5
           (predicted), isoform CRA_a [Rattus norvegicus]
          Length = 253

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 122/191 (63%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPPGEAGS----EEDDEVV 168

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 169 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 228

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 229 YIPEVEGVEQV 239


>gi|114577889|ref|XP_001137105.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Pan
           troglodytes]
          Length = 240

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 121/189 (64%), Gaps = 10/189 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPSGEAGS----EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIR 187
           ++PEV+ + 
Sbjct: 231 YIPEVEGVE 239


>gi|325087305|gb|ADY77002.1| iron-sulfur cluster assembly protein NFU4 [Ipomoea batatas]
 gi|325087311|gb|ADY77005.1| iron-sulfur cluster assembly protein NFU4 [Ipomoea batatas]
          Length = 281

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 90/189 (47%), Positives = 119/189 (62%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F I GI  V++G DF
Sbjct: 80  MFIQTQSTPNPLSLMFYPGKPVMETGSADFPNARSAMNSPLAKALFGIDGITRVFYGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   IM+ F SG P+  +       +D        E DS  V 
Sbjct: 140 VTVTKSDDASWDLLKPEIFAAIMDFFSSGKPLFLDSNTA-ASMDTA----IQEDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYRGFDADSGIVKLRMQGACSGCPSSSVTLKSGIENMLM 254

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 255 HYVPEVKGV 263


>gi|196003412|ref|XP_002111573.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens]
 gi|190585472|gb|EDV25540.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens]
          Length = 236

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +LKF+PG  VL  G I +S+A++A  SPLA  +F + G+ SV+ G DF
Sbjct: 36  MFIQTLDTPNPNSLKFVPGVPVLGSGTIDYSSARDALTSPLAKNLFRVDGVKSVFLGPDF 95

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +T+ +  D  +W  L+P +  +IM+ F SG P++       +  +          DS  V
Sbjct: 96  VTISRADDDIEWNTLKPDIYAVIMDFFASGAPVL-------IDYEPATDTAVQPEDSDTV 148

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ R+RP +  DGGDIV+ GY +GIV L M+GAC  CPSA+ TLK+G+ N+L  
Sbjct: 149 AMIKELLETRIRPTLQEDGGDIVYMGYDNGIVKLKMQGACDSCPSATVTLKHGIQNMLQF 208

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  +
Sbjct: 209 YIPEVEGVEQI 219


>gi|148666782|gb|EDK99198.1| mCG130855, isoform CRA_b [Mus musculus]
          Length = 256

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +      G     E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLV-----TEETPPPPGEAGSSEEDDEVV 171

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 172 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 231

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 232 YIPEVEGVEQV 242


>gi|282154803|ref|NP_001164062.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 1
           precursor [Mus musculus]
 gi|74211556|dbj|BAE26508.1| unnamed protein product [Mus musculus]
          Length = 256

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++      +      G     E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLV-----TEETPPPPGEAGSSEEDDEVV 171

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 172 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 231

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 232 YIPEVEGVEQV 242


>gi|6760408|gb|AAF28338.1|AF213379_1 r10h10-like protein TO42 [Drosophila melanogaster]
 gi|6554171|gb|AAF16622.1| TO42 [Drosophila melanogaster]
          Length = 286

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPLA  +F + G+  V+FG D
Sbjct: 70  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGAD 129

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 130 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDA-------QPNADTEILEDDDETV 182

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 183 MMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 242

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 243 YIPEVESVEQV 253


>gi|115462181|ref|NP_001054690.1| Os05g0155300 [Oryza sativa Japonica Group]
 gi|54291852|gb|AAV32220.1| unknown protein [Oryza sativa Japonica Group]
 gi|113578241|dbj|BAF16604.1| Os05g0155300 [Oryza sativa Japonica Group]
 gi|215697325|dbj|BAG91319.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222630253|gb|EEE62385.1| hypothetical protein OsJ_17174 [Oryza sativa Japonica Group]
          Length = 272

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 123/189 (65%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 72  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRVFFGSDF 131

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V  +IM+ + SG  +  +       +D        E DS +V 
Sbjct: 132 VTVTKSEETSWDYLKPEVFAVIMDFYSSGQSLFLDSSTA-ASMDTA----IHEDDSEIVA 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 187 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 246

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 247 HYVPEVKGV 255


>gi|296087967|emb|CBI35250.3| unnamed protein product [Vitis vinifera]
          Length = 202

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 120/190 (63%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L F PG+ V+  G+  F N++ A  SPLA  ++ I GI  V+FG DF
Sbjct: 1   MFIQTQSTPNPASLMFYPGKPVMEVGSADFPNSRSAMSSPLAKSLYGIDGITRVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ ++P +   IM+ + SG P+  +       +D        E DS  V 
Sbjct: 61  ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTA-AAMDTA----IHEDDSETVA 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 116 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 175

Query: 178 HFVPEVKDIR 187
           H+VPEVK + 
Sbjct: 176 HYVPEVKGVE 185


>gi|24643765|ref|NP_728443.1| CG32857 [Drosophila melanogaster]
 gi|45551492|ref|NP_728447.2| CG32500 [Drosophila melanogaster]
 gi|45556188|ref|NP_996529.1| CG33502 [Drosophila melanogaster]
 gi|74866115|sp|Q8SY96|NFU1_DROME RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|17946577|gb|AAL49319.1| RH16335p [Drosophila melanogaster]
 gi|22831388|gb|AAG22462.2| CG33502 [Drosophila melanogaster]
 gi|22831391|gb|AAN09001.1| CG32857 [Drosophila melanogaster]
 gi|45446754|gb|AAN09005.2| CG32500 [Drosophila melanogaster]
 gi|220949278|gb|ACL87182.1| CG32500-PA [synthetic construct]
 gi|220958368|gb|ACL91727.1| CG32500-PA [synthetic construct]
          Length = 283

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDA-------QPNADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|114799747|ref|YP_759252.1| NifU domain-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114739921|gb|ABI78046.1| NifU domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 192

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 121/191 (63%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQ-VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP T+KF+PGQ VV   G   F +A  A  S LA  +F + G+  V+ G D
Sbjct: 1   MFIQTEATPNPDTIKFLPGQPVVGDRGPFDFPDAASARTSLLARALFQVEGVERVFLGSD 60

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+++ K Q  DW H++P VL  IM+H++SG P+I  G        D    ++    + +V
Sbjct: 61  FVSINKAQDKDWRHVKPMVLAAIMDHYMSGLPVIEEGTSSASSGAD--ETEYEGETAEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ RVRPAVA+DGGDI F  +    GIV LSMRGAC+GCPS++ TLK G+ N+L
Sbjct: 119 NEIKELIETRVRPAVAQDGGDITFHRFDADTGIVHLSMRGACAGCPSSTMTLKQGIENML 178

Query: 177 NHFVPEVKDIR 187
             +VPEV  + 
Sbjct: 179 RTYVPEVTAVE 189


>gi|115946407|ref|XP_001184965.1| PREDICTED: similar to HIRA interacting protein 5
           [Strongylocentrotus purpuratus]
          Length = 209

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 118/194 (60%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  VL  G   F +A  A  SPLA ++F I G+  V+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFLPGVEVLGTGTKDFPSAMNAHGSPLARQLFRIEGVQGVFFGPDF 60

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDS 115
           ITV K   D  DW  L+P +   +M+ F +G PI+          D+    D    E D 
Sbjct: 61  ITVTKMDDDNIDWRVLKPEIYATVMDFFATGVPILT---------DETAPTDTEIQEDDD 111

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD R+RP V  DGGDIV+ G+ +G+V L ++GAC+ CPS+  TLK+GV N+
Sbjct: 112 ETVMMIKELLDTRIRPTVQEDGGDIVYMGFEEGVVKLKLQGACTSCPSSIVTLKHGVQNM 171

Query: 176 LNHFVPEVKDIRTV 189
           L  +VPEV  +  V
Sbjct: 172 LQFYVPEVLSVEAV 185


>gi|115953358|ref|XP_798698.2| PREDICTED: similar to HIRA interacting protein 5, partial
           [Strongylocentrotus purpuratus]
          Length = 211

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 118/194 (60%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  VL  G   F +A  A  SPLA ++F I G+  V+FG DF
Sbjct: 3   MFIQTQDTPNPNSLKFLPGVEVLGTGTKDFPSAMNAHGSPLARQLFRIEGVQGVFFGPDF 62

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDS 115
           ITV K   D  DW  L+P +   +M+ F +G PI+          D+    D    E D 
Sbjct: 63  ITVTKMDDDNIDWRVLKPEIYATVMDFFATGVPILT---------DETAPTDTEIQEDDD 113

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD R+RP V  DGGDIV+ G+ +G+V L ++GAC+ CPS+  TLK+GV N+
Sbjct: 114 ETVMMIKELLDTRIRPTVQEDGGDIVYMGFEEGVVKLKLQGACTSCPSSIVTLKHGVQNM 173

Query: 176 LNHFVPEVKDIRTV 189
           L  +VPEV  +  V
Sbjct: 174 LQFYVPEVLSVEAV 187


>gi|225717260|gb|ACO14476.1| NFU1 iron-sulfur cluster scaffold homolog [Esox lucius]
          Length = 253

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG +VL  G + F+  +EA   PLA ++F I G+  V+ G DF
Sbjct: 59  MFIQTQDTPNPNSLKFLPGCMVLERGTMDFAAPREAYCCPLARQLFGIDGVKGVFLGPDF 118

Query: 61  ITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   D  W+ ++P V   IM+ F SG P+++     D    D    D    D  V+
Sbjct: 119 ITITKANVDLEWKLIKPDVFAAIMDFFASGLPVMNEE---DTPRADTAPSD---DDDEVI 172

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 173 TMIKELLDTRIRPTVQEDGGDVLYRGFEDGIVKLKLQGSCTSCPSSIVTLKSGIQNMLQF 232

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 233 YVPEVEGVEQV 243


>gi|268570156|ref|XP_002648431.1| C. briggsae CBR-LPD-8 protein [Caenorhabditis briggsae]
 gi|187039912|emb|CAP21246.1| CBR-LPD-8 protein [Caenorhabditis briggsae AF16]
          Length = 228

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 121/190 (63%), Gaps = 12/190 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA--IHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L + +    FS+A  A+ SPLA ++  + G+  V+FG 
Sbjct: 21  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAIKLLRVDGVKRVFFGE 80

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DFITV K  +  DW  LRP +   I +H  +G  +I+             +G+  E D+ 
Sbjct: 81  DFITVTKSDETVDWALLRPEIFSTIADHLQTGKSVINEAS--------ATAGEAEEDDNE 132

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 133 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 192

Query: 177 NHFVPEVKDI 186
             +VPEVK++
Sbjct: 193 TFYVPEVKEV 202


>gi|125550903|gb|EAY96612.1| hypothetical protein OsI_18522 [Oryza sativa Indica Group]
          Length = 272

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 122/189 (64%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 72  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRVFFGSDF 131

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V   IM+ + SG  +  +       +D        E DS +V 
Sbjct: 132 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQSLFLDSSTA-ASMDTA----IHEDDSEIVA 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 187 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 246

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 247 HYVPEVKGV 255


>gi|156548302|ref|XP_001602506.1| PREDICTED: similar to protein phosphatase 2a [Nasonia vitripennis]
          Length = 511

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 121/194 (62%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL +G    F +A +A  SPLA  +F I G+ SV+FG D
Sbjct: 67  MFIQTQDTPNPNSLKFIPGVEVLGKGQTKDFPSATDAFCSPLAKMLFRIEGVKSVFFGSD 126

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDS 115
           FIT+ K  +  +W+ ++P +   IM+ F SG PI               S D +  E D 
Sbjct: 127 FITITKIDEDVEWKLIKPEIFATIMDFFASGLPIFTEA---------QSSSDTVINEDDD 177

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TLK GV N+
Sbjct: 178 EIVQMIKELLDTRIRPTVQEDGGDIVFMGFENGIVKLKMQGSCTSCPSSVVTLKNGVQNM 237

Query: 176 LNHFVPEVKDIRTV 189
           +  ++PEV  +  V
Sbjct: 238 MQFYIPEVLGVEQV 251


>gi|6013069|emb|CAB57314.1| HIRA-interacting protein (HIRIP5) [Mus musculus]
 gi|17390830|gb|AAH18355.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Mus
           musculus]
          Length = 199

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++           + GS    E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPP--PPGEAGS----EEDDEVV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 174

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 175 YIPEVEGVEQV 185


>gi|51473845|ref|YP_067602.1| hypothetical protein RT0659 [Rickettsia typhi str. Wilmington]
 gi|51460157|gb|AAU04120.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 190

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 129/191 (67%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ + ++  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISIDQPVFFSELAEVKGRSTLAESLFHINNVKSVFFGSD 60

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K    +W+ ++P +L +IM+HFISG P+ +     + K+D+      I+  S + 
Sbjct: 61  FITVTKHAGGNWQVIKPEILMVIMDHFISGFPVFNE----NTKIDNEKHN--IDMLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E ++ RVRP V +DGGDI++KG+  G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIETIETRVRPFVTQDGGDIIYKGFESGVVKLALRGACLGCPSSTITLKNGIESMLRH 174

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 175 FIPEVQEVQAV 185


>gi|198470316|ref|XP_002133420.1| GA22888 [Drosophila pseudoobscura pseudoobscura]
 gi|263504850|sp|B5DKJ8|NFU1_DROPS RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|198145392|gb|EDY72048.1| GA22888 [Drosophila pseudoobscura pseudoobscura]
          Length = 286

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGTAAHCSPLAKLLFRVEGVRAVFFGSD 126

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + ++ D   V
Sbjct: 127 FITISKEESAEWSLIKPEVFAVIMDFFASGLPILHEA-------RPNADTEILDDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFISYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|195169040|ref|XP_002025336.1| GL13432 [Drosophila persimilis]
 gi|263504975|sp|B4H303|NFU1_DROPE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194108792|gb|EDW30835.1| GL13432 [Drosophila persimilis]
          Length = 282

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 63  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGTAAHCSPLAKLLFRVEGVRAVFFGSD 122

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + ++ D   V
Sbjct: 123 FITISKEESAEWSLIKPEVFAVIMDFFASGLPILHEARPN-------ADTEILDDDDETV 175

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 176 MMIKELLDTRIRPTVQEDGGDIVFISYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 235

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 236 YIPEVESVEQV 246


>gi|146326964|gb|AAI41716.1| Lpd-8 protein [Xenopus laevis]
          Length = 250

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F N   A  SPLA  +F I G+ SV+FG DF
Sbjct: 54  MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPNPASAFCSPLARHLFRIEGVKSVFFGPDF 113

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSA 116
           IT+ K  +  DW  ++P +   IM+ F +G P++          D+   GD    E +  
Sbjct: 114 ITITKNGEDMDWNLIKPDIFATIMDFFSTGLPVVT---------DEAPRGDPAASEEEDE 164

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 165 VVAMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNML 224

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 225 QFYIPEVEGVEQV 237


>gi|225464130|ref|XP_002264979.1| PREDICTED: similar to NFU4 (NFU domain protein 4) [Vitis vinifera]
          Length = 271

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 120/189 (63%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L F PG+ V+  G+  F N++ A  SPLA  ++ I GI  V+FG DF
Sbjct: 70  MFIQTQSTPNPASLMFYPGKPVMEVGSADFPNSRSAMSSPLAKSLYGIDGITRVFFGSDF 129

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ ++P +   IM+ + SG P+  +       +D        E DS  V 
Sbjct: 130 ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTA-AAMDTA----IHEDDSETVA 184

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 185 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 244

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 245 HYVPEVKGV 253


>gi|114108171|gb|AAI23134.1| Lpd-8 protein [Xenopus laevis]
          Length = 249

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F N   A  SPLA  +F I G+ SV+FG DF
Sbjct: 53  MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPNPASAFCSPLARHLFRIEGVKSVFFGPDF 112

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSA 116
           IT+ K  +  DW  ++P +   IM+ F +G P++          D+   GD    E +  
Sbjct: 113 ITITKNGEDMDWNLIKPDIFATIMDFFSTGLPVVT---------DEAPRGDPAASEEEDE 163

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 164 VVAMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNML 223

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 224 QFYIPEVEGVEQV 236


>gi|15604511|ref|NP_221029.1| hypothetical protein RP667 [Rickettsia prowazekii str. Madrid E]
 gi|3861205|emb|CAA15105.1| unknown [Rickettsia prowazekii]
 gi|292572295|gb|ADE30210.1| NifU-like protein [Rickettsia prowazekii Rp22]
          Length = 190

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 128/191 (67%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE+TPNP  +KF PGQ + V+  + FS   E +  S LA  +F I  + SV+ G D
Sbjct: 1   MFIQTEETPNPDAIKFFPGQEISVDQPVFFSELAEVKGRSALAESLFHINNVKSVFLGSD 60

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K    +W+ ++P +L +IM+HFISG P+ +     + K+DD      ++  S + 
Sbjct: 61  FITVTKQARGNWQVIKPEILMVIMDHFISGFPVFNE----NTKIDDEKHN--LDMLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E ++ RVRP V +DGGDI++KG+  G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIETIETRVRPFVTQDGGDIIYKGFESGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 175 FIPEVQEVKAV 185


>gi|296448206|ref|ZP_06890103.1| Scaffold protein Nfu/NifU [Methylosinus trichosporium OB3b]
 gi|296254290|gb|EFH01420.1| Scaffold protein Nfu/NifU [Methylosinus trichosporium OB3b]
          Length = 183

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 135/190 (71%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP+TLKF+PG+ VL  GA  F +A+ A  SPLA  + +I G+ +V FG DF
Sbjct: 1   MFIQTESTPNPSTLKFLPGRPVLAAGAREFRDAQAAAASPLAGALLAINGVEAVMFGPDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVVQ 119
           ++V K   +W HL+P VLG IMEHF SG PI+ + G       +    +F + +D+ +V 
Sbjct: 61  VSVTKADAEWAHLKPAVLGTIMEHFTSGAPIVLDEG-------EAAPAEFFDPADAELVA 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  RV PAVARDGGDI F+G+RDGIV+L+M+G+CSGCPS+S TLK GV N+L H+
Sbjct: 114 TLKELLVTRVTPAVARDGGDIAFRGFRDGIVYLAMKGSCSGCPSSSATLKNGVENLLRHY 173

Query: 180 VPEVKDIRTV 189
           VP+V+ +  V
Sbjct: 174 VPQVRSVEQV 183


>gi|34500321|gb|AAQ73785.1| NifU-like protein HIRIP5 [Mus musculus]
          Length = 245

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 47  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 106

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++           + GS    E D  VV
Sbjct: 107 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEET--PPPPGEAGS----EEDDEVV 160

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 161 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 220

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 221 YIPEVEGVEQV 231


>gi|328862177|gb|EGG11278.1| hypothetical protein MELLADRAFT_41822 [Melampsora larici-populina
           98AG31]
          Length = 292

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 125/194 (64%), Gaps = 8/194 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQTE TPNP  LKFIPG  V+    G + F +      SPLA  +F IPGI S++FG 
Sbjct: 74  IFIQTETTPNPDALKFIPGVPVMGKSNGTLEFLSNSNPNSSPLAKSLFKIPGIKSLFFGP 133

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFI++ KD+  +W  ++P +  ++ME F SG PI+ +   G+   +D      +ESDS V
Sbjct: 134 DFISINKDEETNWSIIKPEIYSLMMEFFSSGQPILTDESEGNQGPEDT---RVLESDSEV 190

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           +  IKE+LD RVRP++  DGGD+ +KG+ +  G+V L ++G+C GC S++ TLK G+  +
Sbjct: 191 IAMIKELLDTRVRPSIQEDGGDLEYKGFDEETGVVTLMLKGSCRGCDSSTVTLKSGIERM 250

Query: 176 LNHFVPEVKDIRTV 189
           L H++PEV+ +  V
Sbjct: 251 LMHYIPEVQAVEQV 264


>gi|148666781|gb|EDK99197.1| mCG130855, isoform CRA_a [Mus musculus]
          Length = 255

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++           + GS    E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEET--PPPPGEAGS----EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|282154801|ref|NP_064429.2| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 2
           precursor [Mus musculus]
 gi|205830867|sp|Q9QZ23|NFU1_MOUSE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; AltName: Full=HIRA-interacting protein 5;
           Short=mHIRIP5; Flags: Precursor
 gi|12834577|dbj|BAB22965.1| unnamed protein product [Mus musculus]
          Length = 255

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++           + GS    E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEET--PPPPGEAGS----EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|195568040|ref|XP_002107563.1| GD15490 [Drosophila simulans]
 gi|263505455|sp|B4R3T1|NFU1_DROSI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194204973|gb|EDX18549.1| GD15490 [Drosophila simulans]
          Length = 283

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPHGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K +  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDA-------QPNADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|57239492|ref|YP_180628.1| hypothetical protein Erum7660 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579471|ref|YP_197683.1| hypothetical protein ERWE_CDS_08070 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161571|emb|CAH58499.1| putative NifU-related protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418097|emb|CAI27301.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 185

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 132/191 (69%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ EDTPNP TLKF+PG + +  G I  F+++  AE SP A  +F I  I SV+FG D
Sbjct: 1   MFIQIEDTPNPNTLKFMPG-IPVNNGKIGEFTDSITAESSPFAKALFEIEHIVSVFFGGD 59

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+P +L +IM+ F++ +P   N  + +   +D+    F   D  +V
Sbjct: 60  FISVTKSSDIEWDVLKPEILTVIMD-FLTLNP---NDSVENNDEEDLQEF-FDAKDEEIV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +IKE++D+ ++PAVA+DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L +
Sbjct: 115 SKIKELIDDYIKPAVAQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLTY 174

Query: 179 FVPEVKDIRTV 189
           ++P+++ + +V
Sbjct: 175 YLPDIQSVESV 185


>gi|308492754|ref|XP_003108567.1| CRE-LPD-8 protein [Caenorhabditis remanei]
 gi|308248307|gb|EFO92259.1| CRE-LPD-8 protein [Caenorhabditis remanei]
          Length = 223

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 121/190 (63%), Gaps = 12/190 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA--IHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L + +    F++A  A+ SPLA ++  + G+  V+FG 
Sbjct: 16  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFNSAAAAKQSPLAVKLLRVDGVKRVFFGE 75

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+TV K  +  DW  LRP +   I +H  +G P+I+     D        G+    D+ 
Sbjct: 76  DFVTVTKADEHVDWALLRPEIFSTIADHLQTGKPVINEVAATD--------GEAEVEDNE 127

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 128 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 187

Query: 177 NHFVPEVKDI 186
             +VPEVK++
Sbjct: 188 TFYVPEVKEV 197


>gi|165933598|ref|YP_001650387.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia
           rickettsii str. Iowa]
 gi|165908685|gb|ABY72981.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia
           rickettsii str. Iowa]
          Length = 190

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 129/191 (67%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTADTPNPDAITFFPGQKISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEE----NTKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TL+ G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLRNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+++  V
Sbjct: 175 FVPEVQEVEAV 185


>gi|118403546|ref|NP_001072356.1| NFU1 iron-sulfur cluster scaffold homolog [Xenopus (Silurana)
           tropicalis]
 gi|111307911|gb|AAI21453.1| HIRA interacting protein 5 [Xenopus (Silurana) tropicalis]
          Length = 199

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 122/193 (63%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F +   A  SPLA  +F I G+ SV+ G DF
Sbjct: 1   MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPSPASAFCSPLARHLFRIDGVKSVFLGPDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSA 116
           IT+ K  ++ DW  ++P +   IM+ F SG P++          +D   GD    E +  
Sbjct: 61  ITITKNSEELDWNLIKPDIYATIMDFFASGLPVVT---------EDAPRGDAAASEEEDE 111

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 112 VVAMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNML 171

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 172 QFYIPEVEGVEQV 184


>gi|157828872|ref|YP_001495114.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157801353|gb|ABV76606.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 190

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 129/191 (67%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTADTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEE----NTKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TL+ G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLRNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+++  V
Sbjct: 175 FVPEVQEVEAV 185


>gi|239047306|ref|NP_001131382.2| hypothetical protein LOC100192708 [Zea mays]
 gi|238908578|gb|ACF79773.2| unknown [Zea mays]
          Length = 268

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 120/189 (63%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA   F+I G+  V+FG DF
Sbjct: 71  MFIQTQSTPNPQSLMFYPGKPVMEIGSSDFPNARTAMTSPLAKSPFAIDGVTRVFFGSDF 130

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W+ L+P V   IM+ + SG P+  +       +D        E DS +V 
Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAA-ASMDTA----IHEDDSEIVA 185

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    G V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 186 MIKELLETRIRPAVQDDGGDIEYRGFDPETGTVKLKMQGACSGCPSSSVTLKSGIENMLM 245

Query: 178 HFVPEVKDI 186
           H+VPEVK +
Sbjct: 246 HYVPEVKGV 254


>gi|255568026|ref|XP_002524990.1| HIRA-interacting protein, putative [Ricinus communis]
 gi|223535734|gb|EEF37397.1| HIRA-interacting protein, putative [Ricinus communis]
          Length = 271

 Score =  167 bits (423), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (62%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G++ F NA+ A  SPLA  ++ I G   V+FG DF
Sbjct: 70  MFIQTQSTPNPSSLMFYPGKPVMEVGSVDFPNARAALNSPLAKSLYGIDGTTRVFFGSDF 129

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ L+P +   IM+ + SG P+  +  +   K          + DS  V 
Sbjct: 130 ITVTKSDDVSWDLLKPEIFAAIMDFYSSGQPLFLDSEIAASK-----DTAIHKDDSETVA 184

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 185 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 244

Query: 178 HFVPEVKDI 186
           H+V EVK +
Sbjct: 245 HYVSEVKGV 253


>gi|156389173|ref|XP_001634866.1| predicted protein [Nematostella vectensis]
 gi|156221954|gb|EDO42803.1| predicted protein [Nematostella vectensis]
          Length = 186

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ ++TPNP +LKF+PG +VL  G ++F ++  A  SPLA  +F I G+  V FG +F
Sbjct: 1   MFIQVQETPNPNSLKFVPGVLVLESGTVNFDSSSSAHRSPLARNLFRINGVKGVMFGPEF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  ++  W  L+P +   IM+ F S  PI+      +    D GS +    D   V
Sbjct: 61  ITVTKSDEEVQWSVLKPEIFATIMDFFSSNLPIMTE----EEPPQDTGSCN----DDDTV 112

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDI+FKG++DGIV L M+GAC+ CPS+  TLK G+ N++  
Sbjct: 113 LMIKELLDTRIRPTVQEDGGDIIFKGFKDGIVKLKMQGACASCPSSIVTLKNGIENMMQF 172

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 173 YIPEVVSVEQV 183


>gi|302769472|ref|XP_002968155.1| hypothetical protein SELMODRAFT_67451 [Selaginella moellendorffii]
 gi|300163799|gb|EFJ30409.1| hypothetical protein SELMODRAFT_67451 [Selaginella moellendorffii]
          Length = 187

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 121/187 (64%), Gaps = 8/187 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ + TPNPA+L F PG+ V+  G+  F NA+ A  SPLA  +F I G+  V+FG DF
Sbjct: 6   LFIQVQTTPNPASLIFSPGKPVMEIGSSDFPNARTAMKSPLAKSLFGIDGVTRVFFGSDF 65

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+ L+P V   IM+ + SG P+ ++      K   +  GD    D  VV 
Sbjct: 66  VTVTKSDDTEWDVLKPEVFAAIMDFYASGQPLFYSAQAAAPKDTAIEEGD----DETVVM 121

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS++ TLK G+ N+L 
Sbjct: 122 -IKELLETRIRPAVKDDGGDIEYRGFDRESGIVELKMQGACSGCPSSAVTLKSGIENMLM 180

Query: 178 HFVPEVK 184
           H+VPEVK
Sbjct: 181 HYVPEVK 187


>gi|302773942|ref|XP_002970388.1| hypothetical protein SELMODRAFT_93100 [Selaginella moellendorffii]
 gi|300161904|gb|EFJ28518.1| hypothetical protein SELMODRAFT_93100 [Selaginella moellendorffii]
          Length = 210

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 122/187 (65%), Gaps = 8/187 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ + TPNPA+L F PG+ V+  G+  F NA+ A  SPLA  +F I G+  V+FG DF
Sbjct: 10  LFIQVQTTPNPASLIFSPGKPVMEIGSSDFPNARTAMKSPLAKSLFGIDGVTRVFFGSDF 69

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+ L+P V   IM+ + SG P+ ++  +   K   +  GD    D  VV 
Sbjct: 70  VTVTKSDDTEWDVLKPEVFAAIMDFYASGQPLFYSAQVEAPKDTAIEEGD----DETVVM 125

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS++ TLK G+ N+L 
Sbjct: 126 -IKELLETRIRPAVKDDGGDIEYRGFDRESGIVELKMQGACSGCPSSAVTLKSGIENMLM 184

Query: 178 HFVPEVK 184
           H+VPEVK
Sbjct: 185 HYVPEVK 191


>gi|18402817|ref|NP_566673.1| NFU4; structural molecule [Arabidopsis thaliana]
 gi|75273382|sp|Q9LIG6|NIFU4_ARATH RecName: Full=NifU-like protein 4, mitochondrial; Short=AtNfu-III;
           Short=AtNfu4; Flags: Precursor
 gi|13899085|gb|AAK48964.1|AF370537_1 Unknown protein [Arabidopsis thaliana]
 gi|9294004|dbj|BAB01907.1| unnamed protein product [Arabidopsis thaliana]
 gi|18377516|gb|AAL66924.1| unknown protein [Arabidopsis thaliana]
 gi|28207822|emb|CAD55561.1| NFU4 protein [Arabidopsis thaliana]
 gi|332642927|gb|AEE76448.1| NifU-like protein 4 [Arabidopsis thaliana]
          Length = 283

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 118/190 (62%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N + A  SPLA  I+SI G+  V+FG DF
Sbjct: 80  MFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPLAKSIYSIDGVVRVFFGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   +M+ + SG P+  +      K   +      E DS  V 
Sbjct: 140 VTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAAKDTAIS-----EDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI + G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSGIENMLM 254

Query: 178 HFVPEVKDIR 187
           H+V EVK + 
Sbjct: 255 HYVSEVKGVE 264


>gi|58617525|ref|YP_196724.1| hypothetical protein ERGA_CDS_07980 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417137|emb|CAI28250.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 185

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 131/191 (68%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ EDTPNP TLKF+PG + +  G I  F+++  AE SP A  +F I  I  V+FG D
Sbjct: 1   MFIQIEDTPNPNTLKFMPG-IPVNNGKIGEFTDSITAESSPFAKALFEIEHIVGVFFGGD 59

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F++V K    +W+ L+P +L +IM+ F++ +P   N  + +   +D+    F   D  +V
Sbjct: 60  FVSVTKSSDIEWDVLKPEILTVIMD-FLTLNP---NDSVENHDEEDLQEF-FDAKDEEIV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +IKE++D+ ++PAVA+DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L +
Sbjct: 115 SKIKELIDDYIKPAVAQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLTY 174

Query: 179 FVPEVKDIRTV 189
           ++P+++ + +V
Sbjct: 175 YLPDIQSVESV 185


>gi|167520450|ref|XP_001744564.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776895|gb|EDQ90513.1| predicted protein [Monosiga brevicollis MX1]
          Length = 209

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +L F PG  +L    +  ++A  A  SPLA  +F + G+ SV+   DF
Sbjct: 1   MFIQTRDTPNPNSLMFYPGVDILPGSTLELTSAAAAHQSPLARALFRVDGVKSVFLASDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+ KD+  +W  L+P +   +M+ F S  P++ +    +   D   S    E D  +V 
Sbjct: 61  VTINKDEAAEWSTLKPNIYATMMDFFASNQPVVLDSY--EAPTDTAVS----EDDDEIVA 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD+R+RPAV  DGGDI+F+G+ DGIV L + GAC+GCPS+  TLK GV N+L H+
Sbjct: 115 MIKELLDSRIRPAVQEDGGDILFQGFVDGIVQLRLSGACTGCPSSIFTLKNGVENMLMHY 174

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 175 IPEVEGVEQV 184


>gi|332028326|gb|EGI68373.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Acromyrmex echinatior]
          Length = 211

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 119/188 (63%), Gaps = 16/188 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  SPLA  +F I G+ +++FG D
Sbjct: 1   MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPSAKDAYCSPLAKMLFRIEGVKAIFFGPD 60

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG--LGDMKLDDMGSGDFIESDS 115
           FITV K  +  +W+ L+P +   IM+ F SG P++        D +++          D 
Sbjct: 61  FITVTKVDEDVEWKLLKPEIFATIMDFFASGLPVMDEASQPAADTQIN--------AEDD 112

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            VVQ IKE+LD R+RP V  DGGDI   G+ +GIV L M+G+C+ CPS+  TL+ GV N+
Sbjct: 113 EVVQMIKELLDTRIRPTVQEDGGDI---GFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNM 169

Query: 176 LNHFVPEV 183
           +  ++PEV
Sbjct: 170 MQFYIPEV 177


>gi|67458659|ref|YP_246283.1| NifU-like domain-containing protein [Rickettsia felis URRWXCal2]
 gi|67004192|gb|AAY61118.1| NifU-like domain [Rickettsia felis URRWXCal2]
          Length = 190

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 123/181 (67%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  E  + FS+  E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISSEQPVFFSDISEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P VL +IM+HF+SG P+         K D++     ++  S + 
Sbjct: 61  FITVTKQAESNWQVIKPEVLMVIMDHFVSGFPVFEES----TKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|291225596|ref|XP_002732785.1| PREDICTED: GM13534-like [Saccoglossus kowalevskii]
          Length = 275

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 117/193 (60%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT +TPNP +LKFIPG  VL  G + F  A+ A  SPLA ++F I G+ SV+ G DF
Sbjct: 65  MFIQTHETPNPNSLKFIPGVPVLGSGTMDFPTARVAHGSPLARQLFRIDGVKSVFLGPDF 124

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSA 116
           IT+ K  D  +W+ ++P V   +M+ F +G PI+          D+  S D      D  
Sbjct: 125 ITITKHDDDSEWKIIKPEVYAAVMDFFATGLPIL---------TDEQPSADTEIHPDDDE 175

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+LD R+RP V  DGGDIV+ G+  GIV L M+G+C+ CPS+  TLK GV N+L
Sbjct: 176 TVAMIKELLDTRIRPTVQEDGGDIVYMGFEKGIVKLKMQGSCTSCPSSVVTLKSGVQNML 235

Query: 177 NHFVPEVKDIRTV 189
             +VPEV  +  V
Sbjct: 236 QFYVPEVLSVEQV 248


>gi|239799267|dbj|BAH70563.1| ACYPI005854 [Acyrthosiphon pisum]
          Length = 254

 Score =  164 bits (415), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 121/193 (62%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP ++KF+PG  VL +G  + F NA  A  SPLA  +F I G+ SV+FG D
Sbjct: 43  MFIQTQDTPNPNSVKFLPGVQVLEKGHTMDFPNATAAYCSPLAKVLFRIEGVKSVFFGSD 102

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG-LGDMKLDDMGSGDFIESDSA 116
           +IT+ K  D  +W  L+P +   IM+ F SG PI+ +     D ++         E D+ 
Sbjct: 103 YITLTKTDDDIEWMVLKPEIYATIMDFFASGLPILTDAKPTSDTQIH--------EDDNE 154

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+LD+R+RP V  DGGDI+F GY  GIV L ++G+C+ CPS+  TLK GV N+L
Sbjct: 155 TVMMIKELLDSRIRPTVQEDGGDILFIGYDAGIVKLKLQGSCTSCPSSVVTLKGGVQNML 214

Query: 177 NHFVPEVKDIRTV 189
             ++PEV  +  V
Sbjct: 215 QFYIPEVIAVEQV 227


>gi|254797154|ref|YP_003081992.1| hira-interacting protein 5 [Neorickettsia risticii str. Illinois]
 gi|254590399|gb|ACT69761.1| hira-interacting protein 5 [Neorickettsia risticii str. Illinois]
          Length = 180

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 122/190 (64%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF PG  +L  G   F  A +A  + L   ++ I G++ V  G DF
Sbjct: 1   MFIQTEHTPNPNVLKFFPGVNILDSGIADFVTASDASGNKLPEMLWEIQGVSGVMLGVDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K +  +W+ L+P +  +++E+F +G   +            +   + +E    V +
Sbjct: 61  VSVSKTEDAEWDVLKPQIFSVLVEYFTTGSDFVR----------PVTEDEEVECTDEVSK 110

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D +VRP+V  DGG++VFKGY+DGIV+L ++GAC+GCPSAS TLK G+ N+L ++
Sbjct: 111 KIREIIDTKVRPSVIEDGGNVVFKGYKDGIVYLKLQGACAGCPSASVTLKDGIENLLQYY 170

Query: 180 VPEVKDIRTV 189
           VPEV++++ V
Sbjct: 171 VPEVREVQQV 180


>gi|299755866|ref|XP_001828936.2| NifU-like protein c [Coprinopsis cinerea okayama7#130]
 gi|298411416|gb|EAU92943.2| NifU-like protein c [Coprinopsis cinerea okayama7#130]
          Length = 291

 Score =  164 bits (414), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 122/194 (62%), Gaps = 9/194 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKFIPG  V+ EG+  F + + A  SPLA R+  I GI  V++G DF
Sbjct: 66  MFIQTESTPNEDSLKFIPGVPVMEEGSAEFLDTRSALASPLALRLMGIEGITGVFYGPDF 125

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAV 117
           +TV K   + W  ++P V  ++ME F SG P+  +    +   +  G  D   +++DS  
Sbjct: 126 VTVSKSSDHPWAVVKPEVYALLMEFFSSGQPLFRS----EEDREAAGPQDTRILDTDSET 181

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+L+ RVRPA+  DGGDI ++G+   DGIV + ++G+C GC S+S TLK G+  +
Sbjct: 182 VAMIKELLETRVRPAIMEDGGDIEYRGFDENDGIVRVKLKGSCRGCESSSVTLKSGIERM 241

Query: 176 LNHFVPEVKDIRTV 189
           L H+VPEVK +  +
Sbjct: 242 LMHYVPEVKGVEQI 255


>gi|225707158|gb|ACO09425.1| HIRA-interacting protein 5 [Osmerus mordax]
          Length = 268

 Score =  163 bits (413), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + IQT+DTPNP +LKF+PG+ VL  G + F   + AE S LA  +F I G+ SV+FG DF
Sbjct: 64  LSIQTQDTPNPRSLKFLPGKPVLGTGTLDFPTPQNAECSSLAKDLFEIEGVKSVFFGPDF 123

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D  +W +++   +  I + F SG PI    G+   +          E D  +V
Sbjct: 124 ITVTKADDDVEWTNIKRHAVEAITKFFDSGAPI--TTGVSHHE------SSHSEDDDEIV 175

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS+S TL+ G+ N+L  
Sbjct: 176 SIIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSSVTLRNGIQNMLQF 235

Query: 179 FVPEVKDIRTV 189
           ++PEV D+  V
Sbjct: 236 YIPEVDDVEQV 246


>gi|209484091|gb|ACI47520.1| iron-sulfer cluster scaffold protein NFU4 [Eucalyptus grandis]
          Length = 243

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 118/190 (62%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ +  S LA  +F I G+  V++G DF
Sbjct: 40  MFIQTQSTPNPMSLMFYPGKPVMEVGSADFPNARTSMNSALARALFGIDGVTRVFYGSDF 99

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   IM+ + SG P+     L       M +    E DS  V 
Sbjct: 100 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLF----LDSQTASAMDTA-IHEDDSETVA 154

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 155 MIKELLETRIRPAVQDDGGDIEYRGFDLDTGIVKLRMQGACSGCPSSSVTLKSGIENMLM 214

Query: 178 HFVPEVKDIR 187
           H+VPEVK + 
Sbjct: 215 HYVPEVKAVE 224


>gi|88658493|ref|YP_507026.1| NifU domain-containing protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599950|gb|ABD45419.1| NifU domain protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 186

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 128/190 (67%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ  +TPNP TLKF+PG  +       F+++  AE S LA+ +F I  + SV+FG DF
Sbjct: 1   MFIQIGETPNPNTLKFMPGMPINNGKVSEFADSVAAEGSSLATALFKIEYVKSVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K D  +W+ L+P +L +IME F++ +           +L++     F E D  +V 
Sbjct: 61  VSVTKSDDIEWDVLKPEILTVIME-FLTLNSDNATESFDQEELEEF----FDEKDIEMVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++DN V+PAV +DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L+++
Sbjct: 116 KIKELIDNYVKPAVIQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLSYY 175

Query: 180 VPEVKDIRTV 189
           +P+++ + ++
Sbjct: 176 IPDIQGVESI 185


>gi|88608783|ref|YP_506689.1| NifU-like domain-containing protein [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600952|gb|ABD46420.1| NifU-like domain protein [Neorickettsia sennetsu str. Miyayama]
          Length = 180

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 120/190 (63%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF PG  +L  G   F    +A    L   ++ I G+  V  G DF
Sbjct: 1   MFIQTEHTPNPNVLKFFPGVKILDSGTADFVTFSDASGHKLPEMLWEIQGVCGVMLGVDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K +  +W+ L+P + G+++E+F +G   +            +   + +E    V +
Sbjct: 61  VSVSKTEDAEWDVLKPQIFGVLVEYFTTGSDFVRP----------VTEDEEVECTDEVSK 110

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D +VRP+V  DGG+IVFKGY+DGIV+L ++GAC+GCPSAS TLK G+ N+L ++
Sbjct: 111 KIQEIIDTKVRPSVIEDGGNIVFKGYKDGIVYLKLQGACAGCPSASVTLKDGIENLLQYY 170

Query: 180 VPEVKDIRTV 189
           +PEV++++ V
Sbjct: 171 IPEVREVQQV 180


>gi|296421235|ref|XP_002840171.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636384|emb|CAZ84362.1| unnamed protein product [Tuber melanosporum]
          Length = 279

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 123/192 (64%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQTE TPNP+ LKFIPG  VL EG  +  + + +E   SPLA ++F++ G+ SV++G 
Sbjct: 48  LFIQTESTPNPSALKFIPGLPVLPEGCQSQEYIDGRETHNSPLARKLFAVDGVRSVFYGP 107

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFIT+ KD+   W  L+  V  +I E   SG+P+I  G +      +       E DS V
Sbjct: 108 DFITITKDEETQWAFLKAEVYSLITEALNSGEPVILEGTM------ESSDTQREEGDSEV 161

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+L+ R+RPA+  DGGDI ++G+ +G+V L +RGAC  C S++ TLK G+ ++L 
Sbjct: 162 VGMIKELLETRIRPAIQEDGGDIEYRGFENGVVKLKLRGACRTCDSSTVTLKNGIESMLM 221

Query: 178 HFVPEVKDIRTV 189
           H++ EV+ ++ +
Sbjct: 222 HYIEEVQSVQQI 233


>gi|85083846|ref|XP_957202.1| HIRA-interacting protein 5 [Neurospora crassa OR74A]
 gi|18376131|emb|CAD21196.1| conserved hypothetical protein [Neurospora crassa]
 gi|28918289|gb|EAA27966.1| HIRA-interacting protein 5 [Neurospora crassa OR74A]
          Length = 326

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 125/203 (61%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEI----SPLASRIFSIPGIA 52
           +FIQTE+TPNP +LKF+P Q V+ +      I + NA+        SPLA+++ +I G+ 
Sbjct: 83  IFIQTENTPNPDSLKFLPNQKVIPDSIKTPFIEYMNARSTIAPPYPSPLAAQLMNIEGVT 142

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV++G DFITV K    +W H+RP V  +I E   SG  I++      G     + D+  
Sbjct: 143 SVFYGTDFITVTKSADANWAHIRPEVFALITETITSGQTIVNVVERNEGEESTQESDEKD 202

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ 
Sbjct: 203 SLAYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVKLKLRGACRTCDSSTV 262

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+  +L H++ EV+ +  V
Sbjct: 263 TLKNGIEGMLMHYIEEVQGVEQV 285


>gi|4680705|gb|AAD27742.1|AF132967_1 CGI-33 protein [Homo sapiens]
          Length = 231

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 122/193 (63%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD- 59
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+F +D 
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFF-WDQ 93

Query: 60  -FITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            FITV K+  + DW  L+P +   IM+ F SG P++      +    + GS    E D  
Sbjct: 94  IFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTE----ETPPGEAGS----EEDDE 145

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 146 VVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNML 205

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 206 QFYIPEVEGVEQV 218


>gi|326430239|gb|EGD75809.1| HIRA-interacting protein 5 [Salpingoeca sp. ATCC 50818]
          Length = 269

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 112/190 (58%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +L F PG  V   G   F+   +   SPLA  +  I G+  V+ G DF
Sbjct: 61  MFIQTRDTPNPNSLMFYPGTEVTGTGTADFARGGDTSKSPLARVLLRIDGVQGVFLGPDF 120

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K++  DW  ++P + G IM+ F S  P++  G   +       +    E D  VV 
Sbjct: 121 ITISKEEDVDWGVMKPHIFGSIMDFFASNQPVLLEGEEAN------AASTASEEDDEVVS 174

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD R+RPAV  DGGDI+F  + +GIV L + GAC GCPS+  TLK GV N+L H+
Sbjct: 175 MIKELLDTRIRPAVQDDGGDIIFMEFTNGIVKLKLSGACEGCPSSMYTLKQGVENMLMHY 234

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 235 IPEVEGVEQV 244


>gi|42562675|ref|NP_175550.2| NFU5; ATP binding / structural molecule [Arabidopsis thaliana]
 gi|75169527|sp|Q9C8J2|NIFU5_ARATH RecName: Full=NifU-like protein 5, mitochondrial; Short=AtNfu-I;
           Short=AtNfu5; Flags: Precursor
 gi|12325368|gb|AAG52627.1|AC024261_14 unknown protein; 90320-88994 [Arabidopsis thaliana]
 gi|28207824|emb|CAD55562.1| NFU5 protein [Arabidopsis thaliana]
 gi|105829764|gb|ABF74703.1| At1g51390 [Arabidopsis thaliana]
 gi|110741134|dbj|BAE98660.1| hypothetical protein [Arabidopsis thaliana]
 gi|332194540|gb|AEE32661.1| NifU-like protein 5 [Arabidopsis thaliana]
          Length = 275

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 120/190 (63%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I G+  V++G DF
Sbjct: 75  MFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIFAIDGVVRVFYGSDF 134

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +  ++M+ + SG P+  +      K   +      E DS  V 
Sbjct: 135 VTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAKDTAIH-----EDDSETVA 189

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RP+V  DGGDI + G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 190 MIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLM 249

Query: 178 HFVPEVKDIR 187
           H+V EVK + 
Sbjct: 250 HYVSEVKGVE 259


>gi|66808847|ref|XP_638146.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium discoideum AX4]
 gi|60466582|gb|EAL64634.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium discoideum AX4]
          Length = 314

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 121/185 (65%), Gaps = 6/185 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE TPNP +LKFIPG  VL EG I  FS+ K ++ SPLA+ +F + G+  V+F  D
Sbjct: 98  IFIQTETTPNPDSLKFIPGVQVLEEGQIIDFSDFKTSQQSPLANNLFKLDGVNRVFFSSD 157

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K  +++W  L+P + G I++ + SG PI+ +  LG++  D M     +  D  VV
Sbjct: 158 FISVNKYPEHEWSILKPQIYGTIIDFYHSGLPILSDPSLGNINADTM----ILPEDDEVV 213

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 214 AMIKELIETRIRPTVLEDGGNIKYMGFKDGIVMVQLQGTCSSCSSSQATLKGGIERMLMH 273

Query: 179 FVPEV 183
           ++ EV
Sbjct: 274 WISEV 278


>gi|213512278|ref|NP_001134266.1| NFU1 iron-sulfur cluster scaffold homolog [Salmo salar]
 gi|209731958|gb|ACI66848.1| NFU1 iron-sulfur cluster scaffold homolog [Salmo salar]
          Length = 263

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + IQT+DTPNP +LKFIPG+ VL  G + F +   AE S LA  +F I G+ SV++G DF
Sbjct: 59  LSIQTQDTPNPRSLKFIPGKPVLGVGTLDFPSPSSAECSSLARDLFGIEGVKSVFYGPDF 118

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D  +W  ++   +  I + F SGDPI    G+   +          E D  +V
Sbjct: 119 ITVTKADDDVEWTDIKHHAMDAITKFFDSGDPI--TTGVTHHE------SSHSEDDDEIV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ +G V L + G+C+GCPS++ TLK G+ N+L  
Sbjct: 171 SMIKELLDTRIRPTVMEDGGDVIFKGFENGTVKLKLVGSCTGCPSSTVTLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV D+  V
Sbjct: 231 YIPEVDDVEQV 241


>gi|269959159|ref|YP_003328948.1| NifU domain containing protein [Anaplasma centrale str. Israel]
 gi|269848990|gb|ACZ49634.1| NifU domain containing protein [Anaplasma centrale str. Israel]
          Length = 188

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 129/196 (65%), Gaps = 15/196 (7%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP  L+F+       VE  + FS+A  A  S LA  +F I G++ V+FG D
Sbjct: 1   MFIQIENTPNPDALRFLLSADAGNVESGVEFSDADAARSSALARLLFDIQGVSKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFIS-----GDPIIHNGGLGDMKLDDMGSGDFIES 113
           FI+V K    DW+ LRP +L ++M  ++S       P+  +   G+ +        F E 
Sbjct: 61  FISVTKLPHADWDTLRPEIL-VVMTDYLSLRGADATPLPAHEDGGEQEF-------FDEV 112

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           D+ VV+R+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV 
Sbjct: 113 DTEVVKRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVY 172

Query: 174 NILNHFVPEVKDIRTV 189
            +L+++VPEVK + +V
Sbjct: 173 GMLSYYVPEVKAVESV 188


>gi|254995338|ref|ZP_05277528.1| hypothetical protein AmarM_05319 [Anaplasma marginale str.
           Mississippi]
 gi|255003523|ref|ZP_05278487.1| hypothetical protein AmarPR_04754 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004646|ref|ZP_05279447.1| hypothetical protein AmarV_05119 [Anaplasma marginale str.
           Virginia]
          Length = 189

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 130/194 (67%), Gaps = 10/194 (5%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP  L+F+   ++  +   I FS+A  A+ S LA  +F I G++ V+FG D
Sbjct: 1   MFIQIEVTPNPDALRFLLSAEIGAIGSGIEFSDATTAQGSTLARLLFEIQGVSKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNG--GLGDMKLDDMGSGDFIES-DS 115
           F++V K    DW+ LRP +L ++ ++F      +HN          ++    +F ++ DS
Sbjct: 61  FVSVTKLPDADWDTLRPEILVVMTDYFS-----LHNAYSDAAPQAHEESDEREFFDTKDS 115

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            VVQR+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +
Sbjct: 116 EVVQRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVYGM 175

Query: 176 LNHFVPEVKDIRTV 189
           L+++VPEVK + +V
Sbjct: 176 LSYYVPEVKAVESV 189


>gi|145507614|ref|XP_001439762.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124406957|emb|CAK72365.1| unnamed protein product [Paramecium tetraurelia]
          Length = 207

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 11/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQ + TPNP  LKFIP G+ V++ G   FS  +EA+ SPLA ++F I G+  V++G D
Sbjct: 10  LFIQAKPTPNPNFLKFIPDGKQVMLNGTYDFSRPREAKCSPLAQKLFMIDGVNRVFYGKD 69

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD---FIESDS 115
           +I++ K ++  WE L+P +   IMEH+     +   G    + +D           E DS
Sbjct: 70  YISISKNEESKWEELKPQIFEQIMEHY----QLDAEGKEKQLIIDGYSENQDTQIKEEDS 125

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
             +Q IKE++D R+RP V  DGGDIVF+ +  ++GIV L M+G+C+GCPS+S TLK G+ 
Sbjct: 126 EAIQLIKEIIDTRIRPTVQEDGGDIVFRDFDEQNGIVHLYMKGSCAGCPSSSITLKNGIE 185

Query: 174 NILNHFVPEVKDI 186
            +L H+V EVK++
Sbjct: 186 RMLCHYVAEVKEV 198


>gi|56417173|ref|YP_154247.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries]
 gi|222475537|ref|YP_002563954.1| hypothetical protein AMF_868 [Anaplasma marginale str. Florida]
 gi|56388405|gb|AAV86992.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries]
 gi|222419675|gb|ACM49698.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 194

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 130/194 (67%), Gaps = 10/194 (5%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP  L+F+   ++  +   I FS+A  A+ S LA  +F I G++ V+FG D
Sbjct: 6   MFIQIEVTPNPDALRFLLSAEIGAIGSGIEFSDATTAQGSTLARLLFEIQGVSKVFFGGD 65

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNG--GLGDMKLDDMGSGDFIES-DS 115
           F++V K    DW+ LRP +L ++ ++F      +HN          ++    +F ++ DS
Sbjct: 66  FVSVTKLPDADWDTLRPEILVVMTDYFS-----LHNAYSDAAPQAHEESDEREFFDTKDS 120

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            VVQR+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +
Sbjct: 121 EVVQRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVYGM 180

Query: 176 LNHFVPEVKDIRTV 189
           L+++VPEVK + +V
Sbjct: 181 LSYYVPEVKAVESV 194


>gi|225707504|gb|ACO09598.1| HIRA-interacting protein 5 [Osmerus mordax]
          Length = 263

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 11/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + IQT+DTPNP +LKF+PG+ VL  G + F   + AE S LA  +F I G+ SV+FG DF
Sbjct: 60  LSIQTQDTPNPRSLKFLPGKPVLGTGTLDFPTPQNAECSSLAKDLFEIEGVKSVFFGPDF 119

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D  +W +++   +  I + F SG PI    G+   +            D  +V
Sbjct: 120 ITVTKADDDVEWTNIKRHAVEAITKFFDSGAPI--TTGVSHHESSH-------SEDDEIV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS+S TL+ G+ N+L  
Sbjct: 171 SIIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSSVTLRNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV D+  V
Sbjct: 231 YIPEVDDVEQV 241


>gi|193599106|ref|XP_001949519.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Acyrthosiphon pisum]
          Length = 254

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 120/193 (62%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP ++KF+PG  VL +G  + F NA  A  SPLA  +F I G+ SV+FG D
Sbjct: 43  MFIQTQDTPNPNSVKFLPGVQVLEKGHTMDFPNATAAYCSPLAKVLFRIEGVKSVFFGSD 102

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG-LGDMKLDDMGSGDFIESDSA 116
           +IT+ K  D  +W  L+P +   IM+ F SG PI+ +     D ++         E D+ 
Sbjct: 103 YITLTKTDDDIEWMVLKPEIYATIMDFFASGLPILTDAKPTSDTQIH--------EDDNE 154

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+LD+R+RP V  DGGDI+F GY  GIV L ++G+C+ CPS+  TLK GV  +L
Sbjct: 155 TVMMIKELLDSRIRPTVQEDGGDILFIGYDAGIVKLKLQGSCTSCPSSVVTLKGGVQYML 214

Query: 177 NHFVPEVKDIRTV 189
             ++PEV  +  V
Sbjct: 215 QFYIPEVIAVEQV 227


>gi|297847512|ref|XP_002891637.1| hypothetical protein ARALYDRAFT_892107 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337479|gb|EFH67896.1| hypothetical protein ARALYDRAFT_892107 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 274

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 119/190 (62%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I G+  V+FG DF
Sbjct: 74  MFIETQSTPNPSSLMFNPGKPVMDIGSADFPNSRSAMGSPLAKAIFAIDGVVRVFFGSDF 133

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +  ++M+ + SG P+  +      K          E DS  V 
Sbjct: 134 VTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAK-----DTAIHEDDSETVA 188

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RP+V  DGGDI + G+    GIV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 189 MIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLM 248

Query: 178 HFVPEVKDIR 187
           H+V EVK + 
Sbjct: 249 HYVSEVKGVE 258


>gi|307189950|gb|EFN74186.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Camponotus floridanus]
          Length = 289

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 119/186 (63%), Gaps = 12/186 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  S LA  +F I G+ +++FG D
Sbjct: 81  MFIQTQDTPNPNSLKFIPGVPVLGEGCTKDFPSAKDAYCSSLAKMLFRIEGVKAIFFGPD 140

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P +   IM+ F SG PI++         D   + D    D  +
Sbjct: 141 FITVTKLDEDVEWKLLKPEIFATIMDFFASGLPIMNETS--QPATDTQINAD----DDEI 194

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+L+ R+RP V  DGGDI   G+ +GIV L M+G+C+ CPS++ TL+ GV N++ 
Sbjct: 195 VQMIKELLETRIRPTVQEDGGDI---GFEEGIVKLKMQGSCTNCPSSAVTLRNGVQNMMR 251

Query: 178 HFVPEV 183
            ++PEV
Sbjct: 252 FYIPEV 257


>gi|239946652|ref|ZP_04698405.1| type Fe-S cluster assembly protein NFU [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|241563470|ref|XP_002401717.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215501909|gb|EEC11403.1| conserved hypothetical protein [Ixodes scapularis]
 gi|239920928|gb|EER20952.1| type Fe-S cluster assembly protein NFU [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 190

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 122/184 (66%), Gaps = 14/184 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ ++ +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEIISDQPVFFSELAEVKGRSKLAESLFHINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH---NGGLGDMKLDDMGSGDFIESDS 115
           FITV K  + +W+ ++P +L +IM+HF++G P+       G  +  LD +         S
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVAGFPVFEESTKAGNVNHSLDGL---------S 111

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + ++I E+++ RVRP+VA+DGGDI++KG+ +GIV L++RGAC GCPS++ TLK G+ ++
Sbjct: 112 EIEKQIVEIIETRVRPSVAQDGGDIIYKGFENGIVKLALRGACLGCPSSTITLKNGIESM 171

Query: 176 LNHF 179
           L HF
Sbjct: 172 LKHF 175


>gi|145505407|ref|XP_001438670.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124405842|emb|CAK71273.1| unnamed protein product [Paramecium tetraurelia]
          Length = 207

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 124/193 (64%), Gaps = 11/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQ + TPNP  LKFIPG + V++ G   F+  +EA+ SPLA ++F I G+  V++G D
Sbjct: 10  LFIQAKPTPNPNFLKFIPGGKQVMLNGTYDFTRPREAKCSPLAQKLFLIDGVTRVFYGKD 69

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD---DMGSGDFIESDS 115
           +I++ K ++  WE ++P +   IMEH+     +  +G    + +D   +       E DS
Sbjct: 70  YISIAKKEESRWEEIKPQIFEHIMEHY----QLDSDGQEKKLIIDGYQENQDTQINEDDS 125

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
            VVQ IKE++D R+RP V  DGGDIVF+ +  + GIV L M+G+C+GCPS+S TLK G+ 
Sbjct: 126 EVVQLIKEIIDTRIRPTVQEDGGDIVFRDFDEKSGIVQLYMKGSCAGCPSSSVTLKNGIE 185

Query: 174 NILNHFVPEVKDI 186
            +L H+V EVK++
Sbjct: 186 RMLCHYVAEVKEV 198


>gi|303274691|ref|XP_003056661.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461013|gb|EEH58306.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 190

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 122/175 (69%), Gaps = 9/175 (5%)

Query: 16  FIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-YDWEHL 73
           F+PG+ V  +   ++F+  +EA  SPLA ++F+I G+ SV+FG D++TV K++ ++W  L
Sbjct: 2   FMPGKPVNPDAPPLNFATPREAMASPLAKKLFAIDGVVSVFFGADYVTVTKNETHEWGVL 61

Query: 74  RPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAV 133
           +P V   +M+H+ SGDP++ +    D +L   G+    + D  +V  IKE+L+ R+RPAV
Sbjct: 62  KPEVFAAVMDHYASGDPLVSD----DAELVAAGTA-IADDDDEIVAMIKELLETRIRPAV 116

Query: 134 ARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           A DGGDIV+KG+ +  G+V + MRGAC GCPS+S TLK G+ N+L H+VPEVK++
Sbjct: 117 AEDGGDIVYKGWDESTGVVTVQMRGACDGCPSSSVTLKSGIENMLRHYVPEVKEV 171


>gi|73667413|ref|YP_303429.1| nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake]
 gi|72394554|gb|AAZ68831.1| Nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake]
          Length = 186

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 130/193 (67%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ E+TPNP TLKF+PG  V       F++   AE SPLA+ +F +  +  V+FG DF
Sbjct: 1   MFIQIEETPNPNTLKFMPGVPVNNGKVSEFADNIAAESSPLAAALFKVEHVKGVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD---DMGSGDFIESDSA 116
           +++ K D+ +W+ L+P VL +IME F++ +P       GD   D   +     F E D  
Sbjct: 61  VSITKSDEIEWDVLKPEVLTVIME-FLTLNP-------GDSTEDFNEEETDEFFDEKDVE 112

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +IKE++++ V+PAV +DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L
Sbjct: 113 MVDKIKELINDYVKPAVMQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNML 172

Query: 177 NHFVPEVKDIRTV 189
           ++++P+++ + +V
Sbjct: 173 SYYIPDIQGVESV 185


>gi|189200054|ref|XP_001936364.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187983463|gb|EDU48951.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 312

 Score =  160 bits (404), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 88/205 (42%), Positives = 123/205 (60%), Gaps = 19/205 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           MFIQTE TPN   LKF P Q VL E      + + N +        SPLA+++ +I GI 
Sbjct: 70  MFIQTEPTPNADALKFNPNQRVLPENISSPFLEYLNPRSTLAPPHPSPLAAQLMNIDGIT 129

Query: 53  SVYFGYDFITVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHN-------GGLGDMKLDD 104
           SV+FG D+ITV KD    W H++P V  +I E+  SG PI++         G G  + D 
Sbjct: 130 SVFFGADYITVTKDSSTPWAHIKPEVFALINEYMTSGQPIVNTVAAKAGEQGQGGQENDS 189

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           +    + E+D  VV  IKE+L+ RVRPA+  DGGDI F+G+ DG V+L +RGAC  C S+
Sbjct: 190 LA---YDENDDEVVGMIKELLETRVRPAIQEDGGDIEFRGFNDGQVWLKLRGACRTCDSS 246

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
           + TLK G+ ++L H++ EVK ++ V
Sbjct: 247 TVTLKNGIESMLMHYIEEVKGVQQV 271


>gi|297182169|gb|ADI18341.1| thioredoxin-like proteins and domains [uncultured Rhodobacterales
           bacterium HF4000_03E16]
          Length = 146

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 103/151 (68%), Gaps = 6/151 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+FG+DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAEGASASPLAERLFAVNGVEGVFFGHDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW+HL+P +LG IMEHF SG P++     G       G  +    D  +V 
Sbjct: 61  VTVTKAEAMDWDHLKPSLLGAIMEHFQSGAPVMAGDAAG-----PSGHAEHSGEDGEIVS 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIV 150
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFERGVV 146


>gi|242011992|ref|XP_002426727.1| HIRA-interacting protein, putative [Pediculus humanus corporis]
 gi|212510898|gb|EEB13989.1| HIRA-interacting protein, putative [Pediculus humanus corporis]
          Length = 216

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/192 (42%), Positives = 115/192 (59%), Gaps = 20/192 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL  G    F NA  A  SPL   +F I G+ SV+FG D
Sbjct: 14  MFIQTQDTPNPNSLKFIPGVKVLENGKTKDFPNAASALCSPLGKSLFRINGVKSVFFGPD 73

Query: 60  FITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K   D  W+ + P +   IM+ F SG PI+          ++    DF++ +   
Sbjct: 74  FITITKQDEDVSWKLINPEIFATIMDFFSSGLPILT---------ENESKSDFVKEN--- 121

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
                E+L+ R+RP V  DGGD+VFKG+ +GIV L + G+C+ CPS+  TLK G+ N+L 
Sbjct: 122 -----ELLETRIRPTVQEDGGDVVFKGFENGIVKLKLLGSCTTCPSSIVTLKNGIQNMLQ 176

Query: 178 HFVPEVKDIRTV 189
            ++PEV ++  +
Sbjct: 177 FYIPEVLEVEQI 188


>gi|238650984|ref|YP_002916840.1| hypothetical protein RPR_06295 [Rickettsia peacockii str. Rustic]
 gi|238625082|gb|ACR47788.1| hypothetical protein RPR_06295 [Rickettsia peacockii str. Rustic]
          Length = 190

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 122/181 (67%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEE----NTKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|157804045|ref|YP_001492594.1| NifU-like domain-containing protein [Rickettsia canadensis str.
           McKiel]
 gi|157785308|gb|ABV73809.1| NifU-like domain [Rickettsia canadensis str. McKiel]
          Length = 189

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 127/191 (66%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  EG I FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEINSEGPIFFSELAEVKGKSKLAESLFHINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+         K D++     ++    + 
Sbjct: 61  FITVTKQPESNWQVIKPEILMVIMDHFVSGFPVFEES----TKADNVQHN--LDGLLEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++K + +G+V L +RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIEIIETRVRPSVAQDGGDIIYKCFENGVVKLVLRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 175 FVPEVQAVEAV 185


>gi|15892941|ref|NP_360655.1| hypothetical protein RC1018 [Rickettsia conorii str. Malish 7]
 gi|15620134|gb|AAL03556.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 190

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 122/181 (67%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEE----NTKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|34581359|ref|ZP_00142839.1| hypothetical protein [Rickettsia sibirica 246]
 gi|229587020|ref|YP_002845521.1| NifU-like protein [Rickettsia africae ESF-5]
 gi|28262744|gb|EAA26248.1| unknown [Rickettsia sibirica 246]
 gi|228022070|gb|ACP53778.1| NifU-like protein [Rickettsia africae ESF-5]
          Length = 190

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 122/181 (67%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEE----NTKADNVNHN--LDGLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|168061090|ref|XP_001782524.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666009|gb|EDQ52676.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 212

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 11/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ E TPNP +L F PG+ V+  G+  F N++ A  SPLA  IF + G+  V+FG DF
Sbjct: 14  MFIQVESTPNPQSLMFYPGKPVMEVGSSDFPNSRAAMASPLAKSIFIVDGVVRVFFGADF 73

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-ESDSAVV 118
           +TV K +   W+ L+P +   IM+ + +  P+ ++            S   I E D   V
Sbjct: 74  VTVTKSEDVSWDILKPEIFAAIMDFYATKQPLFYD-------TQSQASDTAIHEDDDETV 126

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ R+RPAV  DGGDI ++G+    GIV L M+GACSGCPS++ TLK G+ N+L
Sbjct: 127 AMIKELLETRIRPAVQDDGGDIEYRGFDPESGIVSLKMQGACSGCPSSAVTLKSGIENML 186

Query: 177 NHFVPEVKDIRTV 189
            H+V EVK ++ V
Sbjct: 187 MHYVSEVKGVQEV 199


>gi|330922033|ref|XP_003299669.1| hypothetical protein PTT_10711 [Pyrenophora teres f. teres 0-1]
 gi|311326592|gb|EFQ92266.1| hypothetical protein PTT_10711 [Pyrenophora teres f. teres 0-1]
          Length = 243

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 122/205 (59%), Gaps = 19/205 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           MFIQTE TPN   LKF P Q VL E      + + N +        SPLA+++ +I G+ 
Sbjct: 1   MFIQTEPTPNADALKFNPNQRVLPENISSPFLEYLNPRSTLAPPHPSPLAAQLMNIDGVT 60

Query: 53  SVYFGYDFITVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHN-------GGLGDMKLDD 104
           SV+FG D+ITV KD    W H++P V  +I E+  SG PI++         G G  + D 
Sbjct: 61  SVFFGADYITVTKDSSTPWAHVKPEVFALINEYMTSGQPIVNTVAAKAGEQGQGGQENDS 120

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           +    + E+D  V+  IKE+L+ RVRPA+  DGGDI F+G+ DG V L +RGAC  C S+
Sbjct: 121 LA---YDENDDEVIGMIKELLETRVRPAIQEDGGDIEFRGFNDGQVLLKLRGACRTCDSS 177

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
           + TLK G+ ++L H++ EVK ++ V
Sbjct: 178 TVTLKNGIESMLMHYIEEVKGVQQV 202


>gi|157964815|ref|YP_001499639.1| NifU-like protein [Rickettsia massiliae MTU5]
 gi|157844591|gb|ABV85092.1| NifU-like protein [Rickettsia massiliae MTU5]
          Length = 191

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 121/181 (66%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 2   MFIQTADTPNPDAITFFPGQEISSDQPVFFSELAEVQGRSKLAESLFHINNVKSVFFGSD 61

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       + K D++     ++  S + 
Sbjct: 62  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEE----NTKADNVNHN--LDGLSEIE 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 116 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 175

Query: 179 F 179
           F
Sbjct: 176 F 176


>gi|212540194|ref|XP_002150252.1| NifU-related protein [Penicillium marneffei ATCC 18224]
 gi|210067551|gb|EEA21643.1| NifU-related protein [Penicillium marneffei ATCC 18224]
          Length = 321

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 124/206 (60%), Gaps = 20/206 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E  +  F       S       SPLA+++ +I GI+
Sbjct: 81  IFIQTESTPNPDALKFLPNNRVLPENFSTPFLEYLSPRSTLAPPHPSPLAAKLLNIEGIS 140

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPII----HNGGLGDMKL----D 103
           SV++G DFITV K    +W H++P V  +I E   SG+PI+    H  G  D +     D
Sbjct: 141 SVFYGPDFITVTKSSDVNWAHVKPEVFSLITEVVTSGEPIVNTVEHTSGAQDAQEGGGED 200

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPS 163
            +G   + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S
Sbjct: 201 TLG---YNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDS 257

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TLK G+ ++L H++ EV+ ++ V
Sbjct: 258 STVTLKNGIESMLMHYIEEVQGVQQV 283


>gi|325303172|tpg|DAA34414.1| TPA_inf: NifU-like domain-containing protein [Amblyomma variegatum]
          Length = 217

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP  LKF+P   VL +G   F N   A+ SPLA  +F + G+ +V+ G DF
Sbjct: 46  MFIQTQDTPNPNCLKFLPNAKVLEQGTRDFPNIGSAKNSPLARHLFRVEGVKAVFLGPDF 105

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D+ +W+ ++P +   IM+ F +G P++ +G       +D       E DS  V
Sbjct: 106 ITVTKVDDETEWKVIKPHIFAAIMDFFTTGLPVLDDGSASTQVSEDTQPR---EGDSETV 162

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
             IKE+++ R+RP V  DGGDI++ G+ DG+V L ++G+C+GCPS+S TLK G+
Sbjct: 163 LAIKELIETRIRPTVQEDGGDILYMGFEDGVVKLKLQGSCTGCPSSSVTLKAGI 216


>gi|225711062|gb|ACO11377.1| NFU1 iron-sulfur cluster scaffold homolog [Caligus rogercresseyi]
          Length = 237

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 117/194 (60%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      + F     A  SPLA  +F + G+  V+FG 
Sbjct: 27  MYIRTQETPNPQSLKFLPGVRVLETAGSTLDFPTPSAAYCSPLAKLLFRVDGVKGVFFGQ 86

Query: 59  DFITVGKDQ---YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K++    +W+ ++P V   +M+ F SG PI++               +  E D 
Sbjct: 87  DFITITKEEDSEVEWKVIKPEVYATLMDFFASGLPIVNEDA------KPHSDTEIHEDDD 140

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDI+F G+ DGIV L M+G+C+ CPS+  TLK GV N+
Sbjct: 141 DTVAMIKELLDSRIRPTVQEDGGDIIFMGFEDGIVKLKMQGSCTSCPSSIVTLKNGVQNM 200

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 201 LQFYIPEVIEVEQI 214


>gi|62202252|gb|AAH92870.1| Zgc:110319 [Danio rerio]
 gi|182890178|gb|AAI64833.1| Zgc:110319 [Danio rerio]
          Length = 256

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DF
Sbjct: 52  LSILTQDTPNPRSLKFLPGKPVLGSGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDF 111

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V
Sbjct: 112 ITLTKTDDDVEWTDIKRHAIEVIRKFFEGGEAITTGAAHAESSV--------TEDDDEIV 163

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  
Sbjct: 164 SLIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQF 223

Query: 179 FVPEVKDIRTV 189
           ++PEV ++  V
Sbjct: 224 YIPEVDNVEQV 234


>gi|225711844|gb|ACO11768.1| NFU1 iron-sulfur cluster scaffold homolog [Lepeophtheirus salmonis]
          Length = 238

 Score =  157 bits (396), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 117/194 (60%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      I F     A  SPLA  +F + G+  V+FG 
Sbjct: 29  MYIRTQETPNPQSLKFLPGVPVLETAGSTIDFPQPSAAFCSPLAKLLFRVEGVKGVFFGP 88

Query: 59  DFITVGKDQ---YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K++    +W+ ++P +   IM+ F SG PI++               +  E D 
Sbjct: 89  DFITITKEEEVNAEWKLMKPLIYATIMDFFASGLPIVNEDA------KPHSDTEIHEDDD 142

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDIVF G+ DG+V L M+G+C+ CPS+  TLK GV N+
Sbjct: 143 DTVAMIKELLDSRIRPTVQEDGGDIVFMGFDDGVVKLKMQGSCTSCPSSIVTLKNGVQNM 202

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 203 LQFYIPEVLEVEQI 216


>gi|213624625|gb|AAI71359.1| Zgc:110319 [Danio rerio]
          Length = 256

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DF
Sbjct: 52  LSILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDF 111

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V
Sbjct: 112 ITLTKTDDDVEWTDIKRHAIEVIRKFFEGGEAITTGAAHAESSV--------TEDDDEIV 163

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  
Sbjct: 164 SLIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQF 223

Query: 179 FVPEVKDIRTV 189
           ++PEV ++  V
Sbjct: 224 YIPEVDNVEQV 234


>gi|330799706|ref|XP_003287883.1| hypothetical protein DICPUDRAFT_20344 [Dictyostelium purpureum]
 gi|325082086|gb|EGC35580.1| hypothetical protein DICPUDRAFT_20344 [Dictyostelium purpureum]
          Length = 203

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE TPNP +LKFIPG  VL +G I  F + K +++SPLA+ +F I G+  V+F  D
Sbjct: 4   IFIQTETTPNPDSLKFIPGVEVLSDGQIMDFPDFKSSQVSPLANSLFKIEGVNRVFFSSD 63

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K  + DW  L+P + G I++ + SG PI+      D+  D       +  DS VV
Sbjct: 64  FISVNKYPEQDWAALKPEIYGAIIDFYNSGSPILSEHS-SDINTDTT----ILPEDSEVV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGG+I + G+ DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 119 AMIKELIETRIRPTVLEDGGNIKYMGFADGIVLVQLQGTCSSCSSSQATLKGGIERMLMH 178

Query: 179 FVPEVKDIRTV 189
           ++ EVK +  +
Sbjct: 179 WIAEVKGVVAI 189


>gi|324120927|ref|NP_001018093.2| NFU1 iron-sulfur cluster scaffold homolog [Danio rerio]
 gi|220678983|emb|CAX14770.1| novel protein similar to HIRA interacting protein 5 (hirip5,
           zgc:110319) [Danio rerio]
          Length = 256

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DF
Sbjct: 52  LSILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDF 111

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V
Sbjct: 112 ITLTKTDDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSV--------TEDDDEIV 163

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  
Sbjct: 164 SLIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQF 223

Query: 179 FVPEVKDIRTV 189
           ++PEV ++  V
Sbjct: 224 YIPEVDNVEQV 234


>gi|302409492|ref|XP_003002580.1| HIRA-interacting protein [Verticillium albo-atrum VaMs.102]
 gi|261358613|gb|EEY21041.1| HIRA-interacting protein [Verticillium albo-atrum VaMs.102]
          Length = 292

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 118/198 (59%), Gaps = 9/198 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL EG     I + N +        SPLA+++ +I G+ 
Sbjct: 66  IFIQTEPTPNPDALKFLPNHRVLPEGISVPYIEYLNPRATIAPPHPSPLAAQLLAIDGVT 125

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           +V++G DFITV K    +W H+R  +  +I E   SG P++      +    +  S  + 
Sbjct: 126 AVFYGADFITVTKAADANWAHVRAEIFALITEAITSGAPLVVVKEGAEAAPAEEDSLAYN 185

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG+V L +RGAC  C S++ TLK G
Sbjct: 186 EDDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGVVLLKLRGACRTCDSSTVTLKNG 245

Query: 172 VANILNHFVPEVKDIRTV 189
           +  +L H++ EVK +  V
Sbjct: 246 IEGMLMHYIEEVKSVNQV 263


>gi|41351250|gb|AAH65889.1| Zgc:110319 protein [Danio rerio]
          Length = 255

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DF
Sbjct: 51  LSILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDF 110

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V
Sbjct: 111 ITLTKTDDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSV--------TEDDDEIV 162

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  
Sbjct: 163 SLIKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQF 222

Query: 179 FVPEVKDIRTV 189
           ++PEV ++  V
Sbjct: 223 YIPEVDNVEQV 233


>gi|320170179|gb|EFW47078.1| TO42 [Capsaspora owczarzaki ATCC 30864]
          Length = 280

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  V+  G   F++++ A  SPLA ++  I G+  V+F   F
Sbjct: 65  MFIQTQDTPNPNSLKFMPGVTVVDAGTYDFADSRAAATSPLARQLLRIQGVNRVFFAQKF 124

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I++ K D+ +W  L+P +   IM+ F SG P++      +              ++  V 
Sbjct: 125 ISINKADEAEWPVLKPEIYATIMDFFASGLPVVEAPKTTEEA---------ATEENETVS 175

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD+R+RP V  DGGDI FK + +G+V L + G+CS CPS+  TL  GV+N+L H+
Sbjct: 176 MIKELLDSRIRPMVQEDGGDIEFKSFENGVVKLKLIGSCSTCPSSKATLYDGVSNMLMHY 235

Query: 180 VPEVKDIRTV 189
           VPE++ I  V
Sbjct: 236 VPEIEKIEQV 245


>gi|148284929|ref|YP_001249019.1| hypothetical protein OTBS_1710 [Orientia tsutsugamushi str.
           Boryong]
 gi|189184851|ref|YP_001938636.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda]
 gi|146740368|emb|CAM80805.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
 gi|189181622|dbj|BAG41402.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda]
          Length = 182

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 122/190 (64%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +LKF P Q +     +HFS  +E   S LA ++FSI  +  V+FG DF
Sbjct: 1   MFIQTQQTPNPNSLKFFPDQKISPGNPVHFSTREECTHSILARKLFSIENVKEVFFGEDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K     WE ++P +L M+M+HF++G P+  +    + +  ++   +     S + +
Sbjct: 61  ITVTKVSDGSWEVIKPEILTMLMDHFVAGLPVFES----EAEKKNIEQANL----SEIEK 112

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I E+++ +VRPAVA DGGDI +  ++DGIV L MRGAC GCPS++ TLK G+ ++L ++
Sbjct: 113 QIIEIINTKVRPAVAMDGGDIEYHSFKDGIVKLQMRGACVGCPSSTMTLKQGIESLLKYY 172

Query: 180 VPEVKDIRTV 189
           +PEV  +  V
Sbjct: 173 IPEVVSVEQV 182


>gi|170084143|ref|XP_001873295.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650847|gb|EDR15087.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 212

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 122/195 (62%), Gaps = 10/195 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKFI G  V+ +G   F + + A ISPLA R+  + G++ V++G DF
Sbjct: 1   MFIQTETTPNEDSLKFILGVPVMGDGTAEFLDTRSALISPLAIRLMGVEGVSGVFYGPDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAV 117
           +TV KD ++ W  ++P +  +IME F SG  +       D + +  G  D   +++DS  
Sbjct: 61  VTVSKDSEHRWAVVKPEIYSIIMEFFSSGQKLFRT----DEEREQAGPQDTRILDTDSET 116

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYR---DGIVFLSMRGACSGCPSASETLKYGVAN 174
           V  IKE+L+ RVRPA+  DGGDI F+G+    D +V + ++G+C GC S++ TLK G+  
Sbjct: 117 VAMIKELLETRVRPAIMEDGGDIEFRGFDEEGDRLVKVKLKGSCRGCDSSTVTLKSGIER 176

Query: 175 ILNHFVPEVKDIRTV 189
           +L H+VPEVK +  V
Sbjct: 177 MLMHYVPEVKGVEQV 191


>gi|67516331|ref|XP_658051.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4]
 gi|40747390|gb|EAA66546.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4]
 gi|259489306|tpe|CBF89467.1| TPA: NifU-related protein (AFU_orthologue; AFUA_1G04680)
           [Aspergillus nidulans FGSC A4]
          Length = 326

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 120/201 (59%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISP----LASRIFSIPGIA 52
           +FIQTE TPNP  LKFIP   VL E      + + + +     P    LA+ +F++ G+ 
Sbjct: 89  IFIQTESTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSTLAANLFNVEGVQ 148

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN---GGLGDMKLDDMGSG 108
           SV+FG DFITV K    +W H++P V  +I +   SG+PI++     G    K  +  S 
Sbjct: 149 SVFFGTDFITVTKASDTNWAHIKPEVFSLITQAVTSGEPIVNTVEKSGASGQKGGEEDSL 208

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 209 SYNEEDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCDSSTVTL 268

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 269 RNGIESMLMHYIEEVQGVEQV 289


>gi|225680672|gb|EEH18956.1| HIRA-interacting protein [Paracoccidioides brasiliensis Pb03]
          Length = 317

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E     F       S       SPLAS++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPI--IHNGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI  I   G G  K  +  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGS-KAQEEDSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK
Sbjct: 201 YNEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVNLKLRGACRTCDSSTVTLK 260

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK +  V
Sbjct: 261 NGIESMLMHYIEEVKGVNQV 280


>gi|226292348|gb|EEH47768.1| HIRA interacting protein [Paracoccidioides brasiliensis Pb18]
          Length = 317

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E     F       S       SPLAS++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPI--IHNGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI  I   G G  K  +  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGS-KAQEEDSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK
Sbjct: 201 YNEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVNLKLRGACRTCDSSTVTLK 260

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK +  V
Sbjct: 261 NGIESMLMHYIEEVKGVNQV 280


>gi|321261141|ref|XP_003195290.1| iron homeostasis-related protein [Cryptococcus gattii WM276]
 gi|317461763|gb|ADV23503.1| Iron homeostasis-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 309

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 127/193 (65%), Gaps = 9/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPN A+LKFIPG V +  GA H F + + A  SPLA+R+ +I GI  V+FG D
Sbjct: 80  MFIQTETTPNEASLKFIPG-VQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPD 138

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T  K D Y W  L+P V  ++MEHF SG  +   G  G+ + +D      +++DS +V
Sbjct: 139 FVTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGS-GESQAEDT---RILDTDSEIV 194

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ RVRPA+  DGGDI ++G+ +  GIV L ++G+C GC S+S TLK G+  +L
Sbjct: 195 GMIKELLETRVRPAIMEDGGDIEYRGFDEVTGIVKLKLKGSCRGCSSSSVTLKNGIERML 254

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV+ +  V
Sbjct: 255 THYVPEVQSVEQV 267


>gi|210075172|ref|XP_500339.2| YALI0B00264p [Yarrowia lipolytica]
 gi|199425114|emb|CAG82553.2| YALI0B00264p [Yarrowia lipolytica]
          Length = 263

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 114/187 (60%), Gaps = 10/187 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT  TPN   LKF+P   +L EG  + F++ +EA  SPLA ++F + G+ SV FG D
Sbjct: 46  MFIQTASTPNEDALKFLPSVQILPEGHTVEFTSGREAHSSPLAKKLFGVDGVRSVMFGSD 105

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K Q   W  L+P V  ++ EH  +G PI+  G       +D    D    DS VV
Sbjct: 106 FITVEKAQDTHWNTLKPEVFSILTEHITAGAPIVMEGTTA---AEDTAPCD---DDSEVV 159

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI F+G+ +  G+V L + GAC  C S++ TLK G+ ++L
Sbjct: 160 SMIKELIETRIRPAIQEDGGDIAFRGFDEDTGVVHLKLLGACRSCDSSAVTLKNGIESML 219

Query: 177 NHFVPEV 183
            H+V EV
Sbjct: 220 MHYVEEV 226


>gi|301107396|ref|XP_002902780.1| iron-sulfur cluster scaffold protein Nfu-like protein [Phytophthora
           infestans T30-4]
 gi|262097898|gb|EEY55950.1| iron-sulfur cluster scaffold protein Nfu-like protein [Phytophthora
           infestans T30-4]
          Length = 217

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 121/194 (62%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLASRIFSIPGIASVYF 56
           MFIQTE TPNP ++KF+PG+ VL E    G     +++E   SPLA ++F I G+  V+F
Sbjct: 1   MFIQTEPTPNPLSVKFLPGRSVLDERFTTGVDFTPSSEEVRRSPLAKKLFQIEGVTRVFF 60

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           G DFI+V K ++ DW+ L   +   IM+ F S + ++ +  +       +     +  D 
Sbjct: 61  GKDFISVTKTEEEDWDALNAEIFATIMDFFASDEQVMSDEPI-------VTDTTILPDDD 113

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE+L+ R+RP+V  DGGDI +KG+  + G V + + G+C+GCPS+S TLK+GV 
Sbjct: 114 EVVAMIKELLEQRIRPSVQDDGGDIFYKGFDEKTGTVSVQLAGSCAGCPSSSVTLKHGVE 173

Query: 174 NILNHFVPEVKDIR 187
           N+L H++PEV+ I 
Sbjct: 174 NMLKHYIPEVRGIE 187


>gi|134114121|ref|XP_774308.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256943|gb|EAL19661.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 309

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 127/193 (65%), Gaps = 9/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPN A+LKFIPG V +  GA H F + + A  SPLA+R+ +I GI  V+FG D
Sbjct: 80  MFIQTETTPNEASLKFIPG-VQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPD 138

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T  K D Y W  L+P V  ++MEHF SG  +   G  G+ + +D      +++DS +V
Sbjct: 139 FVTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGS-GESQAEDT---RILDTDSEIV 194

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ RVRPA+  DGGDI ++G+ +  G+V L ++G+C GC S+S TLK G+  +L
Sbjct: 195 GMIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERML 254

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV+ +  V
Sbjct: 255 THYVPEVQSVEQV 267


>gi|225710000|gb|ACO10846.1| NFU1 iron-sulfur cluster scaffold homolog [Caligus rogercresseyi]
          Length = 237

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 117/194 (60%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      + F     A  SPLA  +F + G+  V+FG 
Sbjct: 27  MYIRTQETPNPQSLKFLPGVRVLETAGSTLDFPTPSAAYCSPLAKLLFRVDGVKGVFFGQ 86

Query: 59  DFITVGKDQ---YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K++    +W+ ++P V   +M+ F SG PI++         +    GD      
Sbjct: 87  DFITITKEEDSEVEWKVIKPEVYATLMDFFASGLPIVNEDAKPHSDTEIHEDGD------ 140

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDI+F G+ DGIV L M+G+C+ CPS+  TLK GV N+
Sbjct: 141 DTVAMIKELLDSRIRPTVQEDGGDIIFMGFEDGIVKLKMQGSCTSCPSSIVTLKNGVQNM 200

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 201 LQFYIPEVIEVEQI 214


>gi|70990736|ref|XP_750217.1| NifU-related protein [Aspergillus fumigatus Af293]
 gi|66847849|gb|EAL88179.1| NifU-related protein [Aspergillus fumigatus Af293]
 gi|159130693|gb|EDP55806.1| NifU-related protein [Aspergillus fumigatus A1163]
          Length = 326

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 119/201 (59%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL EG    F       S       SPLA+ +F++ G+ 
Sbjct: 85  IFIQTENTPNPDALKFIPNHRVLPEGFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 144

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHN---GGLGDMKLDDMGSG 108
           SV++G DFITV K    +W H++P V  +I +   SG+ I++     G    +  +  S 
Sbjct: 145 SVFYGPDFITVNKSSDANWAHIKPEVFSLITQAVTSGEAIVNTVEKTGEHAQESGEQESL 204

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 205 SFSEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 264

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 265 KNGIESMLMHYIEEVQGVEQV 285


>gi|58269446|ref|XP_571879.1| iron ion homeostasis-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57228115|gb|AAW44572.1| iron ion homeostasis-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 309

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 127/193 (65%), Gaps = 9/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPN A+LKFIPG V +  GA H F + + A  SPLA+R+ +I GI  V+FG D
Sbjct: 80  MFIQTETTPNEASLKFIPG-VQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPD 138

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T  K D Y W  L+P V  ++MEHF SG  +   G  G+ + +D      +++DS +V
Sbjct: 139 FVTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGS-GESQAEDT---RILDTDSEIV 194

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ RVRPA+  DGGDI ++G+ +  G+V L ++G+C GC S+S TLK G+  +L
Sbjct: 195 GMIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERML 254

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV+ +  V
Sbjct: 255 THYVPEVQSVEQV 267


>gi|118356024|ref|XP_001011271.1| NifU-like domain containing protein [Tetrahymena thermophila]
 gi|89293038|gb|EAR91026.1| NifU-like domain containing protein [Tetrahymena thermophila SB210]
          Length = 225

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 121/195 (62%), Gaps = 14/195 (7%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQ + TPNP  LKF+P G+ V+ +G  + F  A+ A +SPLA ++F+I G+  V++G 
Sbjct: 25  LFIQAKSTPNPNFLKFVPSGKTVMNDGTTLDFIAARYAHVSPLAKKLFTIDGVNRVFYGK 84

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLDDMGSGDFIESDSA 116
           D+I++ K +  DW  L+P +  +I E F    P+  +     D K+ D         DS 
Sbjct: 85  DYISISKKEDADWNELKPQIFSLITEQFTGTTPLFTDEPEREDTKIKD--------DDSE 136

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
            VQ IKE++D R+RP V  DGGD++++ + +  GIV L+M G+CSGCPS+  TLK G+  
Sbjct: 137 AVQMIKEIIDTRIRPLVQDDGGDVIYRNFDEPSGIVTLTMMGSCSGCPSSQVTLKQGIEK 196

Query: 175 ILNHFVPEVKDIRTV 189
           ++ H+VPEV  + +V
Sbjct: 197 MIMHYVPEVNGVESV 211


>gi|328773127|gb|EGF83164.1| hypothetical protein BATDEDRAFT_9276 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 225

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 114/193 (59%), Gaps = 10/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI---HFSNAKEAEISPLASRIFSIPGIASVYFG 57
           MFIQTE TPN  +LKF PG++VL EG      F +A+EA  SPLAS +F I G+ SV FG
Sbjct: 9   MFIQTESTPNLDSLKFKPGKLVLPEGTTSTREFISAREAMQSPLASTLFRIDGVKSVLFG 68

Query: 58  YDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            D ITV K     W  ++P + G IM+ + SG P+      G    D M     +  DS 
Sbjct: 69  KDVITVNKSPDVAWSIIKPDIFGAIMDFYSSGVPLFKVAFEG--PTDTM----ILPEDSE 122

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+LD R+RP +  DGGDI + G+ +G V L +RGAC  C S+  TLK G+ N+L
Sbjct: 123 TVAMIKELLDTRIRPTIQEDGGDIEYMGFVNGAVRLKLRGACRTCDSSVVTLKNGIENML 182

Query: 177 NHFVPEVKDIRTV 189
            H++PEV  +  V
Sbjct: 183 MHYIPEVTAVEQV 195


>gi|164657977|ref|XP_001730114.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966]
 gi|159104009|gb|EDP42900.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966]
          Length = 276

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 119/193 (61%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKF+PG  V+ +G   F + + +  SPLA  +F++ G++ V++G DF
Sbjct: 56  MFIQTESTPNEDSLKFLPGCRVMEKGTAEFLDQRSSMTSPLAKDLFALDGVSGVFYGPDF 115

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD    W  ++P V   +ME F +G  +  +        D       +++DS VV 
Sbjct: 116 VTVTKDTDTPWSAIKPEVYSTMMEFFTAGHSLFPDPSSAQPGSDTT----ILDTDSEVVA 171

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY---RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+LD RVRPA+  DGGD+ ++G+    DGIV + ++G+C GC S++ TLK G+  +L
Sbjct: 172 MIKELLDTRVRPAIQEDGGDLEYRGFGEDSDGIVRVKLKGSCRGCDSSTVTLKSGIERML 231

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV+ +  V
Sbjct: 232 MHYVPEVQGVEQV 244


>gi|149238520|ref|XP_001525136.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450629|gb|EDK44885.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 292

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 120/195 (61%), Gaps = 13/195 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA  SPLA R+FSI GI S+ FG +
Sbjct: 68  LFIQTAETPNDHALKFLPSLQILGENETREFLSGREAHSSPLAVRLFSIDGIKSIMFGSN 127

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN--GGLGDMKLDDMGSGDFIESDSA 116
           FIT+ K  QY+W  L+P +  ++ E+   G PI++   G L D    D+    F E D  
Sbjct: 128 FITIEKLPQYEWALLKPEIFSILTEYLNQGLPIMNEEEGALAD----DVA---FNEDDDE 180

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVAN 174
           VVQ IKE++  R+RPA+  DGGDI F  +R  DG VFL ++GAC  C S+S TLK G+ +
Sbjct: 181 VVQMIKELIFTRIRPAIQDDGGDIEFVEFRESDGTVFLRLKGACRSCDSSSVTLKNGIES 240

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++ EV+ +  +
Sbjct: 241 MLKHYIEEVQSVEPI 255


>gi|304320546|ref|YP_003854189.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503]
 gi|303299448|gb|ADM09047.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503]
          Length = 163

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 108/165 (65%), Gaps = 6/165 (3%)

Query: 28  IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFI 86
           + F   + A++SPLAS +F I G+  VY G DF+TV KD   +W+HL+P VLG + ++  
Sbjct: 1   MDFPTLESAKVSPLASALFDIDGVVEVYLGADFLTVTKDPSVEWQHLKPAVLGTVADYLA 60

Query: 87  SGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
           +G P++  G   D         D+      +V++I ++++ RVRPAVA+DGGDIVF  + 
Sbjct: 61  AGIPVVDQGAAADSA---DTPDDYEGETKEIVEQIIDLIETRVRPAVAQDGGDIVFHRFV 117

Query: 147 --DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             DGIVFLSMRGACSGCPS++ TLK G+ N+L H+VPEV  +  V
Sbjct: 118 PGDGIVFLSMRGACSGCPSSTMTLKSGIENLLKHYVPEVTAVEAV 162


>gi|88606830|ref|YP_504700.1| NifU domain-containing protein [Anaplasma phagocytophilum HZ]
 gi|88597893|gb|ABD43363.1| NifU domain protein [Anaplasma phagocytophilum HZ]
          Length = 188

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 80/192 (41%), Positives = 127/192 (66%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP TLKF+   +VV +     F +A +A+ SPLA  +F + G+  V+FG D
Sbjct: 1   MFIQIESTPNPDTLKFLLSAEVVGINSGAEFLSADDAQASPLARLLFEVEGVEKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEH-FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           F+++ K +   WE L+P VL ++ ++  + G    H     + +  +       E DS +
Sbjct: 61  FVSITKAENILWEVLKPEVLVVMTDYCLLQGTDKEHVQASAEDEEKEFFD----EKDSEI 116

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ++KE+++N V+PAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +L+
Sbjct: 117 VQQVKELIENYVKPAVAQDGGDIKFRGYKEGVVFVKLRGACSGCPSAAVTLKDGVYGMLS 176

Query: 178 HFVPEVKDIRTV 189
           +++P +K + ++
Sbjct: 177 YYIPAIKAVESI 188


>gi|220678984|emb|CAX14771.1| novel protein similar to HIRA interacting protein 5 (hirip5,
           zgc:110319) [Danio rerio]
          Length = 233

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 10/185 (5%)

Query: 7   DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK- 65
           DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT+ K 
Sbjct: 35  DTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFITLTKT 94

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
            D  +W  ++   + +I + F  G+ I       +  +         E D  +V  IKE+
Sbjct: 95  DDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSV--------TEDDDEIVSLIKEL 146

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++PEV 
Sbjct: 147 LDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYIPEVD 206

Query: 185 DIRTV 189
           ++  V
Sbjct: 207 NVEQV 211


>gi|242802633|ref|XP_002484010.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
 gi|218717355|gb|EED16776.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
          Length = 321

 Score =  153 bits (387), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 119/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E     F       S       SPLA+++ ++ G++
Sbjct: 81  IFIQTESTPNPDALKFLPNHRVLPENFPTPFLEYLSPRSTLAPPHPSPLAAKLLNVEGVS 140

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG--- 108
           SV++G DFITV K    +W H++P V  +I E   SG+PI++         D    G   
Sbjct: 141 SVFYGPDFITVTKQSDVNWAHIKPEVFSLITEVVTSGEPIVNTVERTSGAQDAQEGGGED 200

Query: 109 --DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLSYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EV+ ++ V
Sbjct: 261 TLKNGIESMLMHYIEEVQGVQQV 283


>gi|71083083|ref|YP_265802.1| NifU-like domain-containing protein [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762490|ref|ZP_01264455.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062196|gb|AAZ21199.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718292|gb|EAS84942.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 180

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 122/188 (64%), Gaps = 13/188 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP +LKF+PG+ V   G+      +E + + L   I SI G+  V+ G DF
Sbjct: 1   MFIQTEVTPNPNSLKFLPGKTVSNNGSFEVIKKEETD-NELVRNILSINGVTGVFLGEDF 59

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDP-IIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I++ K ++ +WE ++   + +I + + +G   +I N  LG+ K          E  + + 
Sbjct: 60  ISINKNEEVNWEDIKHIAISLINDFYSTGKEFVIANELLGEKK----------EEHTEIE 109

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I  +L++++RPAVA+DGGDI FK ++DGIV + ++G+CSGCPS++ TLK GV N+L H
Sbjct: 110 KQIISILESKIRPAVAKDGGDIKFKEFKDGIVKVELQGSCSGCPSSTMTLKQGVQNLLCH 169

Query: 179 FVPEVKDI 186
           ++PEVK++
Sbjct: 170 YLPEVKEV 177


>gi|255940800|ref|XP_002561169.1| Pc16g08500 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211585792|emb|CAP93520.1| Pc16g08500 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 320

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 116/200 (58%), Gaps = 11/200 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL        +E     S       SPLA+++  + G+ 
Sbjct: 84  IFIQTENTPNPDALKFIPNHRVLPEDFPSTFLEYMSPRSTLAPPHPSPLAAKLLDVEGVT 143

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN--GGLGDMKLDDMGSGD 109
           SV++G DFITV K    +W H++P V  +I +   SG+ I+    G +   +     S  
Sbjct: 144 SVFYGTDFITVTKGSDANWAHIKPEVFSIITQAVTSGETIVTTIEGAVDGEQESGEDSLS 203

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           F E D  VV  IKE+L+ R+RPA+  DGGDI  KG+ +GIV L +RGAC  C S++ TLK
Sbjct: 204 FNEDDDEVVSMIKELLETRIRPAIQEDGGDIELKGFENGIVMLKLRGACRTCDSSTVTLK 263

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK +  V
Sbjct: 264 NGIESMLMHYIEEVKGVEQV 283


>gi|226480566|emb|CAX73380.1| HIRA interacting protein 5 [Schistosoma japonicum]
 gi|226480792|emb|CAX73493.1| HIRA interacting protein 5 [Schistosoma japonicum]
          Length = 233

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 119/190 (62%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PGQ VL  G   F + K+A  SPLA ++F I G+  V+FG DF
Sbjct: 25  LFIQAQETPNPNSLKYFPGQAVLGSGTRDFPSRKQAGSSPLARQLFRIEGVEQVFFGPDF 84

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K+  ++W  ++P V   IM+ + SG P+I      +       S    E D   V 
Sbjct: 85  ITITKNNDFEWAVIKPDVYATIMDFYSSGQPVIDEEKSQE-------SDKPCEVDDETVL 137

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD R+RP V  DGGDI++KG++DGIV L ++G+CS CPS+  TLK GV N+L  +
Sbjct: 138 MIKELLDTRIRPTVQEDGGDIIYKGFKDGIVLLKLQGSCSSCPSSVVTLKNGVQNMLQFY 197

Query: 180 VPEVKDIRTV 189
           +P+V  +  V
Sbjct: 198 IPDVLGVEQV 207


>gi|238486392|ref|XP_002374434.1| NifU-related protein [Aspergillus flavus NRRL3357]
 gi|317144282|ref|XP_003189583.1| nifU-related protein [Aspergillus oryzae RIB40]
 gi|220699313|gb|EED55652.1| NifU-related protein [Aspergillus flavus NRRL3357]
          Length = 329

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 119/201 (59%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL        +E     S       SPLA+ +F++ G+ 
Sbjct: 88  IFIQTENTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 147

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN---GGLGDMKLDDMGSG 108
           S++FG +FITV K    +W H++P +  +I +   SG+PI++     G    +  +  S 
Sbjct: 148 SIFFGPEFITVTKASDANWAHIKPEIFSLITQAVTSGEPIVNTVAKSGENAQEGGEEESL 207

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 208 SYNEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVMLKLRGACRTCDSSTVTL 267

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 268 KNGIESMLMHYIEEVQGVEQV 288


>gi|198427432|ref|XP_002130447.1| PREDICTED: similar to NFU1 iron-sulfur cluster scaffold homolog (S.
           cerevisiae) [Ciona intestinalis]
          Length = 284

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 119/194 (61%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT +TPNP  LKF+PG  VL  G   F + K +  SPLA R+F I G+ +V+ G DF
Sbjct: 72  MFIQTFETPNPNCLKFVPGVPVLGTGTADFPDWKNSYKSPLAKRLFGIEGVKAVFLGPDF 131

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV +  ++  W+ L+P +  ++M+ F +G+ P++ + G               E D  +
Sbjct: 132 LTVTRQDEEVQWKVLKPEIYSLVMDFFTAGNIPVLTDEGPS-------ADTVVDEDDDEI 184

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  +KE+LD R+RP V  DGGDI+FKG+    G V L ++G+CS CPS+S TLK G+ N+
Sbjct: 185 VAMVKELLDTRIRPTVMEDGGDIIFKGFDPETGSVKLKLQGSCSNCPSSSVTLKSGIENM 244

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  V
Sbjct: 245 LKFYIPEVMEVEEV 258


>gi|331214376|ref|XP_003319869.1| iron-sulfur cluster scaffold protein Nfu [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309298859|gb|EFP75450.1| iron-sulfur cluster scaffold protein Nfu [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 357

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 119/199 (59%), Gaps = 18/199 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE TPN   LKFIPG+ V+  G+  F    +   SPLA  + S+ G+ SV+FG DF
Sbjct: 139 IFIQTEPTPNADALKFIPGRPVMKSGSREFLKGDDTRSSPLARSLLSVEGVKSVFFGPDF 198

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGD-------PIIHNGGLGDMKLDDMGSGDFIE 112
           I++ K+ +  W  ++P +  ++ME F + D       PI    G  D ++ D        
Sbjct: 199 ISINKESEVGWPTMKPEIYSLLMEFFSASDRPVVQEGPIEEESGPLDTRIHD-------- 250

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKY 170
            DS VV  IKE+LD RVRPA+  DGGD+ +KG+ +  G+V L ++G+C GC S++ TLK 
Sbjct: 251 DDSEVVAMIKELLDTRVRPAIQEDGGDLEYKGFNEETGVVQLMLKGSCRGCDSSAVTLKS 310

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+  +L H+VPEV+ +  V
Sbjct: 311 GIERMLMHYVPEVQCVEQV 329


>gi|302695957|ref|XP_003037657.1| hypothetical protein SCHCODRAFT_48637 [Schizophyllum commune H4-8]
 gi|300111354|gb|EFJ02755.1| hypothetical protein SCHCODRAFT_48637 [Schizophyllum commune H4-8]
          Length = 220

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 124/197 (62%), Gaps = 13/197 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPN  ++KFIPG  V+ E G   F + + A  SPLA R+  I G+ +V++G D
Sbjct: 1   MFIQTESTPNEDSIKFIPGVPVMGESGTAEFLDTRSALTSPLAVRLMGIEGVRAVFYGPD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG----DFIESD 114
           F+TV K  ++ W  ++P +  ++ME F S     +N  L   K D   +G      +++D
Sbjct: 61  FVTVSKSSEHPWSVIKPEIYSVLMEFFTS-----NNQPLFRSKEDRENAGPQDTRILDTD 115

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGV 172
           S VV  IKE+L+ RVRPA+  DGGDI ++G+ +  G+V + ++G+C GC S++ TLK G+
Sbjct: 116 SDVVAMIKELLETRVRPAIMEDGGDIEYRGFDEESGVVQVKLKGSCRGCSSSTVTLKTGI 175

Query: 173 ANILNHFVPEVKDIRTV 189
            N+L H++PEVK +  V
Sbjct: 176 ENMLMHYIPEVKGVEQV 192


>gi|148697451|gb|EDL29398.1| mCG14627 [Mus musculus]
          Length = 181

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 8/179 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKRVLETRTMDFSTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++           + GS    E D  VV
Sbjct: 61  ITVTKENGELDWNLLKPDIHATIMDFFASGLPLVTEE--TPPPPGEAGS----EEDDGVV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
             IKE+LD R+RP V  DGGD++++ + DGIV L ++G+C  CPS+  TLK G+    +
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVIYRAFEDGIVRLKLQGSCPSCPSSIITLKSGIRTCCS 173


>gi|91205888|ref|YP_538243.1| NifU-like protein [Rickettsia bellii RML369-C]
 gi|157826752|ref|YP_001495816.1| NifU-like protein [Rickettsia bellii OSU 85-389]
 gi|91069432|gb|ABE05154.1| NifU-like protein [Rickettsia bellii RML369-C]
 gi|157802056|gb|ABV78779.1| NifU-like protein [Rickettsia bellii OSU 85-389]
          Length = 185

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 124/181 (68%), Gaps = 11/181 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  +  I FS   E +  S LA  +F+I  + S++FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISTQ-PIFFSERAEVKGKSKLAESLFNINNVKSIFFGSD 59

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + DW+ ++P VL ++M+HF++G P+         K+DD+     +E  S + 
Sbjct: 60  FITVTKKTESDWQVIKPEVLMVVMDHFVAGFPVFEVSS----KVDDVN----LEGFSDIE 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 112 KQIIEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 171

Query: 179 F 179
           F
Sbjct: 172 F 172


>gi|322710719|gb|EFZ02293.1| NifU-like protein [Metarhizium anisopliae ARSEF 23]
          Length = 297

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 122/202 (60%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +        SPLA+++ +I GI 
Sbjct: 73  IFIQTENTPNPDALKFLPNHRVVPEEINTPFIEYLNPRSTISPPYPSPLAAKLMNIDGIT 132

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPII----HNGGLGDMKLDDMGS 107
           SV++G DFITV K    +W H+RP +  +I E   SG+ I+       G  D++ D +  
Sbjct: 133 SVFYGADFITVTKAGDANWAHVRPEIFALITEAITSGETIVSIAERKEGDEDIEEDSLA- 191

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC  C S++ T
Sbjct: 192 --YNENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFDDGYVKLKLRGACRTCDSSTVT 249

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK +  +
Sbjct: 250 LKNGIEGMLMHYIEEVKGVHQI 271


>gi|212540196|ref|XP_002150253.1| NifU-related protein [Penicillium marneffei ATCC 18224]
 gi|210067552|gb|EEA21644.1| NifU-related protein [Penicillium marneffei ATCC 18224]
          Length = 285

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (59%), Gaps = 20/197 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E  +  F       S       SPLA+++ +I GI+
Sbjct: 81  IFIQTESTPNPDALKFLPNNRVLPENFSTPFLEYLSPRSTLAPPHPSPLAAKLLNIEGIS 140

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPII----HNGGLGDMKL----D 103
           SV++G DFITV K    +W H++P V  +I E   SG+PI+    H  G  D +     D
Sbjct: 141 SVFYGPDFITVTKSSDVNWAHVKPEVFSLITEVVTSGEPIVNTVEHTSGAQDAQEGGGED 200

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPS 163
            +G   + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S
Sbjct: 201 TLG---YNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDS 257

Query: 164 ASETLKYGVANILNHFV 180
           ++ TLK G+ ++L H+V
Sbjct: 258 STVTLKNGIESMLMHYV 274


>gi|115376684|ref|ZP_01463912.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|310823922|ref|YP_003956280.1| NIF system FeS cluster assembly, NifU family protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115366301|gb|EAU65308.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396994|gb|ADO74453.1| NIF system FeS cluster assembly, NifU family protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 187

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 117/189 (61%), Gaps = 8/189 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYDFI 61
           IQ E TPNP+TLK++  + +L  GA++F+  +EAE  SPLA ++  I G+ +V  G +F+
Sbjct: 5   IQLEWTPNPSTLKYVVDRRLLSSGAVNFTRREEAEQKSPLARKLMDIQGVTAVMLGLNFV 64

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K D+ +W+ L   V+  +  H  S +P++      D            E  S+V QR
Sbjct: 65  TVTKGDEGEWDELNDAVMSTLDAHLGSDEPVV------DEAAVAAARAAPAEGGSSVEQR 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+E+LD  +RPAVA+DGGDI    Y +G+V+L M+G+CSGCPS++ TLK G+   L   +
Sbjct: 119 IREILDAEIRPAVAQDGGDITLDRYENGVVYLHMQGSCSGCPSSTATLKMGIEGRLREAI 178

Query: 181 PEVKDIRTV 189
           PEV ++ ++
Sbjct: 179 PEVTEVVSI 187


>gi|310796741|gb|EFQ32202.1| hypothetical protein GLRG_07346 [Glomerella graminicola M1.001]
          Length = 316

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 122/207 (58%), Gaps = 18/207 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEI----SPLASRIFSIPGIA 52
           +FIQTE TPN   +KF+P   +L E      I + N +        SPLA+++ +I G+ 
Sbjct: 80  IFIQTEQTPNADAIKFLPNHRILPENISTPFIEYLNPRSTIAPPYPSPLAAQLMNIDGVT 139

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV++G DFITV K    +W H+RP V  +I E   SG  I++      GG+   +    G
Sbjct: 140 SVFYGADFITVSKAADANWAHIRPEVFALITEAITSGQSIVNVAEKKEGGVAGEEQQQHG 199

Query: 107 SGD---FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCP 162
             D   + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+  DGIV L +RGAC  C 
Sbjct: 200 EEDSLAYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFTDDGIVLLKLRGACRTCD 259

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S++ TLK G+  +L H++ EVK ++ +
Sbjct: 260 SSTVTLKNGIEGMLMHYIEEVKGVQQI 286


>gi|322696539|gb|EFY88330.1| NifU-like protein [Metarhizium acridum CQMa 102]
          Length = 297

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 122/202 (60%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +        SPLA+++ +I GI 
Sbjct: 73  IFIQTENTPNPDALKFLPNHRVVPEEINTPFIEYLNPRSTISPPYPSPLAAKLMNIDGIT 132

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPII----HNGGLGDMKLDDMGS 107
           SV++G DFITV K    +W H+RP +  +I E   SG+ I+       G  D++ D +  
Sbjct: 133 SVFYGADFITVTKAGDANWAHIRPEIFALITEAITSGETIVSVAERKEGDEDIEEDSLA- 191

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E+DS VV  IKE+L+ R+RPA+  DGGDI ++G+ DG V L +RGAC  C S++ T
Sbjct: 192 --YNENDSEVVGMIKELLETRIRPAIQEDGGDIEYRGFDDGYVKLKLRGACRTCDSSTVT 249

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK +  +
Sbjct: 250 LKNGIEGMLMHYIEEVKGVHQI 271


>gi|224009450|ref|XP_002293683.1| nifu-like protein [Thalassiosira pseudonana CCMP1335]
 gi|220970355|gb|EED88692.1| nifu-like protein [Thalassiosira pseudonana CCMP1335]
          Length = 210

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 124/194 (63%), Gaps = 15/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGAIHFSNAKEAEI---SPLASRIFSIP-GIASVY 55
           +FIQT  TPNP +LKFIP G++   + A  +   K+  +   SPLA ++F++  GI S+Y
Sbjct: 15  LFIQTATTPNPESLKFIPNGRLNNTDTAGFYVTRKDHTLIARSPLAKQLFNLDIGIKSLY 74

Query: 56  FGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
            GYDFITV K  +  W+HL+ P+ G IM+ + SG P +     G+ ++ D      +E D
Sbjct: 75  LGYDFITVTKFAEAHWQHLQTPIFGAIMDFYASGKPALR----GEPEITDTT---ILEDD 127

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGV 172
             VV  IKE+L++R+RPAV  DGGDI + G+ +  G+V + + G+C GCPS+S TLK GV
Sbjct: 128 DEVVAMIKELLESRIRPAVQEDGGDIRYVGFEEETGLVTVQLAGSCVGCPSSSVTLKNGV 187

Query: 173 ANILNHFVPEVKDI 186
            N+L H++PEV  +
Sbjct: 188 ENMLMHYIPEVTAV 201


>gi|328872467|gb|EGG20834.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium fasciculatum]
          Length = 313

 Score =  151 bits (381), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 118/190 (62%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE TPNP +LKF+PG  V+ +G + F + K ++ISPLA+ IF + G+  V+FG  F
Sbjct: 104 IFIQTETTPNPDSLKFLPGVEVMEQGTVDFPDFKSSQISPLANAIFKLDGVNRVFFGPSF 163

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K  + +W  L+P V G I+  + SG P++      +   D +     +  D  VV 
Sbjct: 164 ISVNKFTETEWSILKPQVYGAIINFYHSGQPLLLEKPSAENN-DTL----ILPEDDEVVA 218

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ R+RP +  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H+
Sbjct: 219 MIKELIETRIRPTLLDDGGNIQYLGFKDGIVLVKLQGTCSSCSSSQATLKGGIERMLMHW 278

Query: 180 VPEVKDIRTV 189
           + EV+ I  V
Sbjct: 279 ISEVRGIMAV 288


>gi|150864668|ref|XP_001383601.2| hypothetical protein PICST_82838 [Scheffersomyces stipitis CBS
           6054]
 gi|149385924|gb|ABN65572.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 254

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 121/196 (61%), Gaps = 15/196 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN + LKF+P   +L E   I F + +EA  SPLA ++FSI GI S+ FG +
Sbjct: 33  LFIQTVETPNESALKFLPSIKLLEENETIEFLSGREAARSPLAVKLFSIDGIKSIMFGSN 92

Query: 60  FITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGL--GDMKLDDMGSGDFIESDS 115
           FIT+ K+  D  W  L+P +  ++ E+  +G PI+ +G     DM+++D         D 
Sbjct: 93  FITIEKNSNDLHWSLLKPEIFSILTEYLTNGTPILIDGESLSKDMEIND--------DDD 144

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE++  R+RPA+  DGGDI F  +R  DG VFL ++GAC  C S+S TLK G+ 
Sbjct: 145 EVVSIIKELIFTRIRPAIQDDGGDIEFVSFREEDGTVFLRLKGACRSCDSSSVTLKNGIE 204

Query: 174 NILNHFVPEVKDIRTV 189
           ++L +++ EVK +  V
Sbjct: 205 SMLKYYIEEVKAVEQV 220


>gi|162312172|ref|NP_595452.2| NifU-like protein [Schizosaccharomyces pombe 972h-]
 gi|46397296|sp|Q9UUB8|YH9J_SCHPO RecName: Full=NifU-like protein C1709.19c
 gi|157310401|emb|CAA21258.2| NifU-like protein [Schizosaccharomyces pombe]
          Length = 260

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 118/194 (60%), Gaps = 10/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           ++I++E+TPN   LKF+PG  +L    G+  F   +    SPLA ++F I G+ S++FG 
Sbjct: 43  IWIRSEETPNENALKFLPGLDILPPTIGSCEFMRGQGTVNSPLAQKLFDIDGVDSIFFGK 102

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFITV K    +W  ++P V  +IMEH  +G P+     L +  L        +ESDS +
Sbjct: 103 DFITVSKGAGTEWAQMKPEVFSVIMEHLSNGSPV-----LSEEPLKGASDTQILESDSQI 157

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+++  +RP++  DGGD+ F+G+  + G V L +RGAC  C S++ TLK G+  +
Sbjct: 158 VAMIKELIETSIRPSIQEDGGDVEFRGFDEKTGTVSLKLRGACRTCSSSAVTLKNGIQQM 217

Query: 176 LNHFVPEVKDIRTV 189
           L H++PEV+++  V
Sbjct: 218 LKHYIPEVENVVQV 231


>gi|119496847|ref|XP_001265197.1| NifU-related protein [Neosartorya fischeri NRRL 181]
 gi|119413359|gb|EAW23300.1| NifU-related protein [Neosartorya fischeri NRRL 181]
          Length = 326

 Score =  150 bits (379), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 118/201 (58%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E     F       S       SPLA+ +F++ G+ 
Sbjct: 85  IFIQTENTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 144

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHN---GGLGDMKLDDMGSG 108
           SV++G DFITV K    +W H++P V  +I +   SG+ I++     G    +  +  S 
Sbjct: 145 SVFYGPDFITVSKSSDANWAHIKPEVFSLITQAVTSGEAIVNTVEKTGEHAQEGGEEESL 204

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 205 SFNEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 264

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 265 KNGIESMLMHYIEEVQGVEQV 285


>gi|157826074|ref|YP_001493794.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford]
 gi|157800032|gb|ABV75286.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford]
          Length = 190

 Score =  150 bits (379), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 120/181 (66%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  +  + FS   E +  S LA  +F I  + S++FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISSDQPVFFSELAEVKGRSKLAESLFHINNVKSIFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P VL +IM+HF++G P+       D    +      I+  S + 
Sbjct: 61  FITVTKQAEGNWQIIKPEVLMIIMDHFVAGFPVFEESTKADTVNHN------IDGFSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACRGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|241959110|ref|XP_002422274.1| nifU-like protein, mitochondrial precursor, putative; protein
           involved in iron metabolism in mitochondria, putative
           [Candida dubliniensis CD36]
 gi|223645619|emb|CAX40278.1| nifU-like protein, mitochondrial precursor, putative [Candida
           dubliniensis CD36]
          Length = 302

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 116/191 (60%), Gaps = 11/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L +     F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 77  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 136

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD----MKLDDMGSGDFIESD 114
           FIT+ K + +DW  L+P +  ++ E+  +G PI+   G+ +    +  +DM      E D
Sbjct: 137 FITIEKLNNFDWSLLKPEIFSILTEYLTNGTPILLEDGVDEDGNSLLTNDMAIN---EDD 193

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
             VV  IKE++  R+RPA+  DGGDI F  +   DG V+L ++GAC  C S+S TLK G+
Sbjct: 194 DEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGI 253

Query: 173 ANILNHFVPEV 183
            ++L H++ EV
Sbjct: 254 ESMLKHYIEEV 264


>gi|121702857|ref|XP_001269693.1| NifU-related protein [Aspergillus clavatus NRRL 1]
 gi|119397836|gb|EAW08267.1| NifU-related protein [Aspergillus clavatus NRRL 1]
          Length = 320

 Score =  150 bits (378), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 117/201 (58%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL        +E     S       SPLA+ +F++ G+ 
Sbjct: 79  IFIQTENTPNPDALKFIPNHRVLPEEFPTSFLEYLSPRSTLAPPHPSPLAANLFNVEGVT 138

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD-- 109
           SV++G DFITV K    +W H++P V  +I +   SG+ I++          + G  D  
Sbjct: 139 SVFYGPDFITVTKSSDANWAHIKPEVFSLITQAVTSGETIVNTVEKSGEHAQEGGEQDSL 198

Query: 110 -FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  V+  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 199 SFNEEDDEVIGMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 258

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 259 KNGIESMLMHYIEEVQGVEQV 279


>gi|169608792|ref|XP_001797815.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15]
 gi|111063827|gb|EAT84947.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15]
          Length = 263

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 120/202 (59%), Gaps = 19/202 (9%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIASVY 55
           +TE TPN   LKF P Q VL E      + + N +        SPLA+++ +I G+ SV+
Sbjct: 24  KTEPTPNDDALKFNPNQRVLPESISSPFLEYLNPRSTLAPPHPSPLAAQLLNIDGVTSVF 83

Query: 56  FGYDFITVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHN-------GGLGDMKLDDMGS 107
            G D ITV KD    W H++P V  +I E   SG P+++         G G+ ++D +  
Sbjct: 84  LGLDHITVTKDTSTPWAHIKPEVFAIINEFMTSGQPLVNTIADKGNEQGQGNSEVDSLA- 142

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E+DS VVQ IKE+L+ R+RP++  DGGDI F+G+ DG V L +RGAC  C S++ T
Sbjct: 143 --YDENDSEVVQMIKELLETRIRPSIQEDGGDIDFRGFNDGQVLLKLRGACRTCDSSTVT 200

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK ++ V
Sbjct: 201 LKNGIESMLMHYIEEVKGVQQV 222


>gi|115390869|ref|XP_001212939.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624]
 gi|114193863|gb|EAU35563.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624]
          Length = 323

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 117/201 (58%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL        +E     S       SPLA+ + ++ G+ 
Sbjct: 86  IFIQTENTPNPDALKFIPNHRVLPEDFPTTFLEYLSPRSTLAPPHPSPLAANLLNVEGVT 145

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD-- 109
           SV++G DFITV K    +W H++P V  +I +   SG+ +++          + G  +  
Sbjct: 146 SVFYGPDFITVTKASDANWAHIKPEVFSLITQAVTSGEALVNTVAKTGEHAQEGGEEESL 205

Query: 110 -FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+LD R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 206 GYNEEDDEVVSMIKELLDTRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCDSSTVTL 265

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 266 RNGIESMLMHYIEEVQGVEQV 286


>gi|68490038|ref|XP_711140.1| hypothetical protein CaO19.6283 [Candida albicans SC5314]
 gi|68490075|ref|XP_711122.1| hypothetical protein CaO19.13662 [Candida albicans SC5314]
 gi|46432400|gb|EAK91883.1| hypothetical protein CaO19.13662 [Candida albicans SC5314]
 gi|46432419|gb|EAK91901.1| hypothetical protein CaO19.6283 [Candida albicans SC5314]
          Length = 262

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 117/197 (59%), Gaps = 11/197 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L +     F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD----MKLDDMGSGDFIESD 114
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +    +  +DM      E D
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAIN---EDD 148

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
             VV  IKE++  R+RPA+  DGGDI F  +   DG V+L ++GAC  C S+S TLK G+
Sbjct: 149 DEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGI 208

Query: 173 ANILNHFVPEVKDIRTV 189
            ++L H++ EV  +  +
Sbjct: 209 ESMLKHYIEEVNSVEPI 225


>gi|68492023|ref|XP_710207.1| hypothetical protein CaO19.3485 [Candida albicans SC5314]
 gi|46431364|gb|EAK90941.1| hypothetical protein CaO19.3485 [Candida albicans SC5314]
          Length = 262

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 117/197 (59%), Gaps = 11/197 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L +     F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD----MKLDDMGSGDFIESD 114
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +    +  +DM      E D
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAIN---EDD 148

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
             VV  IKE++  R+RPA+  DGGDI F  +   DG V+L ++GAC  C S+S TLK G+
Sbjct: 149 DEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGI 208

Query: 173 ANILNHFVPEVKDIRTV 189
            ++L H++ EV  +  +
Sbjct: 209 ESMLKHYIEEVNSVEPI 225


>gi|281208054|gb|EFA82232.1| NIF system FeS cluster assembly domain-containing protein
           [Polysphondylium pallidum PN500]
          Length = 307

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE+TPNP +LKF+PG  V+  G  I F + K ++ISPLA+ IF + G+  V++G D
Sbjct: 96  LFIQTENTPNPDSLKFVPGIEVMPPGKTIDFPDFKSSQISPLANAIFKLDGVNRVFYGPD 155

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K  +++W  L+P V G I++ + S  P+     L +   ++      +  D   V
Sbjct: 156 FISVNKFPEHEWAILKPQVFGAIIDFYHSDKPL-----LSETPTNENSDTLILPEDDETV 210

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ RVRP +  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 211 AMIKELIETRVRPTLLDDGGNIQYLGFKDGIVLVKLQGTCSSCSSSQATLKGGIERMLMH 270

Query: 179 FVPEVKDIRTV 189
           ++ EV+ I  V
Sbjct: 271 WISEVRGIMAV 281


>gi|145605625|ref|XP_370496.2| NifU-related protein [Magnaporthe oryzae 70-15]
 gi|145013431|gb|EDJ98072.1| NifU-related protein [Magnaporthe oryzae 70-15]
          Length = 319

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 119/202 (58%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEI----SPLASRIFSIPGIA 52
           +FIQTE TPN   LKF+P   VL E      I + N +        SPLA+++ +I G+ 
Sbjct: 74  IFIQTEPTPNSDALKFLPNHRVLPEDISTPFIEYLNPRSTIAPPYPSPLAAQLMNIDGVQ 133

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-------NGGLGDMKLDD 104
           SV++G DFITV K    +W H+RP +  +I E   SG  I++       +G  G     +
Sbjct: 134 SVFYGADFITVTKASDANWAHIRPEIFSLITEAITSGQKIVNIVERTDASGEDGQETSGE 193

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           + S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC  C S+
Sbjct: 194 VDSLSYNENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGNVLLKLRGACRTCDSS 253

Query: 165 SETLKYGVANILNHFVPEVKDI 186
           + TLK G+  +L H++ EV+ +
Sbjct: 254 TVTLKNGIEGMLMHYIEEVQGV 275


>gi|325187609|emb|CCA22145.1| ironsulfur cluster scaffold protein Nfulike protein putative
           [Albugo laibachii Nc14]
          Length = 287

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 117/196 (59%), Gaps = 14/196 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL----VEGAIHFSNAKEAEISPLASRIFSIPGIASVYF 56
           MF+QTE TPNP +LKF+PG+ VL      G      A E   SPLA ++F I GI+ V+F
Sbjct: 71  MFVQTEPTPNPNSLKFLPGKPVLDDRFTTGVDFVPGAAEIRQSPLAKKLFQIDGISRVFF 130

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           G DFI+V K D   W+ LR  +   I++ + +G+  + +  +       +     +  D 
Sbjct: 131 GKDFISVTKADDMHWDALRAEIFATIIDFYGTGEATMSDEPI-------VTDTTILPEDD 183

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE+L+ R+RP+V  DGGDI +K +    GIV L + GAC+GCPS+S TLK GV 
Sbjct: 184 EVVAMIKELLEQRIRPSVQDDGGDIFYKDFDVERGIVKLQLAGACAGCPSSSVTLKSGVE 243

Query: 174 NILNHFVPEVKDIRTV 189
           N+L +++PEV+ I  V
Sbjct: 244 NMLKYYIPEVQGIEEV 259


>gi|156044806|ref|XP_001588959.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980]
 gi|154694895|gb|EDN94633.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 372

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 120/202 (59%), Gaps = 14/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTEDTPNP  LKF+P   +L        I + N +        SPLA+ + +I G+ 
Sbjct: 76  IFIQTEDTPNPDALKFLPNHPILPPSLNAPFIEYLNPRSTLAPPHPSPLAASLMNIDGVK 135

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH----NGGLGDMKLDDMGS 107
           SV++G DFITV K D  +W H++P +  +I E   SG  I++     G  G+   ++  S
Sbjct: 136 SVFYGVDFITVTKADDANWAHIKPEIFSLITEAVTSGAQIVNITEKTGASGEAP-EEEDS 194

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E D  VV  IKE+L+ R+RPA+  DGGDI ++G+ DG+V L +RGAC  C S++ T
Sbjct: 195 LAYNEDDPEVVGMIKELLETRIRPAIQEDGGDIDYRGFEDGMVKLKLRGACRTCDSSTVT 254

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK +  V
Sbjct: 255 LKNGIEGMLMHYIEEVKGVVQV 276


>gi|242802638|ref|XP_002484011.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
 gi|218717356|gb|EED16777.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
          Length = 290

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 113/194 (58%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL        +E     S       SPLA+++ ++ G++
Sbjct: 81  IFIQTESTPNPDALKFLPNHRVLPENFPTPFLEYLSPRSTLAPPHPSPLAAKLLNVEGVS 140

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG--- 108
           SV++G DFITV K    +W H++P V  +I E   SG+PI++         D    G   
Sbjct: 141 SVFYGPDFITVTKQSDVNWAHIKPEVFSLITEVVTSGEPIVNTVERTSGAQDAQEGGGED 200

Query: 109 --DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLSYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFV 180
           TLK G+ ++L H+V
Sbjct: 261 TLKNGIESMLMHYV 274


>gi|238880174|gb|EEQ43812.1| HIRA-interacting protein 5 [Candida albicans WO-1]
          Length = 262

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 11/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L +     F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD----MKLDDMGSGDFIESD 114
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +    +  +DM      E D
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAIN---EDD 148

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
             VV  IKE++  R+RPA+  DGGDI F  +   DG V+L ++GAC  C S+S TLK G+
Sbjct: 149 DEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGI 208

Query: 173 ANILNHFVPEV 183
            ++L H++ EV
Sbjct: 209 ESMLKHYIEEV 219


>gi|261194942|ref|XP_002623875.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis SLH14081]
 gi|239587747|gb|EEQ70390.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis SLH14081]
          Length = 318

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH--NGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+    G G    ++  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEE-DSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK
Sbjct: 201 YNEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLK 260

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK++  V
Sbjct: 261 NGIESMLMHYIEEVKEVNHV 280


>gi|239610759|gb|EEQ87746.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis ER-3]
          Length = 318

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH--NGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+    G G    ++  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEE-DSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK
Sbjct: 201 YNEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLK 260

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK++  V
Sbjct: 261 NGIESMLMHYIEEVKEVNHV 280


>gi|327348799|gb|EGE77656.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis ATCC 18188]
          Length = 318

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH--NGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+    G G    ++  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEE-DSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK
Sbjct: 201 YNEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLK 260

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK++  V
Sbjct: 261 NGIESMLMHYIEEVKEVNHV 280


>gi|302927119|ref|XP_003054431.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735372|gb|EEU48718.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 309

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 120/202 (59%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE TPNP  LKF+P   V+ EG     I + N +        SPLA+++ +I G+ 
Sbjct: 76  IFIQTEGTPNPDALKFLPNHRVVPEGISTPFIEYLNPRATISPPHPSPLAAKLMNIDGVT 135

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD-- 109
           SV++G DFITV K    +W H+RP +  +I E   SG+ +++     + +       D  
Sbjct: 136 SVFYGADFITVTKAADANWAHIRPEIFALITEAITSGETLVNVAERREGETHPEAEEDSL 195

Query: 110 -FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASET 167
            + E DS VV  IKE+L+ R+RPA+  DGGDI F+G+ D G V L +RGAC  C S++ T
Sbjct: 196 AYNEDDSEVVGMIKELLETRIRPAIQEDGGDIDFRGFDDEGYVHLRLRGACRTCDSSTVT 255

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK ++ V
Sbjct: 256 LKNGIEGMLMHYIEEVKGVKQV 277


>gi|254455619|ref|ZP_05069048.1| nitrogen-fixing NifU domain protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082621|gb|EDZ60047.1| nitrogen-fixing NifU domain protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 179

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 118/189 (62%), Gaps = 16/189 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QTE TPNP +LKF+PG+ V   G    +  K+   + L   I SI G+  ++ G DF
Sbjct: 1   MFVQTEVTPNPNSLKFLPGKKVSNSGPFEIT-KKDGIKNDLVRNILSINGVEGIFLGEDF 59

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPII--HNGGLGDMKLDDMGSGDFIESDSAV 117
           I+V K D+ +W+ ++  V+ +I + +  G   +   +    D  LD+            +
Sbjct: 60  ISVNKNDEINWDEIKHIVISLINDFYSDGKEFVIDEDAEQSDDNLDE------------I 107

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            Q+I ++LD ++RPAVARDGGDI FK ++DG+V + ++G+CSGCPS++ TLK GV N+L 
Sbjct: 108 EQKIVKILDQKIRPAVARDGGDIKFKEFKDGVVKVQLQGSCSGCPSSTMTLKQGVQNLLC 167

Query: 178 HFVPEVKDI 186
           H++PEVK++
Sbjct: 168 HYLPEVKEV 176


>gi|154291187|ref|XP_001546179.1| NifU-like protein [Botryotinia fuckeliana B05.10]
 gi|150847081|gb|EDN22274.1| NifU-like protein [Botryotinia fuckeliana B05.10]
          Length = 313

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 122/202 (60%), Gaps = 15/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEI----SPLASRIFSIPGIA 52
           +FIQTEDTPNP  LKF+P   ++ +      I + N +        SPLA+ + +I G+ 
Sbjct: 76  IFIQTEDTPNPDALKFLPNHPIIPQDVNSPFIEYLNPRSTLAPPYPSPLAASLMNIDGVK 135

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH----NGGLGDMKLDDMGS 107
           SV++G +FITV K +  +W H++P V  +I E   SG  I++     G  G+ + +D  S
Sbjct: 136 SVFYGANFITVTKVEDANWAHIKPEVFSLITEAVTSGAQIVNITERTGASGEPEEED--S 193

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E D  VV  IKE+L+ R+RPA+  DGGDI ++G+ DG+V L +RGAC  C S++ T
Sbjct: 194 LAYNEDDPEVVGMIKELLETRIRPAIQEDGGDIDYRGFEDGLVKLKLRGACRTCDSSTVT 253

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK +  V
Sbjct: 254 LKNGIEGMLMHYIEEVKGVVQV 275


>gi|4836948|gb|AAD30650.1|AC006085_23 Similar to human CGI-33 protein [Arabidopsis thaliana]
          Length = 304

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 120/219 (54%), Gaps = 37/219 (16%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGI--------- 51
           MFIQT+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I GI         
Sbjct: 75  MFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIFAIDGIPRLLLQHTI 134

Query: 52  --------------------ASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP 90
                                 V++G DF+TV K D   W+ L+P +  ++M+ + SG P
Sbjct: 135 VSSSYNPCFVTKIVSVDAGVVRVFYGSDFVTVTKSDDVTWDILKPDIFAVVMDFYSSGQP 194

Query: 91  IIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDG 148
           +  +      K   +      E DS  V  IKE+L+ R+RP+V  DGGDI + G+    G
Sbjct: 195 LFLDSQATAAKDTAIH-----EDDSETVAMIKELLETRIRPSVQDDGGDIEYCGFDTETG 249

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           IV L M+GACSGCPS+S TLK G+ N+L H+V EVK + 
Sbjct: 250 IVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVE 288


>gi|171689560|ref|XP_001909720.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944742|emb|CAP70853.1| unnamed protein product [Podospora anserina S mat+]
          Length = 323

 Score =  147 bits (371), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 119/207 (57%), Gaps = 18/207 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN  +LKF+P   VL        VE     S       SPLA+ + ++ G+ 
Sbjct: 77  IFIQTEPTPNANSLKFLPNHPVLPESISTPFVEYLSPRSTISPPYPSPLAANLMNVDGVT 136

Query: 53  SVYFGYDFITVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIH---------NGGLGDMKL 102
           SV++G DFITV K     W H+RP +  +I E   SG P+++         +    + + 
Sbjct: 137 SVFYGQDFITVTKSADAVWAHIRPEIFSLITEAITSGQPLVNISQQSASSPSTAEQEQES 196

Query: 103 DDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCP 162
            +  S ++ E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C 
Sbjct: 197 GERDSLEYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCD 256

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S++ TLK G+  +L H++ EV+ +  V
Sbjct: 257 SSTVTLKNGIEGMLMHYIEEVQGVEQV 283


>gi|289620358|emb|CBI53216.1| unnamed protein product [Sordaria macrospora]
          Length = 290

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 112/195 (57%), Gaps = 29/195 (14%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE+TPNP +LKF+P                        +++ +I G+ SV++G DF
Sbjct: 78  IFIQTENTPNPDSLKFLPN-----------------------TKLMNIDGVTSVFYGTDF 114

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMGSGDFIESD 114
           ITV K    +W H+RP V  +I E   SG  I++      G     + D+  S  + E+D
Sbjct: 115 ITVTKSADANWAHIRPEVFALITETITSGQTIVNVVERREGEENTQESDEKDSLAYDEND 174

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK G+  
Sbjct: 175 SEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVKLKLRGACRTCDSSTVTLKNGIEG 234

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++ EV+ +  V
Sbjct: 235 MLMHYIEEVQGVEQV 249


>gi|260951229|ref|XP_002619911.1| hypothetical protein CLUG_01070 [Clavispora lusitaniae ATCC 42720]
 gi|238847483|gb|EEQ36947.1| hypothetical protein CLUG_01070 [Clavispora lusitaniae ATCC 42720]
          Length = 243

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 121/195 (62%), Gaps = 13/195 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA ISPLA ++FS+ G+ S+  G +
Sbjct: 23  LFIQTAETPNENALKFLPSTKLLQENETREFLSGREAVISPLAMKLFSVDGVKSIMLGSN 82

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL-DDMGSGDFIESDSA 116
           FIT+ K  D  +W  L+P +  ++ E   +G PII +    D +L +DM    F E D  
Sbjct: 83  FITIEKSTDDIEWAVLKPEIFSILTEFLTNGTPIISD----DAQLTNDM---QFSEDDDE 135

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
           +V  IKE++  R+RPA+  DGGDI F  + +  G+V+L ++GAC  C S+S TLK G+ +
Sbjct: 136 IVSMIKELIFTRIRPAIQDDGGDIEFVSFEENTGVVYLRLKGACRSCDSSSVTLKNGIES 195

Query: 175 ILNHFVPEVKDIRTV 189
           +L +++ EV+++R V
Sbjct: 196 MLKYYIEEVQEVRPV 210


>gi|145228927|ref|XP_001388772.1| nifU-related protein [Aspergillus niger CBS 513.88]
 gi|134054866|emb|CAK36880.1| unnamed protein product [Aspergillus niger]
          Length = 330

 Score =  147 bits (370), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 118/201 (58%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E     F       S       SPLA+ + ++ G+ 
Sbjct: 89  IFIQTENTPNPDALKFIPNHRVLPENFPTTFLEYLSPRSTLAPPHPSPLAASLLNVDGVT 148

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN---GGLGDMKLDDMGSG 108
           SV++G DFITV K    +W H++P +  +I +   SG+ I++     G    +  +  S 
Sbjct: 149 SVFYGPDFITVTKATDSNWAHIKPEIFSLITQAVTSGEAIVNTVAKTGESGQEGGESESL 208

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E +  V+  IKE+LD R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 209 AYEEEEDEVIGMIKELLDTRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTVTL 268

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 269 RNGIESMLMHYIEEVQGVEQV 289


>gi|46107542|ref|XP_380830.1| hypothetical protein FG00654.1 [Gibberella zeae PH-1]
          Length = 304

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 122/204 (59%), Gaps = 17/204 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +        SPLA+++ +I G+ 
Sbjct: 74  IFIQTENTPNPDALKFLPNHRVVPEEFSTPFIEYLNPRATISPPHPSPLAAKLMNIDGVT 133

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPII-----HNGGLGDMKLDDMG 106
           SV++G DFITV K    +W H+RP +  +I E   +G+ I+       G  G    +D  
Sbjct: 134 SVFYGADFITVTKAADANWAHIRPEIFALITEAITAGEQIVTISERREGEAGAPVEED-- 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSAS 165
           S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ D G V L +RGAC  C S++
Sbjct: 192 SLAYNENDSEVVGMIKELLETRIRPAIQEDGGDIDFRGFDDEGYVHLRLRGACRTCDSST 251

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TLK G+  +L H++ EVK ++ V
Sbjct: 252 VTLKNGIEGMLMHYIEEVKGVKQV 275


>gi|119189821|ref|XP_001245517.1| hypothetical protein CIMG_04958 [Coccidioides immitis RS]
          Length = 325

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 120/203 (59%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL        +E     S       SPLA+++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-MKLDDMGSGD- 109
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +  +    GSG+ 
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAQAGQEGSGEE 200

Query: 110 ---FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              + E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|303322791|ref|XP_003071387.1| NifU-like domain containing protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|240111089|gb|EER29242.1| NifU-like domain containing protein [Coccidioides posadasii C735
           delta SOWgp]
          Length = 325

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL        +E     S       SPLA+++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-MKLDDMGSGD- 109
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +       GSG+ 
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAHAGQEGSGEE 200

Query: 110 ---FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              + E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|76155328|gb|AAX26597.2| SJCHGC03039 protein [Schistosoma japonicum]
          Length = 222

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PGQ VL  G   F + K+A  SPLA ++F I G+  V+FG DF
Sbjct: 53  LFIQAQETPNPNSLKYFPGQAVLGSGTRDFPSRKQAGSSPLARQLFRIEGVEQVFFGPDF 112

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K+  ++W  ++P V   IM+ + SG P+I              S    E D   V 
Sbjct: 113 ITITKNNDFEWAVIKPDVYATIMDFYSSGQPVIDEE-------KSQESDKPCEVDDETVL 165

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+LD R+RP V  DGGDI++KG++DGIV L ++G+CS CPS+  TLK GV N+L
Sbjct: 166 MIKELLDTRIRPTVQEDGGDIIYKGFKDGIVLLKLQGSCSSCPSSVVTLKNGVQNML 222


>gi|320032859|gb|EFW14809.1| NifU family protein [Coccidioides posadasii str. Silveira]
          Length = 325

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL        +E     S       SPLA+++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-MKLDDMGSGD- 109
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +       GSG+ 
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAHAGQEGSGEE 200

Query: 110 ---FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              + E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|296223650|ref|XP_002757718.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 235

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 114/192 (59%), Gaps = 13/192 (6%)

Query: 2   FIQTEDTPNPATL-KFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           F+Q    P PA     +PG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 40  FVQRPLFPLPAAFCNPVPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 99

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+  + DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 100 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT---------EETPSGEAGSEEDDEV 150

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 151 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 210

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 211 FYIPEVEGVEQV 222


>gi|42523787|ref|NP_969167.1| nifU related protein [Bdellovibrio bacteriovorus HD100]
 gi|39575994|emb|CAE80160.1| nifU related protein [Bdellovibrio bacteriovorus HD100]
          Length = 186

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (61%), Gaps = 11/185 (5%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPNPAT+KF+  + V  +G       +EAE SPLA++IF  P  +SVY G DFITV K
Sbjct: 12  EPTPNPATMKFLLHKKVTDQG-FDCPTVQEAERSPLAAKIFGFPWTSSVYVGPDFITVTK 70

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
            D  DWE L  P+ G+I EH    +P++         +  + + +  E+DS +V+ IK V
Sbjct: 71  QDWVDWELLAHPLSGLIQEHLDRDEPVV---------VTFVEAEEDNENDSPMVRNIKSV 121

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           L+  +RP VA DGGDIVF  Y + ++++ M+GACSGCPS++ TLK G+   +    PE+ 
Sbjct: 122 LNREIRPVVALDGGDIVFHKYENNVLYIHMKGACSGCPSSTVTLKEGIEVRMKELFPEIV 181

Query: 185 DIRTV 189
           ++ +V
Sbjct: 182 EVVSV 186


>gi|154281411|ref|XP_001541518.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150411697|gb|EDN07085.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 279

 Score =  144 bits (362), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 44  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 103

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 104 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 163

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 164 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 223

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 224 GIESMLMHYIEEVKGVNHV 242


>gi|240279904|gb|EER43409.1| HIRA-interacting protein [Ajellomyces capsulatus H143]
 gi|325093032|gb|EGC46342.1| HIRA-interacting protein [Ajellomyces capsulatus H88]
          Length = 314

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 79  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 138

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 139 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 198

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 199 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 258

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 259 GIESMLMHYIEEVKGVNHV 277


>gi|221104801|ref|XP_002157169.1| PREDICTED: similar to HIRA interacting protein 5 [Hydra
           magnipapillata]
          Length = 267

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 119/196 (60%), Gaps = 16/196 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+ +DTPNP +LKFIPG  VL  G + F        SPLA ++F I G+ S++FG DF
Sbjct: 59  MFIRVQDTPNPNSLKFIPGCKVLESGTVDFPTPSHGYRSPLARQLFRIKGVRSIFFGKDF 118

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDS 115
           IT+ K   D   W  L+P +  +IM+ F S  P++          DD+ + D I  E D+
Sbjct: 119 ITISKSDDDDVSWVLLKPDIYAVIMDFFASNLPVLT---------DDVPAQDTIAAEDDN 169

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVA 173
             V  IKE+LD R+RP V  DGGDI+FKG+    GIV L ++G+CS CPS+S TLK GV 
Sbjct: 170 ETVLLIKELLDTRIRPTVQEDGGDIIFKGFDSVSGIVKLKLQGSCSSCPSSSVTLKNGVQ 229

Query: 174 NILNHFVPEVKDIRTV 189
           N++  ++PEV  +  V
Sbjct: 230 NMMQFYIPEVTGVEEV 245


>gi|225563079|gb|EEH11358.1| HIRA-interacting protein [Ajellomyces capsulatus G186AR]
          Length = 314

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF P   VL        VE     S       SPLA+++ ++ G++
Sbjct: 79  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 138

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 139 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 198

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 199 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 258

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 259 GIESMLMHYIEEVKGVNHV 277


>gi|116199405|ref|XP_001225514.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51]
 gi|88179137|gb|EAQ86605.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51]
          Length = 337

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 121/211 (57%), Gaps = 22/211 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEA----EISPLASRIFSIPGIA 52
           +FIQTE TPN   LKF+P   +L  G     I + N +        SPLA+++ +I G+ 
Sbjct: 86  IFIQTESTPNADALKFLPNHQILPAGLTTPFIEYLNPRATIAPPHPSPLAAQLMNIDGVT 145

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-------------NGGLG 98
           +V++G DFITV K    +W H+RP V  +I E   SG PI++               G G
Sbjct: 146 AVFYGADFITVTKAADANWAHVRPEVFALITEAITSGQPIVNVAERKEGGGGVGGAAGEG 205

Query: 99  DMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGAC 158
           +   ++  S  + E+DS VV  IKE+L+ RVRPA+  DGGDI F+G+ +G V L +RGAC
Sbjct: 206 EGAAEEKDSLAYDENDSEVVGMIKELLETRVRPAIQEDGGDIEFRGFENGYVMLKLRGAC 265

Query: 159 SGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             C S++ TLK G+  +L H++ EV+ +  V
Sbjct: 266 RTCDSSTVTLKNGIEGMLMHYIEEVQGVHQV 296


>gi|323451223|gb|EGB07101.1| hypothetical protein AURANDRAFT_54041 [Aureococcus anophagefferens]
          Length = 232

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 115/198 (58%), Gaps = 15/198 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-----GAIHFSNAKEAEI-SPLASRIFSIPGIASV 54
           +FIQ E TPNP +LKF+P Q VL E        HF       + SPLA ++F+I G+  +
Sbjct: 18  VFIQVEKTPNPFSLKFVPSQAVLGEEHQDKSGFHFHRGDTEYLRSPLAKKLFAIDGVTGI 77

Query: 55  YFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES 113
           +   DF+TV K++   W  ++P V G IM+ +  G P + +       L         + 
Sbjct: 78  FLARDFVTVSKNEDGAWATIKPHVFGHIMDFYAEGLPAVEDA------LPAASDTLITDD 131

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYG 171
           DS VV  IKE+++ R+RPAV  DGGDI F+G+ +  G+V + + G+C GCPS+S TL+ G
Sbjct: 132 DSEVVAMIKELVEARIRPAVQEDGGDIFFRGFDEATGVVKVELAGSCVGCPSSSVTLRNG 191

Query: 172 VANILNHFVPEVKDIRTV 189
           V N+L H++ EVK I  V
Sbjct: 192 VENMLMHYIAEVKAIENV 209


>gi|108761437|ref|YP_634156.1| NifU family protein [Myxococcus xanthus DK 1622]
 gi|108465317|gb|ABF90502.1| NifU family protein [Myxococcus xanthus DK 1622]
          Length = 188

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 117/189 (61%), Gaps = 7/189 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYDFI 61
           IQ E TPNP+TLK++  + +L  GA++F+N ++A+  SPLA ++  + G+ +V  G +F+
Sbjct: 5   IQLEWTPNPSTLKYVVDRRLLAGGAVNFTNPEDAQAKSPLARKLMDVRGVTAVMIGTNFV 64

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K ++ +W+ L   V+  +  H  + +P++    L   +     SG        V  R
Sbjct: 65  TVTKGEEGEWDELNDEVMSALDTHLTANEPVVDEAALAAAREAAGPSGG-----GTVEGR 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+++LDN +RPAVA DGGDI    + DGIV+L M+GAC+GCPS++ TLK G+   L   +
Sbjct: 120 IQDILDNEIRPAVAMDGGDITLDRFEDGIVYLHMKGACAGCPSSTATLKMGIEGRLREMI 179

Query: 181 PEVKDIRTV 189
           PEV ++ +V
Sbjct: 180 PEVLEVVSV 188


>gi|190345080|gb|EDK36900.2| hypothetical protein PGUG_00997 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 113/187 (60%), Gaps = 15/187 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT DTPN   LKF+P   +L E   + F + +EA  SPLA ++FS+ GI SV FG +
Sbjct: 27  LFIQTADTPNEHALKFLPSMSILKENETLEFLSGREAARSPLAVKLFSVDGIKSVMFGSN 86

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG--LGDMKLDDMGSGDFIESDS 115
           FIT+ K  +   W  ++P +  ++ EH  +G P+I++      DM+++        E D 
Sbjct: 87  FITIEKSANSNQWAVMKPEIFSILTEHLTTGAPVINDEYELSNDMEIN--------EDDD 138

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE++  R+RPA+  DGGDI F  + +  G V+L ++GAC  C S+S TLK G+ 
Sbjct: 139 EVVAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIE 198

Query: 174 NILNHFV 180
           ++L H++
Sbjct: 199 SMLKHYI 205


>gi|320585764|gb|EFW98443.1| NifU [Grosmannia clavigera kw1407]
          Length = 370

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 119/210 (56%), Gaps = 26/210 (12%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEI-----SPLASRIFSIPGIASVY 55
           TE TPN   +KF+P   VL EG     I + + + A I     SPLA+++ ++ G+ +V+
Sbjct: 121 TESTPNADAIKFLPNHQVLPEGIASPFIEYLSPR-ATIAPPYPSPLAAQLMNVDGVTAVF 179

Query: 56  FGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDM----GSG-- 108
           +G DFITV K    +W H+RP V  +I E   SG  I+     G    + +    G G  
Sbjct: 180 YGSDFITVTKATDANWAHIRPEVFALITEAITSGQAIVRPSATGSAGAEGVDGTHGEGAE 239

Query: 109 ---------DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACS 159
                     + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC 
Sbjct: 240 AEAVHEDSLQYNENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGEVLLKLRGACR 299

Query: 160 GCPSASETLKYGVANILNHFVPEVKDIRTV 189
            C S++ TLK G+ ++L H++ EVK +R V
Sbjct: 300 TCDSSTVTLKNGIESMLMHYIEEVKVVRQV 329


>gi|296817809|ref|XP_002849241.1| HIRA-interacting protein 5 [Arthroderma otae CBS 113480]
 gi|238839694|gb|EEQ29356.1| HIRA-interacting protein 5 [Arthroderma otae CBS 113480]
          Length = 304

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G+ 
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGVV 131

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P V  +I E   +G+ +I+      G  G  + +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEVFSLITEAITTGEALINIVDVRPGKEGAEEAEMEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  +V  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVMLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|254566581|ref|XP_002490401.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|238030197|emb|CAY68120.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
          Length = 249

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 112/195 (57%), Gaps = 11/195 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT+ TPN   LKF+P   +L E   I F N ++A  SPLA ++F I G+ ++  G+D
Sbjct: 21  LFIQTQTTPNDDALKFLPSMKILPEQTTIEFLNGRQAFKSPLALKLFGIDGVKTIMIGHD 80

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA-- 116
           FITV  K Q DW  L+P +  ++ E   +G P+     L +    D      +E D    
Sbjct: 81  FITVEKKTQDDWSLLKPEIFAVLTESLNNGTPV-----LNEQHQSDANDQALLEEDDEDE 135

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFK--GYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           VV  +KE++  R+RPA+  DGGDI F    Y  G V+L +RGAC  C S+S TLK G+ +
Sbjct: 136 VVSMVKELIFTRIRPAIQDDGGDIEFVRFEYETGTVYLRLRGACRSCSSSSITLKNGIES 195

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++ EV+ +  +
Sbjct: 196 MLKHYIEEVEAVEQI 210


>gi|146423384|ref|XP_001487621.1| hypothetical protein PGUG_00997 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 113/187 (60%), Gaps = 15/187 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT DTPN   LKF+P   +L E   + F + +EA  SPLA ++FS+ GI SV FG +
Sbjct: 27  LFIQTADTPNEHALKFLPSMSILKENETLEFLSGREAARSPLAVKLFSVDGIKSVMFGSN 86

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG--LGDMKLDDMGSGDFIESDS 115
           FIT+ K  +   W  ++P +  ++ EH  +G P+I++      DM+++        E D 
Sbjct: 87  FITIEKLANSNQWAVMKPEIFLILTEHLTTGAPVINDEYELSNDMEIN--------EDDD 138

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE++  R+RPA+  DGGDI F  + +  G V+L ++GAC  C S+S TLK G+ 
Sbjct: 139 EVVAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIE 198

Query: 174 NILNHFV 180
           ++L H++
Sbjct: 199 SMLKHYI 205


>gi|219130127|ref|XP_002185224.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403403|gb|EEC43356.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 195

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 116/197 (58%), Gaps = 18/197 (9%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEG-------AIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQT DTPNP +LKF+P G  VL +              AKE   SPLA  +F + G+ 
Sbjct: 6   IFIQTADTPNPESLKFVPTGVAVLTDNPDGNGFYVTKNDPAKEILRSPLAKSLFDVEGVK 65

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           +VY G DF+TV K  ++ W+ LRP +  ++M    S  P +       +++ ++     +
Sbjct: 66  AVYLGGDFVTVTKYAEHKWKILRPQLFDVLMNWADSEKPAL-------LEMPEITDTTIM 118

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLK 169
           E D  +V  IKE++++R+RPAV  DGGDI +  + +  GIV + + G+C GCPS+S TLK
Sbjct: 119 EDDDEIVAMIKELIESRIRPAVQEDGGDIRYVSFEEETGIVTVELAGSCVGCPSSSVTLK 178

Query: 170 YGVANILNHFVPEVKDI 186
            GV N+L H++PEV  +
Sbjct: 179 QGVENMLMHYIPEVSSV 195


>gi|302657114|ref|XP_003020287.1| hypothetical protein TRV_05641 [Trichophyton verrucosum HKI 0517]
 gi|291184105|gb|EFE39669.1| hypothetical protein TRV_05641 [Trichophyton verrucosum HKI 0517]
          Length = 304

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 117/203 (57%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|299469630|emb|CBN76484.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 282

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 116/195 (59%), Gaps = 14/195 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVE---GAIHFS-NAKEAEISPLASRIFSIPGIASVYFG 57
           FIQTE TPNP +LKF+PG+ VL       ++F+ + +E   SPLA  + S+ G+A V+ G
Sbjct: 66  FIQTEPTPNPNSLKFLPGRPVLPAEHGTGVYFTPDDREKSQSPLAVALLSLEGVAGVFLG 125

Query: 58  YDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            DFIT+ K D+  W  ++P V G IM+ F  G P++       +    +     ++ D  
Sbjct: 126 TDFITISKHDEGGWTLMKPVVFGEIMDFFAEGKPVM-------LAEPVVTDTTILDDDDE 178

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVAN 174
           VV  IKE+L  RVRPAV  DGGDI ++G+    G V + + G+C GCPS++ TLK GV  
Sbjct: 179 VVAMIKELLQERVRPAVQEDGGDIFYRGFDPNTGTVNVQLAGSCVGCPSSTVTLKNGVEK 238

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEV  +  V
Sbjct: 239 MLMHYIPEVTAVNAV 253


>gi|326475115|gb|EGD99124.1| NifU domain-containing protein [Trichophyton tonsurans CBS 112818]
 gi|326482250|gb|EGE06260.1| scaffold protein Nfu/NifU [Trichophyton equinum CBS 127.97]
          Length = 304

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 117/203 (57%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P V  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEVFSLITEAITRGEALVNVVDVRPGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|315052166|ref|XP_003175457.1| hypothetical protein MGYG_02982 [Arthroderma gypseum CBS 118893]
 gi|311340772|gb|EFQ99974.1| hypothetical protein MGYG_02982 [Arthroderma gypseum CBS 118893]
          Length = 301

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 116/202 (57%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLNPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH----NGGLGDMKLDDMGS 107
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G    +     +
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRPGKEGAEEVGEEA 191

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E D  +V  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ T
Sbjct: 192 VRYNEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTVT 251

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK +  V
Sbjct: 252 LKNGIESMLMHYIEEVKSVTQV 273


>gi|300175875|emb|CBK21871.2| Scaffold protein Isu1 [Blastocystis hominis]
          Length = 271

 Score =  138 bits (347), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 115/193 (59%), Gaps = 15/193 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-----IHFSNAKEAEISPLASRIFSIPGIASVY 55
           +F+Q ++TPNP   KF+P   + V  +     + F+  KEA  SPLAS++F IP + SV 
Sbjct: 28  LFVQIKETPNPDVQKFLPTPSISVLPSEFGHTMEFNTTKEARASPLASKLFDIPEVKSVL 87

Query: 56  FGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGS--GDFIE 112
            G D+I V + +  +WE+L P +   I++ F S D   H   +  +K D++     +  +
Sbjct: 88  LGNDYICVTRQKGVEWEYLNPAIFHTILDFFSSPD---HEAVV--LKPDEIPEDPNEIKD 142

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKY 170
           +DS VV+ IKE+LD R+RP +  DGGDI F  + +  G + + M GAC GC S+S TLK 
Sbjct: 143 TDSEVVRLIKELLDTRIRPRIKADGGDIFFHTFDESSGELLVRMTGACKGCASSSVTLKQ 202

Query: 171 GVANILNHFVPEV 183
           GV  ++ H++PEV
Sbjct: 203 GVEQMMKHYIPEV 215


>gi|50419691|ref|XP_458373.1| DEHA2C15796p [Debaryomyces hansenii CBS767]
 gi|49654039|emb|CAG86455.1| DEHA2C15796p [Debaryomyces hansenii]
          Length = 246

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 112/194 (57%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   ++ E     F + +EA  SPLA ++FSI GI S+ FG +
Sbjct: 29  LFIQTMETPNEHALKFLPSMQIMKENETREFLSGREAACSPLALKLFSIDGIKSIMFGSN 88

Query: 60  FITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K   D  W  L+P +  ++ E   +G PI++         DDM   +  E D   
Sbjct: 89  FITIEKANEDLHWSLLKPEIFSILTEFLNNGTPILNEES---ELTDDM---EISEDDDET 142

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +  G V+L ++GAC  C S+S TLK G+ ++
Sbjct: 143 VTMIKELIFTRIRPAIQDDGGDIEFVSFAEDNGTVYLRLKGACRSCDSSSVTLKNGIESM 202

Query: 176 LNHFVPEVKDIRTV 189
           L +++ EV  +  V
Sbjct: 203 LKYYIEEVTTVEQV 216


>gi|116781621|gb|ABK22181.1| unknown [Picea sitchensis]
          Length = 181

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 14/168 (8%)

Query: 26  GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEH 84
           G+  F NA+ A  SPLA  ++ I G+A ++FG DFITV K ++  W+ L+P +   IM+ 
Sbjct: 4   GSADFPNARVAMGSPLAKSLYGIDGVARIFFGSDFITVTKSEEVSWDILKPEIFAAIMDF 63

Query: 85  FISGDPII---HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           + SG P+     +G   D  ++        E D   V  IKE+L+ R+RPAV  DGGDI 
Sbjct: 64  YSSGQPLFLDSKSGAPTDTAIN--------EDDDETVAMIKELLETRIRPAVQDDGGDIE 115

Query: 142 FKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           + G+    G+V L M+GACSGCPS+S TLK G+ N+L H+VPEVK + 
Sbjct: 116 YCGFDPETGVVKLKMQGACSGCPSSSLTLKSGIENMLMHYVPEVKGVE 163


>gi|302500846|ref|XP_003012416.1| hypothetical protein ARB_01375 [Arthroderma benhamiae CBS 112371]
 gi|291175974|gb|EFE31776.1| hypothetical protein ARB_01375 [Arthroderma benhamiae CBS 112371]
          Length = 264

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 116/203 (57%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G  
Sbjct: 32  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 91

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G        
Sbjct: 92  SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAGAEE 151

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 152 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 211

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 212 TLKNGIESMLMHYIEEVKSVTQV 234


>gi|260949769|ref|XP_002619181.1| hypothetical protein CLUG_00340 [Clavispora lusitaniae ATCC 42720]
 gi|238846753|gb|EEQ36217.1| hypothetical protein CLUG_00340 [Clavispora lusitaniae ATCC 42720]
          Length = 237

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 113/190 (59%), Gaps = 10/190 (5%)

Query: 4   QTEDTPNPATLKFIPGQVV---LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +T  TPN   LKF+  +     L      FS + +A  SPLA ++F + G+ SV  G+DF
Sbjct: 17  KTYPTPNENALKFVSPEAEISPLKNKTFEFSTSLQAVHSPLALKLFKLNGVKSVMIGHDF 76

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K D  +W HLRP V+ ++     S D P+I    +   + D + +    E+DS VV
Sbjct: 77  LTVNKLDHVNWAHLRPEVVKLLDSFLTSKDEPVITKELIQQGENDSLSAS---ENDSEVV 133

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE++D R+RPA+  DGGDI +K + +  G VFL ++GAC  C ++ +TLK G+ ++L
Sbjct: 134 SMIKELIDTRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKGGIESML 193

Query: 177 NHFVPEVKDI 186
            H++ EVK++
Sbjct: 194 MHYIEEVKEV 203


>gi|258565761|ref|XP_002583625.1| HIRA-interacting protein 5 [Uncinocarpus reesii 1704]
 gi|237907326|gb|EEP81727.1| HIRA-interacting protein 5 [Uncinocarpus reesii 1704]
          Length = 316

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 117/203 (57%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVL--------VEGAIHFSNAKEAEISPLASRIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL        +E     S       SPLA+++F++ G++
Sbjct: 72  IFIQTETTPNADALKFIPNFTVLPKDFPTPFLEYLSPRSTLAPPHPSPLAAKLFNVDGVS 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-----MKLDDMG 106
           SV++G DFIT+ K     W H++P V  +I E   SG+ +++     D      +     
Sbjct: 132 SVFYGPDFITITKAGDASWAHIKPEVFSLITEAVTSGEQLVNTVAAKDGAEPGQEGSAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           + ++ E D  +V  I+E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 192 APEYAEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EV  +  V
Sbjct: 252 TLKNGIESMLMHYIEEVTSVTQV 274


>gi|255726880|ref|XP_002548366.1| hypothetical protein CTRG_02663 [Candida tropicalis MYA-3404]
 gi|240134290|gb|EER33845.1| hypothetical protein CTRG_02663 [Candida tropicalis MYA-3404]
          Length = 261

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 113/194 (58%), Gaps = 9/194 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAI-HFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA  SPLA ++FSI GI SV +G D
Sbjct: 32  LFIQTSETPNEQALKFLPSIQILGENQTKEFLSGREAACSPLAVKLFSIDGIKSVMYGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPII-HNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K +   W  L+P +  ++ E+  +G PI+  N   G +  D     D  E    V
Sbjct: 92  FITIEKSENIAWPLLKPEIFSILTEYLTNGSPILLENDKNGIITDDMAFDEDDDE----V 147

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  +   +G V+L ++GAC  C S+S TLK G+ ++
Sbjct: 148 VSMIKELIFTRIRPAIQDDGGDIEFIKFEPDNGTVYLKLKGACRSCDSSSVTLKNGIESM 207

Query: 176 LNHFVPEVKDIRTV 189
           L H++ EV  +  +
Sbjct: 208 LKHYIEEVNSVEPI 221


>gi|256419768|ref|YP_003120421.1| nitrogen-fixing NifU domain protein [Chitinophaga pinensis DSM
           2588]
 gi|256034676|gb|ACU58220.1| nitrogen-fixing NifU domain protein [Chitinophaga pinensis DSM
           2588]
          Length = 198

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 107/185 (57%), Gaps = 3/185 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I TE TPNP T+KF+  +++     I F +   A+ SPLA  +FS P I  V+   +FIT
Sbjct: 11  IYTEMTPNPETMKFVANKLLYPGKHIDFPDEASAKPSPLAVELFSFPFIRGVFIMANFIT 70

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K    DW  + P +   + E+     P+I+   +   K     + +    D+ VV+RI
Sbjct: 71  LTKTPDTDWNDIIPTIKAFLKEYLEDNRPVINEEEIVVTKA--AATNEVSADDTDVVKRI 128

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           KE+L+N V+PAV  DGG I FK Y DG V L ++G+CSGCPS+  TLK G+  ++   +P
Sbjct: 129 KELLENYVKPAVEMDGGAIQFKDYDDGTVTLMLQGSCSGCPSSMITLKAGIEGMMKRMIP 188

Query: 182 EVKDI 186
           EVK++
Sbjct: 189 EVKEV 193


>gi|218659803|ref|ZP_03515733.1| Scaffold protein Nfu/NifU [Rhizobium etli IE4771]
          Length = 107

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 76/97 (78%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EA+ SPLA+R+F IPG+  VYFGYDF
Sbjct: 9   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAQASPLAARLFEIPGVTGVYFGYDF 68

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL 97
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +
Sbjct: 69  ISVSKDDVEWQHLKPAILGSIMEHFMSGKPVMGDASI 105


>gi|148666783|gb|EDK99199.1| mCG130855, isoform CRA_c [Mus musculus]
          Length = 219

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 95/156 (60%), Gaps = 7/156 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 69  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 128

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  ++ DW  L+P +   IM+ F SG P++      +      G     E D  VV
Sbjct: 129 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVT-----EETPPPPGEAGSSEEDDEVV 183

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM 154
             IKE+LD R+RP V  DGGD++++G+ DGIV L +
Sbjct: 184 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKL 219


>gi|295673142|ref|XP_002797117.1| LiPid Depleted family member [Paracoccidioides brasiliensis Pb01]
 gi|226282489|gb|EEH38055.1| LiPid Depleted family member [Paracoccidioides brasiliensis Pb01]
          Length = 317

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 114/200 (57%), Gaps = 15/200 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E     F       S       SPLAS++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPI--IHNGGLGDMKLDDMGSGD 109
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI  I   G G    ++  S  
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGSQAQEE-DSLS 200

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++   K
Sbjct: 201 YNEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFDDGIVNLKLRGACRTCDSST---K 257

Query: 170 YGVANILNHFVPEVKDIRTV 189
             V  +  H    +++++ V
Sbjct: 258 LFVPTLRGHAEISIEEVKGV 277


>gi|241950625|ref|XP_002418035.1| conserved hypothetical protein [Candida dubliniensis CD36]
 gi|223641374|emb|CAX43334.1| conserved hypothetical protein [Candida dubliniensis CD36]
          Length = 237

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 113/190 (59%), Gaps = 14/190 (7%)

Query: 4   QTEDTPNPATLKFIPGQVVLV---EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +T  TPNP  LKFI  +  ++   +    F+   +A  SPLA  +F IPG+ SV  GYDF
Sbjct: 19  KTLPTPNPNALKFISPECNILPMEDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGYDF 78

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K  Y +W +LRP ++  + E   S   P+I    + + + +        E +S ++
Sbjct: 79  LTVNKQDYINWANLRPEIVEHLDEFLTSKKHPVITKELVDEAQRE-------AEEESELI 131

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI  KG+ +  G VF+ ++GAC  C ++ +TLK+G+ ++L
Sbjct: 132 SMIKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESML 191

Query: 177 NHFVPEVKDI 186
            H+V EVK++
Sbjct: 192 MHYVEEVKEV 201


>gi|327299030|ref|XP_003234208.1| NifU domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326463102|gb|EGD88555.1| NifU domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 288

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 112/194 (57%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHF-------SNAKEAEISPLASRIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG  + F       S  +    SPLA+++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFV 180
           TLK G+ ++L H+V
Sbjct: 252 TLKNGIESMLMHYV 265


>gi|218516514|ref|ZP_03513354.1| nitrogen fixation protein [Rhizobium etli 8C-3]
          Length = 99

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 73/92 (79%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          MFIQTE TPNPAT KF+PG+VV+  G   F +A EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1  MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAAEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPII 92
          I+V KD  +W+HL+P +LG IM+HF+SG P++
Sbjct: 61 ISVSKDNAEWQHLKPAILGSIMKHFMSGKPVM 92


>gi|146418001|ref|XP_001484967.1| hypothetical protein PGUG_02696 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 244

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 119/193 (61%), Gaps = 11/193 (5%)

Query: 4   QTEDTPNPATLKFI-PGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           QT  TPN   LKF+ P ++V +E     F+++ +A  SPLA ++F +PG+ SV  G DF+
Sbjct: 23  QTLSTPNENALKFVSPTKIVPMENKTFEFTSSLQAVHSPLALKLFKLPGVRSVMLGPDFL 82

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFIS--GDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           TV K D  +W HLRP VL + ++ F++   +P+I    +   + +   +      D  +V
Sbjct: 83  TVNKQDHVNWAHLRPEVLSL-LDKFLTEKQEPVITKELIEATEKEAAEADA---DDLEIV 138

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI +K + +  G VFL ++GAC  C ++ +TLK+G+ ++L
Sbjct: 139 SMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIESML 198

Query: 177 NHFVPEVKDIRTV 189
            H+V EV+++  +
Sbjct: 199 KHYVEEVQEVEQI 211


>gi|149248632|ref|XP_001528703.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448657|gb|EDK43045.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 248

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 17/202 (8%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVL--VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFG 57
           +  +T  TPN   LKFI P   +L        F++  +A  SPLA ++F IPG+ S+  G
Sbjct: 17  LHFKTASTPNENALKFISPESPILPVANTTFEFNSTLQAIHSPLALQLFKIPGVKSIMLG 76

Query: 58  YDFITVGK-DQYDWEHLRPPVLGMIMEHFI------SGD-PIIHNGGLGDMKLDDMGSGD 109
           +DF+TV K D +DW  L P V+  +M  F+      SG  P++    L   + + +    
Sbjct: 77  HDFLTVNKLDNHDWNSLSPEVMD-VMNKFLDKAGENSGKVPVVTQELLNKAESERLAED- 134

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASET 167
             E DS +V  IKE+++ R+RPA+  DGGDI +KG+ +  G VFL ++GAC  C ++ +T
Sbjct: 135 --EDDSELVLMIKELIETRIRPAIQDDGGDIEYKGFDEETGTVFLKLQGACKSCSASEDT 192

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK+++ +
Sbjct: 193 LKGGIESMLMHYIEEVKEVQQI 214


>gi|68472639|ref|XP_719638.1| hypothetical protein CaO19.9614 [Candida albicans SC5314]
 gi|68472898|ref|XP_719514.1| hypothetical protein CaO19.2067 [Candida albicans SC5314]
 gi|46441335|gb|EAL00633.1| hypothetical protein CaO19.2067 [Candida albicans SC5314]
 gi|46441464|gb|EAL00761.1| hypothetical protein CaO19.9614 [Candida albicans SC5314]
          Length = 237

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 113/190 (59%), Gaps = 14/190 (7%)

Query: 4   QTEDTPNPATLKFIPGQVVLV---EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +T  TPNP  LKFI  +  ++   +    F+   +A  SPLA  +F IPG+ SV  G+DF
Sbjct: 19  KTLPTPNPNALKFISPECNILPMNDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGHDF 78

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K  Y +W +LRP ++  + E   S   P+I    + + + +        E +S ++
Sbjct: 79  LTVNKQDYINWANLRPEIVEQLDEFLTSKKHPVITKELVDEAQRE-------AEEESELI 131

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI  KG+ +  G VF+ ++GAC  C ++ +TLK+G+ ++L
Sbjct: 132 SMIKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESML 191

Query: 177 NHFVPEVKDI 186
            H+V EVK++
Sbjct: 192 MHYVEEVKEV 201


>gi|126131446|ref|XP_001382248.1| hypothetical protein PICST_76567 [Scheffersomyces stipitis CBS
           6054]
 gi|126094073|gb|ABN64219.1| nitrogen fixing protein [Scheffersomyces stipitis CBS 6054]
          Length = 242

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 116/191 (60%), Gaps = 12/191 (6%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGA---IHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           QT  TPNP  LKFI  +  ++  A     F++  ++  SPLA R+F IPG+ SV  G +F
Sbjct: 18  QTLPTPNPNALKFISPECNILPMAGKTFEFTSTLQSVHSPLALRLFKIPGVRSVMLGENF 77

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFIS--GDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV K D  +W +LRP V+ + M+ F++   +P I    L D    +    +    DS +
Sbjct: 78  LTVNKQDHINWANLRPEVVEL-MDDFLTTKQEPSI-TKELVDQSQQESEVAE--AEDSEI 133

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+++ R+RPA+  DGGDI +K + +  G VFL ++GAC  C S+ +TLK+G+ ++
Sbjct: 134 VSMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSSSEDTLKHGIESM 193

Query: 176 LNHFVPEVKDI 186
           L H++ EV+++
Sbjct: 194 LMHYIEEVREV 204


>gi|312885490|ref|ZP_07745129.1| Scaffold protein Nfu/NifU [Mucilaginibacter paludis DSM 18603]
 gi|311302070|gb|EFQ79100.1| Scaffold protein Nfu/NifU [Mucilaginibacter paludis DSM 18603]
          Length = 182

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 114/185 (61%), Gaps = 13/185 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KFI  ++ L+ G++ ++  + AE SP A  +F    +  V+F  +F+T
Sbjct: 5   VYTESTPNPATMKFIVNKL-LINGSVDYATRESAEKSPFAKELFKFSFVNGVFFASNFVT 63

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K +  DW  L P     I++ F+ G   + +  L  +++ +     F  +D+ +  +I
Sbjct: 64  VTKTEGSDWNDLEP-----ILKEFVKG--AVESELL--VQIKEQEEVAFEGTDAEI--KI 112

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +++L + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+ N+L   VP
Sbjct: 113 QQILQDYVRPAVEQDGGAITYKSFNEGVVTVELRGSCSGCPSSTITLKSGIENLLKRMVP 172

Query: 182 EVKDI 186
           EV ++
Sbjct: 173 EVTEV 177


>gi|255723790|ref|XP_002546824.1| hypothetical protein CTRG_01129 [Candida tropicalis MYA-3404]
 gi|240134715|gb|EER34269.1| hypothetical protein CTRG_01129 [Candida tropicalis MYA-3404]
          Length = 237

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 13/189 (6%)

Query: 8   TPNPATLKFIPGQVVLV---EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           TPNP  LKFI  +  ++   +    F+   +A  SPLA  +F IPG+ SV  G+DF+TV 
Sbjct: 22  TPNPNALKFISEECNILPMEDKTFEFTTTMQAMHSPLALMLFKIPGVNSVMLGHDFLTVN 81

Query: 65  KDQY-DWEHLRPPVLGMIMEHFISG-DPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
           K  Y +W +LRP ++  + E   S   P+I        +L D  + +    DS ++  IK
Sbjct: 82  KQDYINWANLRPEIVEHLDEFLTSKKQPVITK------ELIDKANEESEMDDSELMSMIK 135

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           E+++ R+RPA+  DGGDI  KG+ +  G VF+ ++GAC  C ++ +TLK G+  +L H++
Sbjct: 136 ELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKSGIEGMLMHYI 195

Query: 181 PEVKDIRTV 189
            EVK++  V
Sbjct: 196 EEVKEVVQV 204


>gi|238881874|gb|EEQ45512.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 237

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 113/190 (59%), Gaps = 14/190 (7%)

Query: 4   QTEDTPNPATLKFIPGQVVLV---EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +T  TPNP  LKFI  +  ++   +    F+   +A  SPLA  +F IPG+ SV  G+DF
Sbjct: 19  KTLPTPNPNALKFISPECNILPMNDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGHDF 78

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGD-PIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K  Y +W +LRP ++  + E   S   P+I    + + + +        E +S ++
Sbjct: 79  LTVNKQDYINWANLRPGIVEQLDEFLTSKKHPVITKELVDEAQRE-------AEEESELI 131

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI  KG+ +  G VF+ ++GAC  C ++ +TLK+G+ ++L
Sbjct: 132 SMIKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESML 191

Query: 177 NHFVPEVKDI 186
            H+V EVK++
Sbjct: 192 MHYVEEVKEV 201


>gi|110636788|ref|YP_676995.1| thioredoxin-like protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110279469|gb|ABG57655.1| thioredoxin-related protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 191

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 105/185 (56%), Gaps = 7/185 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNP TLKFI  + ++ EG++ F  A  AE  PL   +F    +  V+   +FIT
Sbjct: 8   VYTEATPNPNTLKFITDKTLVEEGSVDFPMASSAESCPLVLDLFRFDFVKRVFMAANFIT 67

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K +  +WE +   +  +I  +   G P+             + +   +E +  VV +I
Sbjct: 68  VTKSEGMEWEEVSGMIKSLIKGYIEEGKPLFKETH------KPLSNTAPVEGEPEVVTKI 121

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           K VLD  +RPAV +DGG I F+ + DG+V + ++G+CSGCPS++ TLK G+ N+L   VP
Sbjct: 122 KVVLDEYIRPAVEQDGGAINFESFVDGVVKVQLQGSCSGCPSSTVTLKSGIENLLKRMVP 181

Query: 182 EVKDI 186
           EV ++
Sbjct: 182 EVTEV 186


>gi|190346499|gb|EDK38598.2| hypothetical protein PGUG_02696 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 244

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 120/196 (61%), Gaps = 11/196 (5%)

Query: 1   MFIQTEDTPNPATLKFI-PGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +  QT  TPN   LKF+ P ++V +E     F+++ +A  SPLA ++F +PG+ SV  G 
Sbjct: 20  LTFQTLSTPNENALKFVSPTKIVPMENKTFEFTSSLQAVHSPLALKLFKLPGVRSVMLGP 79

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFIS--GDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DF+TV K D  +W HLRP V   +++ F++   +P+I    +   + +   +      DS
Sbjct: 80  DFLTVNKQDHVNWAHLRPEV-SSLLDKFLTEKQEPVITKELIEATEKEAAEADA---DDS 135

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVA 173
            +V  IKE+++ R+RPA+  DGGDI +K + +  G VFL ++GAC  C ++ +TLK+G+ 
Sbjct: 136 EIVSMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIE 195

Query: 174 NILNHFVPEVKDIRTV 189
           ++L H+V EV+++  +
Sbjct: 196 SMLKHYVEEVQEVEQI 211


>gi|195559882|ref|XP_002077376.1| GD12677 [Drosophila simulans]
 gi|194202482|gb|EDX16058.1| GD12677 [Drosophila simulans]
          Length = 175

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/149 (41%), Positives = 90/149 (60%), Gaps = 8/149 (5%)

Query: 42  ASRIFSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           A  +F + G+  V+FG DFIT+ K +  +W  ++P V  +IM+ F SG P++++      
Sbjct: 1   AKLLFRVEGVKGVFFGSDFITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN-- 58

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSG 160
                   + +E D   V  IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS 
Sbjct: 59  -----ADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSS 113

Query: 161 CPSASETLKYGVANILNHFVPEVKDIRTV 189
           CPS+  TLK GV N+L  ++PEV+ +  V
Sbjct: 114 CPSSIVTLKNGVQNMLQFYIPEVESVEQV 142


>gi|311745600|ref|ZP_07719385.1| NifU domain protein [Algoriphagus sp. PR1]
 gi|126578163|gb|EAZ82383.1| NifU domain protein [Algoriphagus sp. PR1]
          Length = 193

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 109/185 (58%), Gaps = 10/185 (5%)

Query: 6   EDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           E  PNP +LKF+   +++ EG +  F +A  AE SPLA  +F+   +  V+   +F+TV 
Sbjct: 14  EANPNPNSLKFVANFMLVDEGVSFDFPDAASAENSPLALELFNFSAVDRVFVASNFVTVT 73

Query: 65  KDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           K +  +W  ++      I ++  SG  ++      D   D +    F E+DS  V++IK 
Sbjct: 74  KKEDVEWSEVQNIFRDHIKKYLESGQAVVK----ADFDKDPL----FDENDSETVKKIKG 125

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           +LD  +RPAV +DGG IVF  + DG+V + ++G+CSGCPS++ TLK G+ N+L   +PEV
Sbjct: 126 ILDEYIRPAVEQDGGAIVFHSFHDGVVKVLLQGSCSGCPSSTVTLKAGIQNLLTRMLPEV 185

Query: 184 KDIRT 188
           K++  
Sbjct: 186 KEVEA 190


>gi|255532822|ref|YP_003093194.1| nitrogen-fixing NifU domain-containing protein [Pedobacter
           heparinus DSM 2366]
 gi|255345806|gb|ACU05132.1| nitrogen-fixing NifU domain protein [Pedobacter heparinus DSM 2366]
          Length = 183

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 112/188 (59%), Gaps = 18/188 (9%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  ++ L+ G+  F+  + AE SP A  +F    +  V+F  +F+T
Sbjct: 5   VYTEQTPNPATMKFMVNKL-LINGSEDFATKESAEHSPFAKELFKFSFVNGVFFASNFVT 63

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD---FIESDSAVV 118
           V K +  +W  + P     I++ F+ G          + K+ +  S +   F  SD  + 
Sbjct: 64  VTKTEDAEWADIEP-----ILKEFVKG------AVESEYKIKEDTSAEAPAFEGSDLEI- 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +I+++L + VRPAV +DGG I +K + DG+V + +RG+CSGCPS++ TLK G+ N+L  
Sbjct: 112 -KIQQILHDYVRPAVEQDGGAISYKSFDDGVVTVELRGSCSGCPSSTITLKSGIQNLLQR 170

Query: 179 FVPEVKDI 186
            VPEVK++
Sbjct: 171 MVPEVKEV 178


>gi|332664007|ref|YP_004446795.1| nitrogen-fixing NifU domain-containing protein [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332332821|gb|AEE49922.1| nitrogen-fixing NifU domain-containing protein [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 111/191 (58%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           + + TE TPNP +LKF+  ++ L  G   F     A E SPLA+ +F  P +  VY   +
Sbjct: 19  VLLYTEQTPNPESLKFVTNRM-LYRGTADFREVDLATEWSPLATALFDFPYVRGVYVSNN 77

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNG---GLGDMKLDDMGSGDFIESDS 115
           F+TV K+  Y+W  +   +   I  +   G  ++  G    +  ++ D  G   +   ++
Sbjct: 78  FVTVSKELNYEWPDIMLKLKDFIKNYIEEGGELVKEGFAEHISKIEADRAGVA-YTGDEA 136

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +VQ+IKE++D  V+PAV  DGG+I FK Y +G VF+ M+G+CSGCPS++ TLK G+  +
Sbjct: 137 ELVQKIKELIDTYVKPAVEMDGGNIEFKHYENGKVFVLMQGSCSGCPSSTVTLKAGIEGM 196

Query: 176 LNHFVPEVKDI 186
           L   +P+V+++
Sbjct: 197 LKRMIPQVEEV 207


>gi|323347797|gb|EGA82061.1| Nfu1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 256

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 19/204 (9%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDD 104
           +  G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ 
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAXGEDVISKEFHAVQEEEGEGGYKIN- 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 141 MPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 200

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 201 SSEVTLKYGIESMLKHYVDEVKEV 224


>gi|327188587|gb|EGE55797.1| nitrogen fixation protein [Rhizobium etli CNPAF512]
          Length = 107

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 84/109 (77%), Gaps = 9/109 (8%)

Query: 82  MEHFISGDPIIHNGGLGDMKL--DDMGSGD--FIESDSAVVQRIKEVLDNRVRPAVARDG 137
           MEHF+SG P+     +GD  +  +D  +GD  F E D ++V  IKE+L+ RVRPAVA+DG
Sbjct: 1   MEHFMSGKPV-----MGDASILSEDADAGDEFFDEGDESIVLTIKELLETRVRPAVAQDG 55

Query: 138 GDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           GDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L HFVPEV+++
Sbjct: 56  GDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFVPEVQEV 104


>gi|6322811|ref|NP_012884.1| Nfu1p [Saccharomyces cerevisiae S288c]
 gi|549668|sp|P32860|NFU1_YEAST RecName: Full=NifU-like protein, mitochondrial; Flags: Precursor
 gi|486050|emb|CAA81875.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|45269699|gb|AAS56230.1| YKL040C [Saccharomyces cerevisiae]
 gi|190409786|gb|EDV13051.1| hypothetical protein SCRG_03979 [Saccharomyces cerevisiae RM11-1a]
 gi|207343478|gb|EDZ70927.1| YKL040Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256272476|gb|EEU07457.1| Nfu1p [Saccharomyces cerevisiae JAY291]
 gi|259147796|emb|CAY81046.1| Nfu1p [Saccharomyces cerevisiae EC1118]
 gi|285813219|tpg|DAA09116.1| TPA: Nfu1p [Saccharomyces cerevisiae S288c]
          Length = 256

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 19/204 (9%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDD 104
           +  G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ 
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKIN- 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 141 MPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 200

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 201 SSEVTLKYGIESMLKHYVDEVKEV 224


>gi|323354104|gb|EGA85950.1| Nfu1p [Saccharomyces cerevisiae VL3]
          Length = 249

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 19/204 (9%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDD 104
           +  G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ 
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKIN- 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 141 MPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 200

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 201 SSEVTLKYGIESMLKHYVDEVKEV 224


>gi|151941505|gb|EDN59868.1| nifu-like protein [Saccharomyces cerevisiae YJM789]
          Length = 256

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 19/204 (9%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDD 104
           +  G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ 
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLACGEDVISKEFHAVQEEEGEGGYKIN- 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 141 MPKFELSEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 200

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 201 SSEVTLKYGIESMLKHYVDEVKEV 224


>gi|4790|emb|CAA49299.1| YKL253 [Saccharomyces cerevisiae]
          Length = 230

 Score =  124 bits (310), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 19/204 (9%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDD 104
           +  G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ 
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKIN- 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 141 MPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 200

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 201 SSEVTLKYGIESMLKHYVDEVKEV 224


>gi|254566217|ref|XP_002490219.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|238030015|emb|CAY67938.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|328350616|emb|CCA37016.1| NifU-like protein 5, mitochondrial [Pichia pastoris CBS 7435]
          Length = 257

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 114/213 (53%), Gaps = 24/213 (11%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSN------AKEAEISPLASRIFSIPGIASV 54
           + IQT  TPN   LKFI   V L+   I  S       A   E SPLA ++F +PG+ S+
Sbjct: 20  LSIQTASTPNDNALKFITKGVRLLPPHIQKSTIEIDDLASATEKSPLALQLFKVPGVKSI 79

Query: 55  YFGYDFITVGK--------DQYDWEHLRPPVLGMIMEHFISGDPIIHN-------GGLGD 99
             G DFITV K        D   W+ L+P ++ +I            N         + +
Sbjct: 80  LIGDDFITVNKVDEKLSNSDHSRWQFLKPQIINVIDRSLSKSSEKKVNVLTPQFLENISN 139

Query: 100 MKLDD-MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRG 156
           +  DD + S + +++D  V   IKE+++ R+RPA+  DGGD+ F+ +    GIV++ ++G
Sbjct: 140 VHHDDYIVSQEPLDTDDDVTYEIKELINTRIRPAIQDDGGDVQFRRFDPDAGIVYIKLKG 199

Query: 157 ACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           AC  C  + +TLK+G+ ++L H+V EVK+++ +
Sbjct: 200 ACKSCSLSEDTLKHGIESMLQHYVEEVKEVKAI 232


>gi|326801010|ref|YP_004318829.1| Scaffold protein Nfu/NifU [Sphingobacterium sp. 21]
 gi|326551774|gb|ADZ80159.1| Scaffold protein Nfu/NifU [Sphingobacterium sp. 21]
          Length = 184

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 118/189 (62%), Gaps = 20/189 (10%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  ++ L  G++ F + ++A+ SP A  +F    +  V+F  +F+T
Sbjct: 6   VYTESTPNPATMKFLVNKL-LYNGSLDFPDKEKAQSSPFARELFKFNFVNGVFFASNFVT 64

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISG----DPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           + K +  +WE + P     I++ F+ G    + +IH     +++ D+  + +  E++   
Sbjct: 65  ITKSEDSEWEDILP-----ILKDFVKGAVESELLIH-----EVERDENVAFEGSETE--- 111

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            ++I++VL + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+  +L 
Sbjct: 112 -KKIQQVLHDYVRPAVEQDGGAIAYKSFDEGVVTVELRGSCSGCPSSTITLKAGIEGLLK 170

Query: 178 HFVPEVKDI 186
             VPEV+++
Sbjct: 171 RMVPEVQEV 179


>gi|310877201|gb|ADP36961.1| hypothetical protein [Asterochloris sp. DA2]
          Length = 141

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 83/123 (67%), Gaps = 11/123 (8%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD--FIESDSAVVQRIKEVL 125
           Y W  L+P V   IM+HF SGDP++       +  D+ G+ D    E DS VV  IKE+L
Sbjct: 1   YTWSVLKPDVFXAIMDHFTSGDPLL-------LDDDEYGASDTAIQEDDSDVVAMIKELL 53

Query: 126 DNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + R+RPAV  DGGDIVF+G+ +  GIV L M+GACSGCPS++ TLK G+ N+L H++PEV
Sbjct: 54  ETRIRPAVMEDGGDIVFQGFDENSGIVKLKMQGACSGCPSSAVTLKSGIENMLKHYIPEV 113

Query: 184 KDI 186
           K +
Sbjct: 114 KSM 116


>gi|260838224|ref|XP_002613749.1| hypothetical protein BRAFLDRAFT_84497 [Branchiostoma floridae]
 gi|229299138|gb|EEN69758.1| hypothetical protein BRAFLDRAFT_84497 [Branchiostoma floridae]
          Length = 263

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 105/193 (54%), Gaps = 28/193 (14%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP +LKF+PG  VL  G   F N   A  SPLA  +  +            
Sbjct: 64  MFIQTQETPNPNSLKFLPGCEVLETGTFDFPNHSAAHASPLARLVHPL------------ 111

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAVV 118
                D YDW+ L+P +   IM+ F SG PI+          D+    D +    D   V
Sbjct: 112 ---DDDTYDWQILKPDIFATIMDFFASGLPIL---------TDEPPPSDTVIHPDDDETV 159

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           Q IKE+LD R+RP V  DGGDIV+ G+    GIV L M+G+CS CPS+  TL+ GV N+L
Sbjct: 160 QMIKELLDTRIRPTVQEDGGDIVYVGFDQESGIVKLKMQGSCSSCPSSVVTLRSGVQNML 219

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 220 QFYIPEVQGVEEV 232


>gi|156839096|ref|XP_001643243.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113844|gb|EDO15385.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 256

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEG--AIHFSNAKEA--EISPLASRIF-SIPGIAS 53
           + ++T  TPN   LKFI   G++    G  ++   N  ++  E S  A R+F   PGI S
Sbjct: 27  LHVKTVSTPNENALKFISTDGELFQDRGTHSLEIKNTDDSLIEQSKFAQRLFVQCPGIES 86

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG---- 108
           +  G DF+TV KD+   W  ++P VL ++++   SG+ I+        K  + G      
Sbjct: 87  LMIGDDFVTVNKDEMIHWNQIKPNVLEILLQQLSSGESIVTQKFHEISKESESGYDIQLP 146

Query: 109 --DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSA 164
             +  E +  V   I E++  R+RPA+  DGGDI ++GY  + G V+L ++GAC  C S+
Sbjct: 147 KFELNEDEQEVSDMIDELIQTRIRPAIQDDGGDIQYRGYDPKTGKVYLKLQGACKSCSSS 206

Query: 165 SETLKYGVANILNHFVPEVKDI 186
            +TLKYG+ ++L H+V EV+++
Sbjct: 207 EDTLKYGIESMLKHYVEEVEEV 228


>gi|328350796|emb|CCA37196.1| NifU-like protein 5, mitochondrial [Pichia pastoris CBS 7435]
          Length = 210

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 100/181 (55%), Gaps = 15/181 (8%)

Query: 14  LKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV-GKDQYDWEH 72
           +K +P Q       I F N ++A  SPLA ++F I G+ ++  G+DFITV  K Q DW  
Sbjct: 1   MKILPEQTT-----IEFLNGRQAFKSPLALKLFGIDGVKTIMIGHDFITVEKKTQDDWSL 55

Query: 73  LRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA--VVQRIKEVLDNRVR 130
           L+P +  ++ E   +G P+     L +    D      +E D    VV  +KE++  R+R
Sbjct: 56  LKPEIFAVLTESLNNGTPV-----LNEQHQSDANDQALLEEDDEDEVVSMVKELIFTRIR 110

Query: 131 PAVARDGGDIVFK--GYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           PA+  DGGDI F    Y  G V+L +RGAC  C S+S TLK G+ ++L H++ EV+ +  
Sbjct: 111 PAIQDDGGDIEFVRFEYETGTVYLRLRGACRSCSSSSITLKNGIESMLKHYIEEVEAVEQ 170

Query: 189 V 189
           +
Sbjct: 171 I 171


>gi|325104464|ref|YP_004274118.1| Scaffold protein Nfu/NifU [Pedobacter saltans DSM 12145]
 gi|324973312|gb|ADY52296.1| Scaffold protein Nfu/NifU [Pedobacter saltans DSM 12145]
          Length = 183

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 110/186 (59%), Gaps = 14/186 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNP T+KFI  ++ L+ G++ +   + A  S  AS ++    +  V+F  +F+T
Sbjct: 5   VYTESTPNPNTMKFIVNKL-LINGSVDYPTRESATESRFASELYKFSFVNGVFFASNFVT 63

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ-R 120
           + K +  +W  + P     I++ F+ G          +  +      +F++ + + V+ +
Sbjct: 64  ITKSEDAEWADIEP-----ILKEFVKG------AVESEYAVQSKKEEEFVDFEGSEVEIK 112

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+++L + V+PAV +DGG I +K + DG+V + +RG+CSGCPS++ TLK G+ ++L   V
Sbjct: 113 IQQILHDYVKPAVEQDGGAIAYKSFEDGVVTVELRGSCSGCPSSTITLKSGIQSLLQRMV 172

Query: 181 PEVKDI 186
           PEVK++
Sbjct: 173 PEVKEV 178


>gi|320581036|gb|EFW95258.1| hypothetical protein HPODL_3630 [Pichia angusta DL-1]
          Length = 242

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 109/201 (54%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG----AIHFSNAKEA-EISPLASRIFSI--PGIAS 53
           +FIQT+ TPN   LKF+P +   +       +  +  K+A   S LA ++ S+    I S
Sbjct: 20  LFIQTQSTPNENALKFVPSEFKFLPSPNTPTLEITGIKDALNKSELAFKLLSVNDKSIKS 79

Query: 54  VYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-- 110
           + FGY+FITV K +++ W  L+P +  ++ EH  SG  +I+   +  +      + D   
Sbjct: 80  ILFGYNFITVIKGEKHSWSLLKPEIFSILTEHLTSGQAVINQKYINILGQQSAENEDLDG 139

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETL 168
            E +  VV  I E+L  R++PA+  DGGDI F  + +  G VFL + GAC  C S+  TL
Sbjct: 140 YEDEDEVVALINELLITRIQPAIQEDGGDIKFVRFDEDTGTVFLKLIGACKSCSSSEITL 199

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+  +L  ++ EVK ++ V
Sbjct: 200 KNGIEEMLKFYIDEVKSVQQV 220


>gi|149280243|ref|ZP_01886366.1| thioredoxin-related protein [Pedobacter sp. BAL39]
 gi|149229080|gb|EDM34476.1| thioredoxin-related protein [Pedobacter sp. BAL39]
          Length = 183

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 110/188 (58%), Gaps = 18/188 (9%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  ++ L+ G+  F+  + AE S  A  +F    +  V+F  +F+T
Sbjct: 5   VYTEQTPNPATMKFMVNKL-LINGSEDFATRESAEHSQFAKELFKFNFVNGVFFASNFVT 63

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD---FIESDSAVV 118
           + K +  DW+ +       +++ F+ G          + K+ +    +   F  SD  + 
Sbjct: 64  ITKTEDADWQDIEA-----LLKDFVKG------AVESEYKIKEETQAEAPAFEGSDLEI- 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +I+++L + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+ N+L  
Sbjct: 112 -KIQQILHDYVRPAVEQDGGAISYKSFDEGVVTVELRGSCSGCPSSTITLKSGIQNLLQR 170

Query: 179 FVPEVKDI 186
            VPEVK++
Sbjct: 171 MVPEVKEV 178


>gi|79313311|ref|NP_001030735.1| NFU4; structural molecule [Arabidopsis thaliana]
 gi|332642928|gb|AEE76449.1| NifU-like protein 4 [Arabidopsis thaliana]
          Length = 222

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 87/146 (59%), Gaps = 6/146 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N + A  SPLA  I+SI G+  V+FG DF
Sbjct: 80  MFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPLAKSIYSIDGVVRVFFGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   +M+ + SG P+  +      K   +      E DS  V 
Sbjct: 140 VTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAAKDTAIS-----EDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY 145
            IKE+L+ R+RPAV  DGGDI + G+
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYCGF 220


>gi|294659524|ref|XP_461916.2| DEHA2G08492p [Debaryomyces hansenii CBS767]
 gi|199434030|emb|CAG90379.2| DEHA2G08492p [Debaryomyces hansenii]
          Length = 240

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 114/191 (59%), Gaps = 13/191 (6%)

Query: 4   QTEDTPNPATLKFIPGQVVLV---EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +T +TPNP  LKFI  +  ++        F++  +A  SPLA ++F + G+ S+  G DF
Sbjct: 21  KTLETPNPNALKFISPECQILPIPSKTFEFTSTLQAIHSPLALKLFKLHGVRSIMLGEDF 80

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISG--DPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV K D  +W  LRP V+ + ++ F++   + ++    + + + +   S D    DS +
Sbjct: 81  LTVNKQDHINWAQLRPEVVDL-LDGFLTSKKESVVTKELIEESEREIESSED----DSEI 135

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+++ R+RPA+  DGGDI FKG+ +  G VFL ++GAC  C S+ +TLK G+  +
Sbjct: 136 VSMIKELIETRIRPAIQDDGGDIEFKGFDEETGNVFLKLQGACKTCSSSEDTLKNGIEQM 195

Query: 176 LNHFVPEVKDI 186
           + H++  V+++
Sbjct: 196 MKHYIDGVQEV 206


>gi|255713524|ref|XP_002553044.1| KLTH0D07458p [Lachancea thermotolerans]
 gi|238934424|emb|CAR22606.1| KLTH0D07458p [Lachancea thermotolerans]
          Length = 248

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 117/204 (57%), Gaps = 21/204 (10%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEG--AIHFSNAKEAEI--SPLASRIFS-IPGIAS 53
           + I++  TPN   LKFI   G+++   G  ++   N  E+ I  SPLASR+F+  PG+ +
Sbjct: 21  LHIKSVSTPNENALKFISTDGELLQERGKPSVEIKNTDESLIKHSPLASRLFTQCPGVEA 80

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII-------HNGGLG-DMKLDD 104
           +  G DFITV KD+   W  + P V+ ++ ++  SG   +          G+G D+ +  
Sbjct: 81  LMIGDDFITVNKDEMVHWNQITPSVIDLLTQYLASGREAVTPEFFSVQEQGVGYDVNVPK 140

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
               ++ E +  +   I E++  R+RPA+  DGGDI ++GY  + G V+L ++GAC  C 
Sbjct: 141 F---EYNEDEQEISDMIDELIQTRIRPAIMDDGGDIQYRGYDPQTGTVYLKLQGACKSCS 197

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLK+G+ ++L H++ EV+++
Sbjct: 198 SSEVTLKHGIESMLKHYIEEVENV 221


>gi|316971797|gb|EFV55531.1| putative HECT-domain protein [Trichinella spiralis]
          Length = 626

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 63/144 (43%), Positives = 82/144 (56%), Gaps = 11/144 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M+IQ  +TPNP +LKF+PG  VL      F N   AE SPLA  IF I G+ SV+FG DF
Sbjct: 1   MYIQVMETPNPHSLKFLPGIPVLPGRTAEFPNRPSAENSPLARAIFRIKGVKSVFFGEDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  ++P +   IM+ F S   II         +DD    D  + D+  V
Sbjct: 61  ITVTKNSEVKDWVTMKPEIFSTIMDFFTSKQDII---------IDDSTEKDAADDDNDTV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVF 142
             IK++L+ R+RP V  DGGD+VF
Sbjct: 112 AMIKDLLNTRIRPTVQDDGGDVVF 135


>gi|323332794|gb|EGA74199.1| Nfu1p [Saccharomyces cerevisiae AWRI796]
          Length = 224

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 110/191 (57%), Gaps = 19/191 (9%)

Query: 14  LKFIP--GQVVLVEGA--IHFSNAKEAEI--SPLASRIF-SIPGIASVYFGYDFITVGKD 66
           LKF+   G+++   G+  I   N  E  I  S LA +IF   PG+ S+  G DF+T+ KD
Sbjct: 3   LKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKD 62

Query: 67  QY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDDMGSGDFIESDSAV 117
           +   W  ++P ++ ++ +    G+ +I           G G  K++ M   +  E D  V
Sbjct: 63  RMVHWNSIKPEIIDLLTKQLACGEDVISKEFHAVQEEEGEGGYKIN-MPKFELTEEDEEV 121

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C S+  TLKYG+ ++
Sbjct: 122 SELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESM 181

Query: 176 LNHFVPEVKDI 186
           L H+V EVK++
Sbjct: 182 LKHYVDEVKEV 192


>gi|254582903|ref|XP_002499183.1| ZYRO0E05830p [Zygosaccharomyces rouxii]
 gi|238942757|emb|CAR30928.1| ZYRO0E05830p [Zygosaccharomyces rouxii]
          Length = 254

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 110/200 (55%), Gaps = 17/200 (8%)

Query: 3   IQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEA--EISPLASRIF-SIPGIASVY 55
           I+T  TPN   LKFI   G+++  +G+  +   N+ E+  E S LA RIF   PG+ S+ 
Sbjct: 27  IKTMTTPNENALKFISTDGEMLQDKGSSSLEIKNSDESLIEHSNLAQRIFLQCPGVESLM 86

Query: 56  FGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMG------SG 108
            G DF+TV KD    W  ++P V+ ++     SG+ ++ +     ++  D G        
Sbjct: 87  IGDDFLTVNKDSMVHWNQIKPGVIELLTSQLASGEDVVSDE-FHTIRDSDAGYEVTAPKF 145

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASE 166
           +  E D  V   I E++  R+RPA+  DGGDI ++ Y  + G V+L ++GAC  C S+ +
Sbjct: 146 ELSEEDEEVSDMIDELIQTRIRPAIQDDGGDIQYRAYDPKTGTVYLKLQGACKSCSSSED 205

Query: 167 TLKYGVANILNHFVPEVKDI 186
           TLK G+  +L H+V EV ++
Sbjct: 206 TLKAGIEGMLKHYVDEVTNV 225


>gi|327402876|ref|YP_004343714.1| nitrogen-fixing NifU domain-containing protein [Fluviicola
           taffensis DSM 16823]
 gi|327318384|gb|AEA42876.1| nitrogen-fixing NifU domain-containing protein [Fluviicola
           taffensis DSM 16823]
          Length = 201

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 108/192 (56%), Gaps = 11/192 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYDF 60
           +  E TPNP T+KF+  + +L+ G ++ F +  EA+  SPLA  +F+ P + +V+   +F
Sbjct: 8   VYVEMTPNPNTMKFVANKYLLINGESVEFHSGSEAKGYSPLAEELFNFPFVKTVFITANF 67

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-----SD 114
           +TV K D   W+ +   +   I    + G  I+    +   K     SGD  +     + 
Sbjct: 68  VTVAKNDSISWDFVTMELREFIKSWIVDGKDILIQMPVAKPK---AASGDDSKPAKEYAP 124

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S     I+ +LD  VRPAV  DGG I F G+ +G V +++RGACSGCPS++ TLK G+ N
Sbjct: 125 SEYDDAIRSLLDEYVRPAVEGDGGAIDFVGFEEGTVTVALRGACSGCPSSTATLKGGIEN 184

Query: 175 ILNHFVPEVKDI 186
           +L   +P+VK++
Sbjct: 185 LLKQHLPDVKEV 196


>gi|71654974|ref|XP_816097.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70881201|gb|EAN94246.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 280

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 109/195 (55%), Gaps = 14/195 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  L+F   ++  ++   ++ F NA  A  SPLA  +FSI G+ +VY   
Sbjct: 62  LLVETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIAD 121

Query: 59  DFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG-----DFIE 112
           ++ITV K    DW+ + P +   I E   S   I+   G      +++ SG     +  +
Sbjct: 122 EYITVRKGHLVDWDSILPMIKESIAEFAESKVNILSEEG------EELLSGHNEDTEPKD 175

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            D  V+  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+
Sbjct: 176 DDDEVILAVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGI 235

Query: 173 ANILNHFVPEVKDIR 187
             +L H++PEV +++
Sbjct: 236 ERMLMHWIPEVVEVQ 250


>gi|322824715|gb|EFZ30028.1| hypothetical protein TCSYLVIO_3695 [Trypanosoma cruzi]
          Length = 280

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 109/195 (55%), Gaps = 14/195 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  L+F   ++  ++   ++ F NA  A  SPLA  +FSI G+ +VY   
Sbjct: 62  LLVETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIAD 121

Query: 59  DFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG-----DFIE 112
           ++ITV K    DW+ + P +   I E   S   I+   G      +++ SG     +  +
Sbjct: 122 EYITVRKGHLVDWDAILPMIKESIAEFAESKVNILSEEG------EELLSGHNEDTEPKD 175

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            D  V+  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+
Sbjct: 176 DDDEVILAVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGI 235

Query: 173 ANILNHFVPEVKDIR 187
             +L H++PEV +++
Sbjct: 236 ERMLMHWIPEVVEVQ 250


>gi|45185274|ref|NP_982991.1| ABR045Wp [Ashbya gossypii ATCC 10895]
 gi|44980932|gb|AAS50815.1| ABR045Wp [Ashbya gossypii ATCC 10895]
          Length = 239

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 109/199 (54%), Gaps = 14/199 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA----IHFSNAKEAEISPLASRIFS-IPGIAS 53
           + I+T  TPN   LK++   G+++   GA    I   + +    +PLA ++F+ +PG+ +
Sbjct: 20  LHIKTLTTPNENALKYVSTDGELLQERGAPSVEIRNFDMELIRQAPLAEKLFAQVPGVEA 79

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V  G DF+TV KD +  W  + P VL ++ +   SG   +     G + +       + E
Sbjct: 80  VMIGDDFVTVSKDAELGWAQVTPRVLEVLTQQLASGQAAVQ----GQVAVGGTERFQYDE 135

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
            +  +   I+E++  RVRPA+  DGGDI ++G+    G V+L ++GAC  C S+  TLK+
Sbjct: 136 EEQEISDTIEEIIQTRVRPAIMDDGGDIQYRGWDPETGRVYLKLQGACKSCSSSEVTLKH 195

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H+V EV  +  V
Sbjct: 196 GIESMLKHYVEEVSGVEQV 214


>gi|50312363|ref|XP_456215.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645351|emb|CAG98923.1| KLLA0F25476p [Kluyveromyces lactis]
          Length = 256

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 110/202 (54%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEI--SPLASRIFS-IPGIAS 53
           + I+T  TPN   LKF+     L++     ++   N  E  +  +P  S++F   PG+ +
Sbjct: 28  IHIKTLTTPNENALKFVSTDGGLLQEKGTQSVEIKNTDEELLKHAPFPSKVFQQCPGVEA 87

Query: 54  VYFGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG---- 108
           +  G DF+T+ KD+   W  + P V+ ++++H  SG P          K  ++G      
Sbjct: 88  MMIGDDFVTINKDELIHWNQVTPTVIDLLVQHLASGKPTFLPDFFDVKKSSEVGYDVDIP 147

Query: 109 --DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSA 164
             ++ E +  + + I E++  R+RPA+  DGGDI ++G+    G V+L ++GAC  C S+
Sbjct: 148 KFEYDEDEQEISEMIDELIQTRIRPAIMDDGGDIQYRGWNPETGTVYLKLQGACKSCSSS 207

Query: 165 SETLKYGVANILNHFVPEVKDI 186
            +TLK+G+  +L H++ EV+D+
Sbjct: 208 EDTLKHGIEAMLKHYIEEVEDV 229


>gi|262277769|ref|ZP_06055562.1| NifU domain protein [alpha proteobacterium HIMB114]
 gi|262224872|gb|EEY75331.1| NifU domain protein [alpha proteobacterium HIMB114]
          Length = 179

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 103/187 (55%), Gaps = 15/187 (8%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            I   DTPNP T KF+  Q ++  G+  F  + ++ I  L + +F I  +  VY   +FI
Sbjct: 1   MINVVDTPNPDTKKFVFDQTIVKIGSKEFKKSDQSNID-LVNDLFLIKELELVYLDKNFI 59

Query: 62  TVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++ K++   W+ +   +L  + +                   D +   +  E    + +R
Sbjct: 60  SIKKNKDSSWDDIVQDILEALNKRISQN-------------FDALSFEEESEFTDDISKR 106

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+EVL++++RPAVA DGGDI  K ++DG+  + ++GAC+GCPS++ TLK+GV  ++ H+V
Sbjct: 107 IEEVLNDKIRPAVAMDGGDIRLKSFKDGVAEVMLKGACAGCPSSTVTLKHGVERMIKHYV 166

Query: 181 PEVKDIR 187
           PEV  + 
Sbjct: 167 PEVTSVE 173


>gi|330813331|ref|YP_004357570.1| hypothetical protein SAR11G3_00356 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486426|gb|AEA80831.1| hypothetical protein SAR11G3_00356 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 179

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 102/189 (53%), Gaps = 14/189 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            I   DTPNP + KF+    ++  G+    + ++ +    A ++F       +Y   +F+
Sbjct: 1   MITLTDTPNPESKKFVFDFDIVKSGSKEIKSIEDCKEIKFAEKLFDQVSPELIYIDSNFV 60

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           T+ K    DW  ++  +L ++ E  ++ D             + +      E    + QR
Sbjct: 61  TIKKKSSQDWNEIKENILKILSEE-VNAD------------FEALSFEKSFEFKDEISQR 107

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+EVL++++RPAVA DGGDI  K Y+DGIV + ++G+C+GCPS++ TLK GV  ++ H+V
Sbjct: 108 IEEVLNDKIRPAVAMDGGDIQLKSYKDGIVEVMLKGSCAGCPSSTVTLKQGVERMIKHYV 167

Query: 181 PEVKDIRTV 189
           PEV  +  V
Sbjct: 168 PEVNSVIAV 176


>gi|71662836|ref|XP_818418.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70883670|gb|EAN96567.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 280

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 108/195 (55%), Gaps = 14/195 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  L+F   ++  ++   ++ F NA  A  SPLA  +FSI G+ +VY   
Sbjct: 62  LLVETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIAD 121

Query: 59  DFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG-----DFIE 112
           ++ITV K    DW+ + P +   I E       ++   G      +D+ SG     +  +
Sbjct: 122 EYITVRKGHLVDWDAILPMIKESIEEFAERKMNVLSEEG------EDLLSGHNEDTEPKD 175

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            D  V+  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+
Sbjct: 176 DDDEVILAVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGI 235

Query: 173 ANILNHFVPEVKDIR 187
             +L H++PEV +++
Sbjct: 236 ERMLMHWIPEVVEVQ 250


>gi|197106639|ref|YP_002132016.1| thioredoxin-like domain protein [Phenylobacterium zucineum HLK1]
 gi|196480059|gb|ACG79587.1| thioredoxin-like domain protein [Phenylobacterium zucineum HLK1]
          Length = 233

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAK--EAEISPLASRIFSIPGIASVYFGY 58
           M I TE TPNP   KF+P    L +G  H  +    +   SPLA+R+F++  +  V    
Sbjct: 1   MLILTETTPNPEARKFLP-HARLTDGTAHAFDRTGFDPAASPLAARLFALGSVRHVLIAE 59

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+TV +  D   W  LR   +  I +H  SG P +   G      ++          S 
Sbjct: 60  DFVTVTRETDGEAWTTLRIKAIAEIADHLESGAPAVAAEGADPPDPEE----------SQ 109

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVAN 174
           V   I++VL   VRP VARDGGD++F  +    G++++ M+GAC GCPS+  TLK G+  
Sbjct: 110 VEGEIRQVLGLYVRPGVARDGGDVLFDRFEPDTGVLWIRMQGACGGCPSSRLTLKAGIEQ 169

Query: 175 ILNHFVPEV 183
           I+  +VPEV
Sbjct: 170 IVRRYVPEV 178


>gi|154339123|ref|XP_001562253.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134062836|emb|CAM39281.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 282

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 106/195 (54%), Gaps = 10/195 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  L+F       +  E ++   +   A  SPLA  +F + G+ +++   
Sbjct: 64  LVVETNETPNPDCLRFFSMDFSFLKPEFSMDIPSPAHAYKSPLAEALFGVAGVQAIFLAD 123

Query: 59  DFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE---SD 114
           +++TV KD Q DW  L   +  +I+E   S + ++   G  ++    MG  D  E    D
Sbjct: 124 EYVTVRKDPQADWGALVHIIKEVIVEFAESKENVLSEAGEAEL----MGYNDDTEPNEDD 179

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             VV  +KE+L  R+RP +  DGG++ F    +G VFL + GAC  CPS+  TLK G+  
Sbjct: 180 DEVVLAVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGACKSCPSSHITLKSGIER 239

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEV +++ V
Sbjct: 240 MLMHWIPEVVEVQEV 254


>gi|91216703|ref|ZP_01253668.1| nifU related protein [Psychroflexus torquis ATCC 700755]
 gi|91185172|gb|EAS71550.1| nifU related protein [Psychroflexus torquis ATCC 700755]
          Length = 302

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 104/181 (57%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + +++E A  F +  +AE+SPLA ++F  P +  ++   ++I+
Sbjct: 111 VYAESTPNPSVMKFVANKKLVLESA-EFKSIDDAELSPLAQKLFHFPFVKEIFMDDNYIS 169

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +WE +   + G I ++   G  I+ +G +   K +         +   + + I
Sbjct: 170 INKYDMAEWEEITNELRGFIKDYLEEGGKILESGKVQSKKTEAPSPEIDTSNLDDISKEI 229

Query: 122 KEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ ++L   
Sbjct: 230 VQILEEYVKPAVASDGGNIMFKSYNAESKDVQVILQGACSGCPSSTITLKNGIESMLKEM 289

Query: 180 V 180
           +
Sbjct: 290 L 290



 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          ++ + T  P+ LKF   + +  +    + N +EA  SP+AS++F +P + +VY   +FI 
Sbjct: 6  VEIKPTNKPSILKFEFNEFLTKQKGYEYHNIEEAMKSPIASQLFYLPFVKTVYISQNFIA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + K +  +W  ++  +   +++H   G  I+
Sbjct: 66 IEKFNIVEWADVQNEISEQLLKHMNDGGKIV 96


>gi|255038627|ref|YP_003089248.1| nitrogen-fixing NifU domain-containing protein [Dyadobacter
           fermentans DSM 18053]
 gi|254951383|gb|ACT96083.1| nitrogen-fixing NifU domain protein [Dyadobacter fermentans DSM
           18053]
          Length = 198

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 104/195 (53%), Gaps = 16/195 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHF------SNAKEAEISPLASRIFSIPGIASV 54
           +F+ TE +PNP ++KF+     LV   + F      +  +E + SPLA+ +F  P +  V
Sbjct: 6   VFVYTELSPNPNSMKFVLN-FELVPDGLSFDYPSLEAALEEGKASPLAADLFQFPHVKRV 64

Query: 55  YFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES 113
           +   +FIT+ K D   WE +       I  +F    P+       + K  D  +      
Sbjct: 65  FIASNFITITKGDDIAWEEVLRDTKQFIKIYFEENHPVF------EQKTIDTNTLIVDAR 118

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYG 171
           DS  VQ+IK  LD  VRPAV  DGG I F  + +G  +V + ++G+CSGCPS++ TLK G
Sbjct: 119 DSDTVQKIKAALDQYVRPAVESDGGAINFHSFDEGSGVVKVLLQGSCSGCPSSTLTLKAG 178

Query: 172 VANILNHFVPEVKDI 186
           + N+L   VP+VK++
Sbjct: 179 IENLLTRMVPDVKEV 193


>gi|149525599|ref|XP_001517848.1| PREDICTED: similar to HIRA interacting protein 5 [Ornithorhynchus
           anatinus]
          Length = 180

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 91/154 (59%), Gaps = 10/154 (6%)

Query: 39  SPLASR-IFSIPGIASVYFGYDFITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNG 95
           S  ASR +F I G+ SV+ G DFITV K+    DW  L+P +   IM+ F SG P++   
Sbjct: 25  SGFASRHLFRIEGVKSVFLGPDFITVTKENEDVDWNLLKPDIYATIMDFFASGLPVVTE- 83

Query: 96  GLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMR 155
                +     +    ES  AVV  I+ +L +  RP V  DGGD++++G+ DG+V L ++
Sbjct: 84  -----EAPSAEAARARESKDAVVL-IERLLSSMARPTVQEDGGDVIYRGFEDGVVQLKLQ 137

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           G+C+ CPS+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 138 GSCTSCPSSIVTLKSGIQNMLQFYIPEVEGVEQV 171


>gi|312129640|ref|YP_003996980.1| nitrogeN-fixing nifu domain protein [Leadbetterella byssophila DSM
           17132]
 gi|311906186|gb|ADQ16627.1| nitrogen-fixing NifU domain protein [Leadbetterella byssophila DSM
           17132]
          Length = 199

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 98/193 (50%), Gaps = 14/193 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGA-----IHFSNAKEAEISPLASRIFSIPGIASVYFG 57
           I TE +PNP ++KF+    ++ EG         S   E + SPLAS +F    +  V+  
Sbjct: 8   IYTELSPNPNSMKFVLNYEIVPEGLSFDYPTKASTFDEKKASPLASDLFLFDFVERVFIS 67

Query: 58  YDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            +FIT+ K    DW+ +   V   I  +F    P+     +    L   GS      DS 
Sbjct: 68  SNFITLTKRGDIDWDDVLGDVRQFIKTYFDENHPVFAQKTIDSHTLIVQGS------DSE 121

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
           VV +IK  LD  VRPAV  DGG I F  + +  G V + ++G+CSGCPSAS TLK G+  
Sbjct: 122 VVAKIKSTLDQYVRPAVESDGGAINFSSFEEESGTVKVLLQGSCSGCPSASLTLKAGIER 181

Query: 175 ILNHFVPEVKDIR 187
           +L   +PEVK + 
Sbjct: 182 LLTTMIPEVKSVE 194


>gi|325286802|ref|YP_004262592.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga lytica
           DSM 7489]
 gi|324322256|gb|ADY29721.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga lytica
           DSM 7489]
          Length = 300

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 101/181 (55%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E+TPNPA ++F+  +++ V     F N +EA+ S LA+ +F  P +  V+   ++I+
Sbjct: 109 VYAENTPNPAAMRFVANKLI-VPTIFEFKNKEEAKDSDLATTLFQFPYVKEVFLDENYIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D+ DW  +   +   I      G  ++    +   K +   +    E+     ++I
Sbjct: 168 VTKTDEADWNEITLELRESIQAFLTEGKEVVSANSISKQKQEAPATQLQDENLDDTSKQI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+FK Y +    V + ++GACSGCPS++ TLK G+ N+L + 
Sbjct: 228 IDILEEYVKPAVASDGGNIMFKSYDENTKKVNVILQGACSGCPSSTFTLKNGIENMLKNM 287

Query: 180 V 180
           +
Sbjct: 288 M 288



 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 8  TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-D 66
          T NPA LKF     +    +  + N  EA+ SPLA ++F +P I +VY   +FI + + D
Sbjct: 11 TTNPAILKFETNHFITKNNSYEYKNIDEAKNSPLAQQLFYLPFIKTVYISGNFIALERFD 70

Query: 67 QYDWEHLRPPVLGMIMEHFISGDPIIH 93
             W+ +R  V   ++++  SG+ ++H
Sbjct: 71 IVAWDDVRDEVAQQLVDYLNSGEVVVH 97


>gi|209883397|ref|YP_002287254.1| nifu protein [Oligotropha carboxidovorans OM5]
 gi|209871593|gb|ACI91389.1| nifu protein [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 82/133 (61%), Gaps = 5/133 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TP+P  +KF+PG+ VL EG ++  + + A  SPLA ++F+IPG+A V    D 
Sbjct: 1   MFIQTEETPDPERMKFLPGREVLPEGTLNLKSREHAGSSPLAEQLFAIPGVAGVLLNKDS 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I V +   DW+HL+P +LG+IMEHF+SG P++        +  +   G   E+D+    R
Sbjct: 61  IVVTRSDSDWQHLKPAILGVIMEHFMSGAPVLRAPPAAPERTAESDGG---ETDA--TGR 115

Query: 121 IKEVLDNRVRPAV 133
           I+E L   + P +
Sbjct: 116 IREALRKVIDPEL 128


>gi|227536308|ref|ZP_03966357.1| nifU domain protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|300772344|ref|ZP_07082214.1| NifU domain protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|227243915|gb|EEI93930.1| nifU domain protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|300760647|gb|EFK57473.1| NifU domain protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 184

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 105/175 (60%), Gaps = 12/175 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  ++ L+ G++ + N ++A+ SP A  +F    +  V+F  +F+T
Sbjct: 6   VYTESTPNPATMKFLVNKL-LINGSLDYPNKEKAQESPFAFELFKFNFVTGVFFASNFVT 64

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +W  +       I++ F+ G  +     + ++  D+  + +  E    V  +I
Sbjct: 65  ITKSDDVEWSDIEA-----ILKDFVKG-AVESELAVKEVHHDEDTNFEGTE----VEVKI 114

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++VL + VRPAV +DGG I +K + +GIV + +RG+CSGCPS++ TLK G+  +L
Sbjct: 115 QQVLHDYVRPAVEQDGGAIHYKSFDNGIVTVELRGSCSGCPSSTITLKSGIEGLL 169


>gi|50292835|ref|XP_448850.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528163|emb|CAG61820.1| unnamed protein product [Candida glabrata]
          Length = 263

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 113/206 (54%), Gaps = 28/206 (13%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEIS--PLASRIFS-IPGIASVY 55
           IQT  TPN   LKF+     L++     +I   N  +  IS   LAS+IF+  PG+ S+ 
Sbjct: 26  IQTLTTPNENALKFLNKDNELLQTRGSKSIVIKNTDQNLISHSDLASKIFAQCPGVESLM 85

Query: 56  FGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNG------------GLGDMKL 102
            G DF+TV KD Q  W  ++  V+ ++ +   SG  +I +              + +MK 
Sbjct: 86  IGDDFLTVNKDSQVPWAQIQSDVIDLLTQQLASGKNVISDEFHAIKEDNEAGYQINEMKF 145

Query: 103 DDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSG 160
           D        E D  + + I+E+++ R+RPA+  DGGDI F+G+    G V+L ++GAC+ 
Sbjct: 146 D------LTEEDEEIKELIEELIETRIRPAILEDGGDIDFRGWDPESGTVYLKLQGACTS 199

Query: 161 CPSASETLKYGVANILNHFVPEVKDI 186
           C S+  TLKYG+ ++L H+V EVK++
Sbjct: 200 CSSSEVTLKYGIESMLKHYVDEVKEV 225


>gi|261329222|emb|CBH12201.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 280

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 106/190 (55%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++  +TPNP  L+F   ++  +    ++   +A+ A  SPLA  +FSI G+ SV+   
Sbjct: 61  IVVEKNETPNPDCLRFYSMELSFLPPGRSLDLPDAQHAGKSPLAELLFSISGVQSVFLAD 120

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           ++ITVGK    DW  L P +   I+E   SG  I+   G     +D+    D  + D  V
Sbjct: 121 EYITVGKVPHVDWGSLVPQIQECIVEFAESGVGILSEEGEACF-VDNNNDTDPEDDDDEV 179

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPS+  TLK G+  +L 
Sbjct: 180 VLAVKELLSARIRPLLRADGGNVRYISMDDGTVFVLLEGACKSCPSSGVTLKNGIERMLM 239

Query: 178 HFVPEVKDIR 187
           H++PEV +++
Sbjct: 240 HWIPEVVEVQ 249


>gi|146299436|ref|YP_001194027.1| NifU domain-containing protein [Flavobacterium johnsoniae UW101]
 gi|146153854|gb|ABQ04708.1| nitrogen-fixing NifU domain protein [Flavobacterium johnsoniae
           UW101]
          Length = 299

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 95/178 (53%), Gaps = 4/178 (2%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPNPA LKF+  ++ L   A+ + N  +   SPLA  +F  P +  V+   ++I+V K
Sbjct: 111 ETTPNPAALKFVVSRM-LTRNAVEYKNIDQTASSPLAQELFKFPYVKEVFIDENYISVTK 169

Query: 66  DQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
            +  DW+ +   +   I +   +G  ++    +     +D+   +  +      Q+I  +
Sbjct: 170 YEINDWQEITLELRTFIKQFIENGGTVLDESLIQTATKNDVTKDEAFDKLDVTSQQIINI 229

Query: 125 LDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           L+  V+PAVA DGG+I F  Y   D  V + ++GACSGCPS++ TLK G+ N+L   +
Sbjct: 230 LEEYVKPAVAADGGNIAFDSYNEDDKTVKVILQGACSGCPSSTFTLKSGIENMLKSML 287



 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  ++T NP  LKF     +    +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 4  ITIKETQNPTILKFEFEDFITQNQSFEFKNIDEAQASPLAQQLFYLPFVKTVYISGNFIA 63

Query: 63 VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH 93
          + +    DW+ ++  V   I      G  II 
Sbjct: 64 IERYSIVDWDDVKDAVAEQITSFVDKGGVIIK 95


>gi|332291487|ref|YP_004430096.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332169573|gb|AEE18828.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 300

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 101/182 (55%), Gaps = 4/182 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+TLKF+  +  LV  A  F +  +   +P+A  +F +P +  V+F  ++I+
Sbjct: 109 VYAESTPNPSTLKFVANKK-LVTTAFEFKSIDDTANAPMAKALFHLPYVKEVFFDENYIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  +W+ +       I ++   G  I+    L   +  +  + +  E+   + + I
Sbjct: 168 VQKYDVAEWDEVVTETREFIRDYIQDGKEIVTAAQLKTPQQAEAIAEEKFETLDDISKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+I+FK Y  +   V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNIIEEYVKPAVASDGGNIMFKNYDPKTQNVSVILQGACSGCPSSTFTLKNGIENMLKQM 287

Query: 180 VP 181
           +P
Sbjct: 288 LP 289



 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NPA  KF   Q ++   +  F N  EA  SPLA ++F +P + +VY   +F+ 
Sbjct: 6  ISVEGTSNPAIKKFQADQFLVNHNSYEFKNIDEAANSPLAQQLFYLPFVKTVYITQNFVA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHF 85
          + K +  +W  ++  V   I ++ 
Sbjct: 66 IEKYNIVEWIDVQQEVANQIEDYL 89


>gi|221103919|ref|XP_002156303.1| PREDICTED: similar to GK25604 [Hydra magnipapillata]
          Length = 192

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 103/192 (53%), Gaps = 14/192 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIH-----FSNAKEAEISPLASRIFSIPGIASVYFG 57
           I TE +PNP ++KF+    +  EG         S  +E++ SPLA  +F  P +  ++  
Sbjct: 2   IYTELSPNPNSMKFVLNFELAPEGLTFDYPSLASTVEESKASPLAGDLFQFPFVRRIFIA 61

Query: 58  YDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            +FIT+ KD + +WE +   +   +   F   +P+     +      D  +     +DSA
Sbjct: 62  SNFITITKDDETEWEDIVYDIKKFMKIFFEQNNPVFAQKTI------DKNTLIVDANDSA 115

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
           V+ +IK  LD  VRPAV  DGG I F  + +  G V + ++G+CSGCPS++ TLK G+  
Sbjct: 116 VIAKIKSTLDQYVRPAVESDGGAINFASFDEISGQVKVYLQGSCSGCPSSTVTLKDGIER 175

Query: 175 ILNHFVPEVKDI 186
           +L   VPEVK++
Sbjct: 176 LLKTMVPEVKEV 187


>gi|72391004|ref|XP_845796.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|62176423|gb|AAX70531.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
 gi|70802332|gb|AAZ12237.1| HIRA-interacting protein 5, putative [Trypanosoma brucei brucei
           strain 927/4 GUTat10.1]
          Length = 280

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 106/190 (55%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++  +TPNP  L+F   ++  +    ++   +A+ A  SPLA  +FSI G+ SV+   
Sbjct: 61  IVVEKNETPNPDCLRFYSMELSFLPPGRSLDLPDAQHAGKSPLAELLFSISGVQSVFLAD 120

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           ++ITVGK    DW  L P +   I+E   SG  ++   G     +D+    D  + D  V
Sbjct: 121 EYITVGKVPHVDWGSLVPQIQECIVEFAESGVGVLSEEGEACF-VDNNNDTDPEDDDDEV 179

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPS+  TLK G+  +L 
Sbjct: 180 VLAVKELLSARIRPLLRADGGNVRYISMDDGTVFVLLEGACKSCPSSGVTLKNGIERMLM 239

Query: 178 HFVPEVKDIR 187
           H++PEV +++
Sbjct: 240 HWIPEVVEVQ 249


>gi|305665213|ref|YP_003861500.1| NifU-like protein [Maribacter sp. HTCC2170]
 gi|88709966|gb|EAR02198.1| nifU related protein [Maribacter sp. HTCC2170]
          Length = 300

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 102/181 (56%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + + V  A  F N  EA+ S LA ++F +P +  V+F  ++++
Sbjct: 109 VYAEVTPNPSVMKFVSNKRI-VPTAFEFKNIDEAKDSALAQQLFQLPFVKEVFFDENYVS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  +WE +  P+  M+ +    G+ ++    +     +   S    ES     ++I
Sbjct: 168 VNKFDVAEWEDITMPLREMVRDFLAEGNEVVTVSAITLKSAEAPKSQLNNESLDDTSKQI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+F+ Y      V + ++GACSGCPS++ TLK G+  +L + 
Sbjct: 228 VDILEEYVKPAVASDGGNILFQSYEKDTKTVNVILQGACSGCPSSTFTLKNGIETMLKNM 287

Query: 180 V 180
           +
Sbjct: 288 M 288



 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  + T NPA LKF     +       F N  EA+ SPLA ++F +P I +VYF  +FI 
Sbjct: 6  ITVKQTNNPAVLKFETNHFITKNNNYEFKNIDEAKNSPLAQQLFYLPFIKTVYFSGNFIG 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + + D  +W  ++  V   ++E+  SG+PI+
Sbjct: 66 LERFDIVEWADVKDEVAQQLVEYLNSGEPIV 96


>gi|322492565|emb|CBZ27842.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 281

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 106/192 (55%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  ++F    +  +  E ++   +  +A  SPLA  +F + G+ +V+   
Sbjct: 63  IVVETNETPNPDCIRFFSMDISFLKPEFSVDIPSPAQAYKSPLAEALFGVAGVQAVFLAD 122

Query: 59  DFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +++TV K  Q DW  L P +  +I+E   S + ++   G  ++ L      +  E D  V
Sbjct: 123 EYVTVRKHPQEDWAALMPIIKEVIVEFAESKENVLSAAGEEEL-LGYNNDTEPDEDDDEV 181

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  +KE+L  R+RP +  DGG++ F    +G VFL + GAC  CPS+  TLK G+  +L 
Sbjct: 182 VLAVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGACKSCPSSHITLKSGIERMLM 241

Query: 178 HFVPEVKDIRTV 189
           H++PEV + + V
Sbjct: 242 HWIPEVVEAQEV 253


>gi|86130774|ref|ZP_01049373.1| NifU-like protein [Dokdonia donghaensis MED134]
 gi|85818185|gb|EAQ39345.1| NifU-like protein [Dokdonia donghaensis MED134]
          Length = 300

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 100/182 (54%), Gaps = 4/182 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+T+KF+  +  LV  +  F +  +   +P+A  +F  P +  V+F  ++I+
Sbjct: 109 VYAESTPNPSTIKFVANKK-LVTTSFEFKSIDDTANAPMAKALFHFPFVKEVFFDENYIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  +W+ +       I ++   G  I+    L   +  D  + +  E+   V + I
Sbjct: 168 VQKYDMAEWDEVVTETREFIRDYIQDGKEIVTAEQLKTPQQVDAIAEEKFETLDDVSKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+IVFK Y +    +S  ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNIIEEYVKPAVASDGGNIVFKHYDEKTQNVSVILQGACSGCPSSTFTLKNGIENMLKQM 287

Query: 180 VP 181
           +P
Sbjct: 288 LP 289



 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NPA  KF   Q ++   +  F N  EA  SPLA ++F +P + +VY   +F+ 
Sbjct: 6  ISVEGTSNPAIKKFQADQFLVNHNSYEFKNIDEAANSPLAQQLFYLPFVKTVYIAQNFVA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHF 85
          + K +  +W  ++  V   + ++ 
Sbjct: 66 IEKYNIVEWIDVQQEVANQVEDYL 89


>gi|313677059|ref|YP_004055055.1| scaffold protein nfu/nifu [Marivirga tractuosa DSM 4126]
 gi|312943757|gb|ADR22947.1| Scaffold protein Nfu/NifU [Marivirga tractuosa DSM 4126]
          Length = 198

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 106/190 (55%), Gaps = 11/190 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           I  E  PNP +LKF   Q+++ EG +  F + ++   +PLA  +F    +  V++  +FI
Sbjct: 11  IYMEANPNPNSLKFATNQMLVPEGDSFDFPSIEDTAQAPLAEILFKKEYVDRVFYMSNFI 70

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K  +Y+W  ++  V   I E   SG  +I      +++  D+        ++ + ++
Sbjct: 71  TVTKKPEYEWVEIQNDVKDTIKEFLESGKRVI------ELQAKDLFEETNTSENAELEEQ 124

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IK +LD  ++PAV +DGG I F  Y      V L ++GACSGCPS++ TLK G+ N+L  
Sbjct: 125 IKNILDEYIKPAVEQDGGAISFHSYEKDTQRVNLLLQGACSGCPSSTITLKAGIENLLKR 184

Query: 179 FVP-EVKDIR 187
            +P +VK+++
Sbjct: 185 MLPNDVKEVQ 194


>gi|157870953|ref|XP_001684026.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68127094|emb|CAJ04535.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 240

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 107/192 (55%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  ++F    +  +  E ++  ++  +A  SPLA  +F + G+ +V+   
Sbjct: 22  IVVETNETPNPDCMRFFSMDLSFLKPEFSMDITSPAQAYKSPLAEALFGVAGVQAVFLAD 81

Query: 59  DFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +++TV K  Q DW  L P +  +I+E   S + ++   G  ++ L      +  E D  V
Sbjct: 82  EYVTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEEL-LGYNNDTEPDEDDDEV 140

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  +L 
Sbjct: 141 VLAVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHITLKSGIERMLM 200

Query: 178 HFVPEVKDIRTV 189
           H++PEV + + V
Sbjct: 201 HWIPEVVEAQEV 212


>gi|146089377|ref|XP_001470367.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134070400|emb|CAM68738.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 284

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 107/195 (54%), Gaps = 10/195 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  ++F    V  +  E ++   +  +A  SPLA  +F + G+ +V+   
Sbjct: 66  IVVETNETPNPDCMRFFSMDVSFLKPEFSMDIPSPAQAYKSPLAEALFGVAGVQAVFLAD 125

Query: 59  DFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE---SD 114
           +++TV K  Q DW  L P +  +I+E   S + ++   G  ++    +G  +  E    D
Sbjct: 126 EYVTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEEL----LGYNNDTEPDDDD 181

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             VV  +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  
Sbjct: 182 DEVVLAVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHVTLKSGIER 241

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEV + + V
Sbjct: 242 MLMHWIPEVVEAQEV 256


>gi|322499834|emb|CBZ34907.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 284

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 107/195 (54%), Gaps = 10/195 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           + ++T +TPNP  ++F    V  +  E ++   +  +A  SPLA  +F + G+ +V+   
Sbjct: 66  IVVETNETPNPDCMRFFSMDVSFLKPEFSMDIPSPAQAYKSPLAEALFGVAGVQAVFLAD 125

Query: 59  DFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE---SD 114
           +++TV K  Q DW  L P +  +I+E   S + ++   G  ++    +G  +  E    D
Sbjct: 126 EYVTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEEL----LGYNNDTEPDDDD 181

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             VV  +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  
Sbjct: 182 DEVVLAVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHVTLKSGIER 241

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEV + + V
Sbjct: 242 MLMHWIPEVVEAQEV 256


>gi|320584117|gb|EFW98328.1| hypothetical protein HPODL_0008 [Pichia angusta DL-1]
          Length = 250

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%), Gaps = 18/204 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV----EGAIHFSNAKEA-EISPLASRIFSIPGIASVY 55
           + ++T  TPN   LKFI      +      A+  ++  EA + SPLAS +F + G+ S+ 
Sbjct: 24  LSLKTVGTPNENALKFISTDFNFLPESLTSAVEVNDLPEASQRSPLASELFKLNGVKSLL 83

Query: 56  FGYDFITVGK--------DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGS 107
            G++FITV K            W+ L   V+ +I     S  P+++   L ++       
Sbjct: 84  IGHNFITVNKVDPELSNNPDLHWDSLSTKVMNVITNAVDSNIPVLNPEYLDEIV---RKQ 140

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSAS 165
            +  E D  V   IKE+++ R+RPA+  DGGDI F+ +    G V+L ++GAC  C  + 
Sbjct: 141 DEAQEDDDDVTYEIKELINTRIRPALQDDGGDIHFRSFDAESGTVYLKLQGACKSCSLSE 200

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
           +TLK G+ ++L H++PEV++++ V
Sbjct: 201 DTLKNGIESMLKHYIPEVEEVKAV 224


>gi|332877772|ref|ZP_08445513.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332684352|gb|EGJ57208.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 298

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 98/178 (55%), Gaps = 5/178 (2%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFITV 63
           TE TPNPA +KF+  +  LV   I + +A EA  +PLA  +F + P I  V+F  D+I+V
Sbjct: 110 TETTPNPAVMKFVANKR-LVPTIIEYKSATEAAEAPLAQALFQAFPFITEVFFDNDYISV 168

Query: 64  GK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            K D  DWE   P +   I ++  +   +I+   +   +           +   + Q+I 
Sbjct: 169 TKTDTADWEEESPRLRAFIKDYLAAEKTVINISEVKKWQTAVQAHLLSKVTTDPISQQIV 228

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
            +++  V+PAVA DGG+I F  Y+     V + ++GACSGCPS+++TLK G+  IL +
Sbjct: 229 AIIEEHVKPAVASDGGNIQFISYQPDTHHVEVLLQGACSGCPSSTQTLKKGIEAILKN 286



 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          +  + T NP  +K +     LV+G+  + N  EA+ +PLA  +F +P I +VY   +FI 
Sbjct: 6  LTVQPTANPDIIK-LEANRPLVKGSYEYKNVDEAKNAPLAKELFYLPFIKTVYISSNFIA 64

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN 94
          + +    +W+ ++  V   I  +  SG P+++N
Sbjct: 65 LKRFPIIEWKDVQEEVAQQIAVYLQSGRPLVNN 97


>gi|254495078|ref|ZP_05108002.1| NifU-like protein [Polaribacter sp. MED152]
 gi|85819428|gb|EAQ40585.1| NifU-like protein [Polaribacter sp. MED152]
          Length = 301

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 105/189 (55%), Gaps = 18/189 (9%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYDFI 61
           +  E TPNPA +KF   +  L +  + + N +EA + SPLA  IF+ P +  V+   ++I
Sbjct: 110 VYAEVTPNPAVMKFGTNKA-LTQTDVEYKNIEEASKSSPLAQAIFNFPFVKEVFISDNYI 168

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ- 119
           +V K D  +W  +   V   I E+ + G  II +       L  + +    E  + VV+ 
Sbjct: 169 SVTKYDMVEWNEVFAEVRSFIREYLVDGKTIIKD-------LPTVETSKTPEVVAPVVEL 221

Query: 120 -----RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
                +I ++LD  ++PAVA DGG+I F+ Y  ++ +V + ++GACSGCPS++ TLK G+
Sbjct: 222 EGIPAQISDILDEYIKPAVAGDGGNIAFRSYDEQNKVVSVILQGACSGCPSSTATLKNGI 281

Query: 173 ANILNHFVP 181
            ++L   +P
Sbjct: 282 ESLLKEMLP 290



 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  ++T N   LKF   +V++  G+  FSN  EA+ SPLA ++F +P +  V+   +FI 
Sbjct: 6  ITIQETTNETILKFNSTKVLINGGSYEFSNIDEAKNSPLAQQLFYLPFVKKVFITANFIA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN 94
          + + D  +W  ++  V   I E +IS   I+ N
Sbjct: 66 IQRFDIVEWADVQDEVAEQI-EAYISDGNIVVN 97


>gi|225012214|ref|ZP_03702651.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
 gi|225003769|gb|EEG41742.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
          Length = 295

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 102/182 (56%), Gaps = 8/182 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  +  LV  ++ F N  EA+ +PLA ++F +P +  V+   ++++
Sbjct: 108 VYAESTPNPAVMKFVANKP-LVSHSVEFKNIDEAKNAPLAQKLFHLPFVKEVFIDANYVS 166

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  +WE +   V   I      G+ I+    +  +++D       +   +A  ++I
Sbjct: 167 ITKFEVTEWEEVVMEVREFIRAFIEEGNVILTEAPIA-IEIDQKNQSSNL---TATEEQI 222

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +LD  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK G+  +L   
Sbjct: 223 VSILDEYIKPAVASDGGNIMFDSYDEVEKEVHVVLQGACSGCPSSTFTLKNGIETMLKEM 282

Query: 180 VP 181
           +P
Sbjct: 283 MP 284


>gi|299132121|ref|ZP_07025316.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
 gi|298592258|gb|EFI52458.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
          Length = 213

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/131 (38%), Positives = 75/131 (57%), Gaps = 4/131 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+T +   L+F+PG+ VL EG ++    ++A  SPLA ++F+IPG+A V    D 
Sbjct: 1   MFIQTEETQDSERLRFLPGREVLPEGTLNLKTKEQAASSPLAEQLFTIPGVAGVLLNKDS 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I V +   DW+HL+P +LG IMEHF+SG P++             G     E D+    +
Sbjct: 61  IVVTRSGSDWQHLKPAILGAIMEHFMSGAPVVRTPPGASAHASASGE----EGDATATGQ 116

Query: 121 IKEVLDNRVRP 131
           I+E L   + P
Sbjct: 117 IREALRRVIDP 127


>gi|88802135|ref|ZP_01117663.1| NifU protein [Polaribacter irgensii 23-P]
 gi|88782793|gb|EAR13970.1| NifU protein [Polaribacter irgensii 23-P]
          Length = 301

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 102/188 (54%), Gaps = 13/188 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYDFI 61
           +  E TPNPA +KF   +  L +  + F N  EA  S PLA  IF+ P +  V+   ++I
Sbjct: 109 VYAEVTPNPAVMKFGTNKA-LTQTDVEFKNIDEASASSPLAQAIFNFPFVQQVFISDNYI 167

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ- 119
           +V K D  +W  +   V   I E+   G  II        K + + + +  +    V++ 
Sbjct: 168 SVTKYDMVEWNEVYGEVRTFIREYLADGKTIIKELP----KEEVVETANKAQEPEVVLEG 223

Query: 120 ---RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVAN 174
              +I ++LD  ++PAVA DGG+I F+ Y  +  +V + ++GACSGCPS++ TLK G+ N
Sbjct: 224 ISAQIVDILDEYIKPAVASDGGNIAFRSYDEQTKVVRVILQGACSGCPSSTATLKNGIEN 283

Query: 175 ILNHFVPE 182
           +L   +P+
Sbjct: 284 LLKEMLPD 291



 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 2/93 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  ++T N   +K+    +++  G+  F+N  EA+ SPLA  +F +P +  V+   +FI 
Sbjct: 6  ITIQETTNNTIIKYNSNTILINGGSYEFNNIDEAKNSPLAQELFYLPFVKKVFITANFIA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHN 94
          + + D  +W  ++  V   I E F++   I+ N
Sbjct: 66 IQRFDILEWIDVQEEVKEQI-EAFLNDGNIVVN 97


>gi|124006329|ref|ZP_01691163.1| NifU domain protein [Microscilla marina ATCC 23134]
 gi|123987986|gb|EAY27657.1| NifU domain protein [Microscilla marina ATCC 23134]
          Length = 197

 Score =  103 bits (258), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 104/190 (54%), Gaps = 11/190 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFS-IPGIASVYFGYDF 60
           I TE  PNP +LK++   +++ +G    F +A+ A+ SPLA+ +FS    +  V+   +F
Sbjct: 11  IYTESNPNPNSLKYVINYMLVPDGTTFDFPDAETAQQSPLATELFSKFSYVDRVFMMSNF 70

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV  K++ DW  +   V   +  +     P++         + D    +  + +  + +
Sbjct: 71  VTVTKKEEADWHDVAGEVKEFLQGYLEEQKPLLTQD------IQDEYDKELNKDEPEIDR 124

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +L+  VRPAV  DGG I F  Y +G V + ++G+CSGCPS+  TLK G+ N+L   
Sbjct: 125 KIKGILEEYVRPAVESDGGAINFHSYENGTVKVLLQGSCSGCPSSMVTLKSGIENLLKRM 184

Query: 180 VPEVKDIRTV 189
           +PE  D++ V
Sbjct: 185 LPE--DVKEV 192


>gi|90076830|dbj|BAE88095.1| unnamed protein product [Macaca fascicularis]
          Length = 199

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 79/133 (59%), Gaps = 12/133 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQNTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-IESDSAV 117
           ITV K+    DW  L+P +   IM+ F SG P++          ++  SG+   E D  V
Sbjct: 119 ITVTKENEDLDWNLLKPDIYATIMDFFASGLPLV---------TEETPSGEAGSEEDDEV 169

Query: 118 VQRIKEVLDNRVR 130
           V  IKE+LD R+R
Sbjct: 170 VAMIKELLDTRIR 182


>gi|284037367|ref|YP_003387297.1| nitrogen-fixing NifU domain protein [Spirosoma linguale DSM 74]
 gi|283816660|gb|ADB38498.1| nitrogen-fixing NifU domain protein [Spirosoma linguale DSM 74]
          Length = 200

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 101/193 (52%), Gaps = 21/193 (10%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAK------EAEISPLASRIFSIPGIASVYF 56
           I TE +PNP ++KF+     LV   + F  A       + + SPLA  +F    +  V+ 
Sbjct: 11  IFTEGSPNPNSMKFV-VNFELVPTGLSFDYATPGDALLDGKASPLAVALFGFEFVRRVFI 69

Query: 57  GYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGL--GDMKLDDMGSGDFIES 113
             +F+TV KD + DW+ +   V   + ++F    P+     +     KLD          
Sbjct: 70  SANFVTVTKDDETDWDEVLLEVKLFLKDYFGEQKPVFSQRTVDTNTTKLD---------M 120

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYG 171
           DS  VQ+IK VL+  ++PAV  DGG I F  + +  G V + ++G+CSGCPS++ TLK G
Sbjct: 121 DSETVQKIKAVLEQYIKPAVESDGGAISFYSFDEPSGTVKVLLQGSCSGCPSSTLTLKAG 180

Query: 172 VANILNHFVPEVK 184
           + N+L   VPEVK
Sbjct: 181 IENLLTRLVPEVK 193


>gi|163786509|ref|ZP_02180957.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1]
 gi|159878369|gb|EDP72425.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1]
          Length = 300

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 98/181 (54%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ LKF+  +V LV     F++ +EA+ SPLA+ +F  P I +++   +FI+
Sbjct: 109 VYAESTPNPSVLKFVCNKV-LVPSLYEFTSIEEAKPSPLATALFQFPFIKNIFIEKNFIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +WE +   +   +  +   G  I+++     +   +       E+     + I
Sbjct: 168 ITKFDIIEWEDITLQLREFLKSYIEDGKTILNDDAPQKLNKTEEAIEQKFEALDDTSKNI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  ++PAV  DGG+I FK Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNILEEYIKPAVESDGGNIEFKSYDANTKKVEVLLQGACSGCPSSTFTLKNGIENMLKEM 287

Query: 180 V 180
           +
Sbjct: 288 L 288



 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 8  TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-D 66
          T N   LKF   + +    +  F+N  +A+ SPLA ++F +P +  VY   +FI + + +
Sbjct: 11 TSNETILKFEADRFLTNHNSFEFNNIDDAKHSPLAQQLFYLPFVKKVYIATNFIAIERYN 70

Query: 67 QYDWEHLRPPVLGMIMEHFISGDPII 92
            +W+ ++  V   I E ++S D ++
Sbjct: 71 IVEWKDVQNEVAAQI-EDYLSNDGVV 95


>gi|260060626|ref|YP_003193706.1| nifU related protein [Robiginitalea biformata HTCC2501]
 gi|88784756|gb|EAR15925.1| nifU related protein [Robiginitalea biformata HTCC2501]
          Length = 300

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 102/182 (56%), Gaps = 6/182 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +K++  +  LV     F +  +A  SPLA ++F  P +  V+  +++I+
Sbjct: 109 VYAEVTPNPAVMKYVANKQ-LVPDVFEFKDIDQARHSPLAQKLFGFPFVKEVFMDHNYIS 167

Query: 63  VGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM-KLDDMGSGDFIESDSAVVQR 120
           V K +  +WE +   +   I E+  +G  ++  G   +  ++  +  G+  + D  + Q 
Sbjct: 168 VTKYEVAEWEDVSMELREFIREYLAAGGEVLEPGASAEKSQIAGVPEGNLEQMDP-ISQE 226

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I  +L+  V+PAVA DGG+IVF+ Y      V + ++GACSGCPS++ TLK G+  +L +
Sbjct: 227 IAGILEEYVKPAVASDGGNIVFQSYEAESKTVHVILQGACSGCPSSTFTLKNGIQTMLQN 286

Query: 179 FV 180
            +
Sbjct: 287 MM 288



 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  ++T NPA LKF   Q ++ +G+  + N  EA+ SPLA ++F +P I +VY   +F+ 
Sbjct: 6  ITLKETNNPAILKFEANQPLVTKGSYEYKNIDEAKDSPLAQQLFYLPFIKTVYISGNFVA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + + D   W+ ++  V   ++E+  +G+P++
Sbjct: 66 MERFDIVTWDDVKQEVAQQLVEYLNAGEPVV 96


>gi|86140721|ref|ZP_01059280.1| NifU-like domain protein [Leeuwenhoekiella blandensis MED217]
 gi|85832663|gb|EAQ51112.1| NifU-like domain protein [Leeuwenhoekiella blandensis MED217]
          Length = 301

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 6/182 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA LKF+  + ++ E  + F N  EA+ +PLA  +F  P +  V+   ++++
Sbjct: 110 VYAESTPNPAVLKFVTNKKIVTE-TLEFKNIDEAKNAPLALALFHFPFVKEVFMDSNYVS 168

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPII-HNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           V K D  +W+ +   V   I  +   G  II  N       +++    +F E+     + 
Sbjct: 169 VQKYDVAEWDDVFQEVREFIKTYIEEGKEIISENFKKTPQAVEEQKEVEF-EAMDDTSKE 227

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I  +++  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ N+L  
Sbjct: 228 IANIIEEYVKPAVASDGGNILFKHYDPESKNVKVILQGACSGCPSSTFTLKNGIENMLKE 287

Query: 179 FV 180
            +
Sbjct: 288 ML 289



 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NPA  KF     ++   +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 6  ITIEPTSNPAIKKFQANSFLVDHNSYEFKNIDEAKNSPLAQQLFYLPFVKTVYISQNFIA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + K +  +W  ++  +   I E+F++ + ++
Sbjct: 66 IEKFNIVEWIDIQDELSAQI-ENFLNDNGVV 95


>gi|323336723|gb|EGA77987.1| Nfu1p [Saccharomyces cerevisiae Vin13]
          Length = 174

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 85/142 (59%), Gaps = 12/142 (8%)

Query: 56  FGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDDMG 106
            G DF+T+ KD+   W  ++P ++ ++ +    G+ +I           G G  K++ M 
Sbjct: 2   IGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAXGEDVISKEFHAVQEEEGEGGYKIN-MP 60

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSA 164
             +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C S+
Sbjct: 61  KFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSS 120

Query: 165 SETLKYGVANILNHFVPEVKDI 186
             TLKYG+ ++L H+V EVK++
Sbjct: 121 EVTLKYGIESMLKHYVDEVKEV 142


>gi|57335931|emb|CAH25367.1| nifU-like protein [Guillardia theta]
          Length = 183

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 77/128 (60%), Gaps = 8/128 (6%)

Query: 64  GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           GKDQ+ W  ++P V   I++ + SG  II      DM  D   +    E DS +V  IKE
Sbjct: 31  GKDQHSWAEMKPEVFDAILDFYASGQSIIT--AEEDMPQDTKVN----EDDSEIVAMIKE 84

Query: 124 VLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +LD R+RPAV  DGGDI F G+ +  G V + ++GACS C S+  TLK GV N+L H+VP
Sbjct: 85  LLDTRIRPAVQDDGGDISFIGFDEETGRVTVRLQGACSTCSSSKVTLKSGVENMLMHYVP 144

Query: 182 EVKDIRTV 189
           EV ++  V
Sbjct: 145 EVTEVVAV 152


>gi|298206804|ref|YP_003714983.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559]
 gi|83849436|gb|EAP87304.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559]
          Length = 305

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 102/188 (54%), Gaps = 21/188 (11%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP+ LKF+  + ++V+    F +  +   +PLA  +F+ P +  ++   ++++
Sbjct: 109 IYAESTPNPSVLKFVANKKLVVQSE-EFKSIDDTANAPLAQALFNFPFVKEIFIDENYVS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-----------NGGLGDMKLDDMGSGDF 110
           + K D  +W  +   +   I +H +SG P++            NGG  +    D+   D 
Sbjct: 168 IQKYDMAEWGDITTELRDFISQHIMSGKPVVTEHRANKLAPQTNGGTTEKPQLDLSHLD- 226

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETL 168
            ++  A+V    E+LD  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TL
Sbjct: 227 -DTSKAIV----EILDEYIKPAVASDGGNIMFDSYDEETKSVKVILQGACSGCPSSTMTL 281

Query: 169 KYGVANIL 176
           K G+  +L
Sbjct: 282 KNGIETML 289



 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  + T NP+ LKF   + +    +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 5  IDIQSTSNPSILKFETNKFLSRHDSFEFHNIDEAKPSPLAQKLFYLPFVKTVYIAQNFIA 64

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + K D  +W  ++  V   I+E+  SG+ +I
Sbjct: 65 IQKYDIAEWSDVQDEVKSQILEYLNSGEDVI 95


>gi|163753913|ref|ZP_02161036.1| thioredoxin-related protein [Kordia algicida OT-1]
 gi|161326127|gb|EDP97453.1| thioredoxin-related protein [Kordia algicida OT-1]
          Length = 301

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  + + V+    F N  E + +PLA  +F  P +  ++   ++I+
Sbjct: 110 IYAESTPNPTVMKFVANKKI-VDRIFEFKNIDETKYAPLAQSLFHFPFVKEIFLDKNYIS 168

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +W  +   +   I  +   G  +I      + K     S +  E    + + I
Sbjct: 169 ITKYDMVEWNDITMEIREFIRNYIQEGREVISKDIPVEQKEKIQISDESFEELDDISKEI 228

Query: 122 KEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  ++PAVA DGG+I+F  Y     IV + ++GACSGCPS++ TLK G+ N L + 
Sbjct: 229 VNILEEYIKPAVASDGGNIMFDSYDPNSKIVKVVLQGACSGCPSSTMTLKSGIENTLKNL 288

Query: 180 V 180
           +
Sbjct: 289 L 289



 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NPA +KF     +    +  F N  EA+ SPLA ++F +P + +++   +FI 
Sbjct: 6   ISIEKTSNPAIIKFEASTFLSRHNSYEFKNIDEAKDSPLAQQLFYLPFVKTIFISGNFIA 65

Query: 63  VGKDQYD---WEHLRPPVLGMIMEHFISGDPIIHNGG 96
           +  ++Y+   WE ++  V   I  +   G  +I    
Sbjct: 66  I--ERYNIVTWEDVQDEVAEQIQNYINEGKEVISESA 100


>gi|294936237|ref|XP_002781672.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239892594|gb|EER13467.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 262

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 105/197 (53%), Gaps = 25/197 (12%)

Query: 3   IQTEDTPNPATLKFI--PGQVVLVEGAIHFSNAK-EAEISPLASRIFSIPGIASVYFGYD 59
           +  E TPNP+ + F    G+ +L +GA   S  K +   SPLA+ +F I G+  V     
Sbjct: 31  VSAEATPNPSAMIFTLEGGKPILGKGAKSMSFEKTQCGGSPLAASLFRIHGVDKVLLAAR 90

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHF-------ISGDPIIHNGGLGDMKLDDMGSGDFI 111
             TV K  + +WE L+P V  +I + F       ++ D I +     D   DD       
Sbjct: 91  HATVTKSPETEWEMLKPNVELVISQFFDIPNVKPVAPDTIEYTQEGQDQHNDD------- 143

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLK 169
                VV+ I E+L+ R++P V RDGGD+ F  +    G++ + + G+C+GCP +S TLK
Sbjct: 144 -----VVKSIHEILEQRIKPFVERDGGDVEFIAFDSDTGVLQIRLVGSCAGCPKSSVTLK 198

Query: 170 YGVANILNHFVPEVKDI 186
           +G+  ++ H++PEVK++
Sbjct: 199 FGIQRMVCHYIPEVKNV 215


>gi|327289878|ref|XP_003229651.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like, partial [Anolis carolinensis]
          Length = 129

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (59%), Gaps = 9/131 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F++      SPLA ++F I G+ SV+FG DF
Sbjct: 6   MFIQTQDTPNPNSLKFIPGKPVLESRTMEFTSPASTYCSPLARQLFRIEGVKSVFFGADF 65

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K+    DW  ++P +   IM+ + SG P++ +      + +   S    E D  VV
Sbjct: 66  VTVTKESEDVDWNLIKPDIYATIMDFYASGLPVVTDEA---PRPETAPS----EEDDEVV 118

Query: 119 QRIKEVLDNRV 129
             IKE+LD R+
Sbjct: 119 SMIKELLDTRI 129


>gi|225011341|ref|ZP_03701795.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
 gi|225004524|gb|EEG42492.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
          Length = 301

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP+ +K++  +++ V     F N  EA+ +PLA  +F +P +  V+   ++I+
Sbjct: 110 IYAESTPNPSVMKYVANKLI-VPALFEFKNIDEAKDAPLAKELFLMPFVKEVFMDQNYIS 168

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA--VVQ 119
           V K D  +WE +   +   I    +SG   +  G     K  +      + +D+     +
Sbjct: 169 VTKYDVAEWEEINNELREKIRLFLMSGQESV--GANTVQKEKEKAPTTLLHTDNLDDTSK 226

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
           +I ++L+  V+PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK G+ N+L 
Sbjct: 227 QIVDILEEYVKPAVASDGGNIMFDSYDEVSKTVNVILQGACSGCPSSTFTLKNGIENMLK 286

Query: 178 HFV 180
           + +
Sbjct: 287 NMM 289



 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 8  TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67
          T NP  +KF     +  +    F N  +A+ SPLA ++F +P + +VY   +FI  G ++
Sbjct: 12 TNNPNIMKFETNHFISPDKNYEFQNIDQAKESPLAQQLFHLPFVKTVYISSNFI--GIEK 69

Query: 68 YD---WEHLRPPVLGMIMEHFISGDPII 92
          YD   WE ++  +   ++++  +G  ++
Sbjct: 70 YDIVGWEDIKDSLGQQLVDYLNTGAAVV 97


>gi|319953626|ref|YP_004164893.1| nitrogen-fixing nifu domain-containing protein [Cellulophaga
           algicola DSM 14237]
 gi|319422286|gb|ADV49395.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga
           algicola DSM 14237]
          Length = 300

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 100/193 (51%), Gaps = 28/193 (14%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  + + V  A  F N  EA+ S LA ++F  P +  V+F  ++ +
Sbjct: 109 VYAESTPNPAVMKFVSNKTI-VPTAFEFKNIDEAKDSELAKKLFHFPFVKEVFFDENYAS 167

Query: 63  VGKDQY-DWEH----LRPPVLGMIME--HFISGDPIIHNGG------LGDMKLDDMGSGD 109
           V K +  DW      +R  +   I +    +S + ++          L D  LDD     
Sbjct: 168 VTKYEVADWNEVTFDIRELIRNFIADGLEVVSAESVVKKKAEAPKTQLQDANLDDTS--- 224

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASET 167
                    ++I ++L+  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ T
Sbjct: 225 ---------KKIIDILEEYVKPAVASDGGNIMFKSYDKETKTVNVILQGACSGCPSSTYT 275

Query: 168 LKYGVANILNHFV 180
           LK G+ ++L + +
Sbjct: 276 LKNGIESMLKNMM 288



 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 7  DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK- 65
          +T NPA LKF     +       + +  EA+ SPLA ++F +P + +VY   +FI + + 
Sbjct: 10 ETNNPAILKFDTNHFITKSNNYEYKDIDEAKNSPLAQQLFYLPFVKTVYISANFIALERF 69

Query: 66 DQYDWEHLRPPVLGMIMEHFISGDPII 92
             +W+ ++  V   ++E+  SG+P+I
Sbjct: 70 SIVEWDDVKDEVAQQLVEYLNSGEPVI 96


>gi|126663121|ref|ZP_01734119.1| thioredoxin-related protein [Flavobacteria bacterium BAL38]
 gi|126624779|gb|EAZ95469.1| thioredoxin-related protein [Flavobacteria bacterium BAL38]
          Length = 299

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 96/174 (55%), Gaps = 4/174 (2%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPNP+ LKF+  ++ L + A+   N  E   SPLA  +F  P +  ++   ++I+V K
Sbjct: 111 ETTPNPSVLKFVCNKL-LTKTALECKNIDETIASPLAKELFKFPFVKEIFIDENYISVTK 169

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
               +W+ +   +   I E+  +G+ +I    +   ++       + ++     Q+I  +
Sbjct: 170 FAVTEWDEITLELRTFIKEYIENGNTVIDETAIVKTEIHQKQQEAYFDTLDVTSQQIINI 229

Query: 125 LDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++  V+PAV  DGG+I+F+ +   +  V + ++GACSGCPS++ TLK G+ N+L
Sbjct: 230 IEEYVKPAVQSDGGNIMFESFDPIEKRVKVILQGACSGCPSSTFTLKNGIENML 283



 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I T+ T NPA +KF   + ++      F N  E + SPLA ++F +P + +VY   +FI 
Sbjct: 4  IATKITQNPAIVKFELDENIVRSENFEFKNIDETQNSPLAKQLFFLPFVKTVYVSGNFIA 63

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH 93
          + K    +WE ++  V   I E   +G  II 
Sbjct: 64 IEKFSIVEWEDVQEDVANQINEFISNGGEIIK 95


>gi|297266190|ref|XP_001096379.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Macaca mulatta]
          Length = 196

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 95/186 (51%), Gaps = 36/186 (19%)

Query: 10  NPATLKFIP----GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           NP T+K  P     Q  L      F N    +ISPL  +I    G+ SV+FG DFITV K
Sbjct: 28  NPYTIKKQPLHQFVQRPLFPLPAAFCNP--GKISPLLKQI---EGVKSVFFGPDFITVTK 82

Query: 66  DQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           +    DW  L+P +   IM+ F SG P++          ++  SG+              
Sbjct: 83  ENEDLDWNLLKPDIYATIMDFFASGLPLV---------TEETPSGE-------------- 119

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
                + P V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV
Sbjct: 120 --AGNMLPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEV 177

Query: 184 KDIRTV 189
           + +  V
Sbjct: 178 EGVEQV 183


>gi|323304101|gb|EGA57879.1| Nfu1p [Saccharomyces cerevisiae FostersB]
          Length = 174

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 84/142 (59%), Gaps = 12/142 (8%)

Query: 56  FGYDFITVGKDQY-DWEHLRPPVLGMIMEHFISGDPII--------HNGGLGDMKLDDMG 106
            G DF+T+ KD+   W  ++P ++ ++ +     + +I           G G  K++ M 
Sbjct: 2   IGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYXEDVISKEFHAVQEEEGEGGYKIN-MP 60

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSA 164
             +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C S+
Sbjct: 61  KFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSS 120

Query: 165 SETLKYGVANILNHFVPEVKDI 186
             TLKYG+ ++L H+V EVK++
Sbjct: 121 EVTLKYGIESMLKHYVDEVKEV 142


>gi|149369678|ref|ZP_01889530.1| thioredoxin-related protein [unidentified eubacterium SCB49]
 gi|149357105|gb|EDM45660.1| thioredoxin-related protein [unidentified eubacterium SCB49]
          Length = 306

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 95/180 (52%), Gaps = 10/180 (5%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPNPA LKF+  +  LV G   F N  +A+ +PLA+ +F+ P +  V+   ++I+V K
Sbjct: 112 ETTPNPAVLKFVANKP-LVTGTFDFKNIDDAKHAPLATALFNFPFVKEVFMSNNYISVMK 170

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-MKLDDMGSGDFIE-----SDSAVV 118
            D  +W+ +   +   I  +   G  I  +  L + +K +        E     S S + 
Sbjct: 171 YDIAEWDEISMQLREFIRSYIEDGKEIFTDAMLNETIKEEQKAVASPTENGSDKSYSDID 230

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
             I ++LD  ++PAVA DGG I F  Y      V + ++GACSGCPSA+ TLK G+  +L
Sbjct: 231 NEIMDILDEYIKPAVASDGGHIAFDSYDANTKTVKVILQGACSGCPSATVTLKNGIETML 290



 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 8   TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-D 66
           T N   +KF+    +    +  F N +EA  SP+A ++F +P + +VY   +FI + K +
Sbjct: 11  TNNENIVKFVANSFLTQAKSYEFKNIEEAVESPIAQQLFYLPFVKTVYISQNFIAIEKYN 70

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
              W+ ++  V   I E+  SG P+++   
Sbjct: 71  IVSWDMVQDEVAESINEYIESGKPVVNESA 100


>gi|332519966|ref|ZP_08396430.1| nitrogen-fixing NifU domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332044525|gb|EGI80719.1| nitrogen-fixing NifU domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 300

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 94/181 (51%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + +    A  F    +A+ SPLA+ +F +P + SV+   ++++
Sbjct: 109 VYAESTPNPSVIKFVANKKI-ANAAYEFVTIDDAKPSPLATELFHLPFVKSVFIDENYVS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  +W+ +   +   I  +   G  II       ++          E+     + I
Sbjct: 168 VTKYDVAEWQEITNELREFIRSYIEDGKEIISANAPEAIEKSTKNVDAHFETLDDTSKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  V+PAVA DGG+I F+ Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNILEEYVKPAVASDGGNIQFESYNADTKTVKVILQGACSGCPSSTFTLKNGIENMLKEM 287

Query: 180 V 180
           +
Sbjct: 288 L 288



 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  ++T N + +KF   Q +    +  F+N  EA+ SPLA  +F +P +  VY   +FI 
Sbjct: 6   VTIQETSNNSIIKFELNQFITQHQSFEFNNIDEAKESPLAQELFYLPFVKKVYITSNFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG 98
           + + +  +W+ ++  V   I  +   G  +I      
Sbjct: 66  IERFNIVEWKDVQDEVSEQIKAYLNKGGIVITENATS 102


>gi|326334857|ref|ZP_08201058.1| nitrogen-fixing NifU domain protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325692894|gb|EGD34832.1| nitrogen-fixing NifU domain protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 295

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 98/185 (52%), Gaps = 21/185 (11%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  +  LV     + +A+EA  SPLA+ +F  P +  V+F  ++I+
Sbjct: 110 IYVESTPNPMAMKFVANKK-LVSRVYEYKSAQEAAESPLAAALFKFPYVKEVFFDSNYIS 168

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH------NGGLGDMKLDDMGSGDFIESDS 115
           V +  +  WE +   +   I ++ ++G P++       +   G   L+D+ S        
Sbjct: 169 VIRQPKILWEEVMMELREFIRQYLMAGKPVVRVIVEDGDRPKGLPTLNDIYS-------- 220

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
              ++I  +LD  ++PAV+ DGG+I F  Y     +V + M+GAC+GCPS+  TLK G+ 
Sbjct: 221 ---RKIIAILDQYIKPAVSSDGGNIQFVSYDKESQVVKVLMQGACNGCPSSKLTLKQGIE 277

Query: 174 NILNH 178
            IL  
Sbjct: 278 AILRE 282



 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          M +  + T NPA +K +   V+LV+G+  F+  ++AE SPLA  + +IP I +V+   +F
Sbjct: 1  MRLDIQRTTNPAIIK-LEAPVILVKGSYQFTTEEQAENSPLAKELLAIPFIKTVFISANF 59

Query: 61 ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPII 92
          I +      +W+ +   V   +  +   G PI+
Sbjct: 60 IALEALPIVEWDDVAQEVALQVEAYLRRGAPIL 92


>gi|8571395|gb|AAF76865.1|AF232919_4 NifU-like protein [Sinorhizobium meliloti]
          Length = 63

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 55/63 (87%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HFVPEV+ +
Sbjct: 1   TRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHFVPEVEAV 60

Query: 187 RTV 189
            +V
Sbjct: 61  ESV 63


>gi|17946069|gb|AAL49077.1| RE53788p [Drosophila melanogaster]
          Length = 134

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 65/108 (60%), Gaps = 7/108 (6%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           M+ F SG P++++              + +E D   V  IKE+LD R+RP V  DGGDIV
Sbjct: 1   MDFFASGLPVLNDAQPN-------ADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIV 53

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           F GY  G+V L M+G+CS CPS+  TLK GV N+L  ++PEV+ +  V
Sbjct: 54  FMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 101


>gi|300776224|ref|ZP_07086083.1| nitrogen-fixing NifU [Chryseobacterium gleum ATCC 35910]
 gi|300505357|gb|EFK36496.1| nitrogen-fixing NifU [Chryseobacterium gleum ATCC 35910]
          Length = 292

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (51%), Gaps = 20/191 (10%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIAS-VYFGYDFI 61
           I  E TPNP  +KF+  ++ L+EG +   +   AE  PLA  IF     A+ V+   +F+
Sbjct: 103 IYAEMTPNPNVMKFVSSKL-LMEGFVEVKSKDAAEEVPLAQAIFKEFDFATEVFISDNFV 161

Query: 62  TVGKDQ-YDWEHLRPPVLGMIMEHFISG------DPIIHNGGLGDMKLDDMGSGDFIESD 114
            V +D   +W  +   V  +I E+  +G      +P  H   +     + + + D+ E +
Sbjct: 162 AVTRDNSVEWHQVMMTVRALIAEYLQNGGEISKIEPQKHENPV-----EKIINRDYTEDE 216

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGV 172
               Q+I ++L+  V PAV  DGG I    Y   +    + ++GACSGCPS++ TLK G+
Sbjct: 217 ----QKISDILNEYVAPAVENDGGKISLMEYDQENKTAKMLLQGACSGCPSSTATLKNGI 272

Query: 173 ANILNHFVPEV 183
            NIL  FVP++
Sbjct: 273 ENILKQFVPDL 283


>gi|213962175|ref|ZP_03390439.1| nitrogen-fixing NifU domain protein [Capnocytophaga sputigena
           Capno]
 gi|213955181|gb|EEB66499.1| nitrogen-fixing NifU domain protein [Capnocytophaga sputigena
           Capno]
          Length = 300

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 100/179 (55%), Gaps = 5/179 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFS-IPGIASVYFGYDFI 61
           + TE TPNP  +KF+  +  LV   I + + +EA  +P+A+ + +  P I  V+F  ++I
Sbjct: 109 VYTETTPNPTVMKFVANKR-LVPTVIEYKSIEEATEAPMAATLLTRFPFIEEVFFDDNYI 167

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++ K    +WE +   +   I ++   G PII+   +   + +       + +   + Q+
Sbjct: 168 SLTKKGMEEWEMIAADLRDYIRKYLSEGRPIINPSEIKRRQEEAQARLLSMVTTDEISQQ 227

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY-RDGI-VFLSMRGACSGCPSASETLKYGVANILN 177
           I  +++  V+PAVA DGG+I F  Y RD   V + ++GACSGCPS+++TLK G+  IL 
Sbjct: 228 IVAIIEQYVKPAVASDGGNIQFISYNRDTHHVEVLLQGACSGCPSSTQTLKKGIEVILK 286



 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          + ++ + T NP  +K +     LV+G+  F N  EA+ +PLA  +F +P + +VY   +F
Sbjct: 4  LTLKIQPTANPDIIK-LEANRPLVKGSYEFKNIDEAKNAPLAKELFYLPFVKTVYISSNF 62

Query: 61 ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          I + +    +W+ ++  V   ++ +  SG  I+
Sbjct: 63 IALKRFPIVEWKEVQEEVAQQVLVYLQSGKDIL 95


>gi|315223924|ref|ZP_07865769.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea F0287]
 gi|314946096|gb|EFS98100.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea F0287]
          Length = 299

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 96/178 (53%), Gaps = 5/178 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFS-IPGIASVYFGYDFI 61
           + TE TPNP+ +KF+  +  LV   I + + KE + +P+A  +F+  P I  V+F  ++I
Sbjct: 107 VYTETTPNPSVMKFVANKR-LVPTIIEYKHIKETDEAPMAKALFTQFPFIEEVFFDDNYI 165

Query: 62  TV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V  KD  +W  + P +   I  +   G  +I +  +   +         + +   V ++
Sbjct: 166 SVTKKDNKEWAMVTPNIREFIKNYLSEGHTLISSSEIKRHQQATQERLLSMVTTDEVSKQ 225

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANIL 176
           I  ++D  V+PAVA DGG+I F  Y     ++   ++GACSGCPS++ TLK G+  IL
Sbjct: 226 IVAIIDEFVKPAVASDGGNIQFISYNPETHYVEVILQGACSGCPSSTLTLKKGIEVIL 283



 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          +  + T +P  +K +     LV+G+  + N  EA+ SPLA  +F +P + +VY   +FI 
Sbjct: 6  LSVQPTSSPDIIK-LEANKALVKGSYEYKNIDEAKNSPLAKELFYLPFVKTVYISSNFIA 64

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
          + +    +W+ ++  V   ++ +  SG  I+   G
Sbjct: 65 LKRFPIIEWKDVQEEVAQQVLLYLQSGREIVSTEG 99


>gi|325955388|ref|YP_004239048.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
 gi|323438006|gb|ADX68470.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
          Length = 295

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 98/182 (53%), Gaps = 5/182 (2%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFS-IPGIASVYFGYDFITVG 64
           E TPNPA +KF+  ++ LV   I   + ++A+  P+A+ IF   P I  V+   ++I++ 
Sbjct: 106 EMTPNPAVMKFVSNKL-LVPSIIEIKSREKAQNVPIATAIFQEYPFIEEVFIAENYISLT 164

Query: 65  K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           K D   W+     V   ++ +  +   I ++      ++    +   IE  + V Q+IK 
Sbjct: 165 KNDTESWDLWTMDVRSFVLSYLQTDGKIFNDDYEFVTEIPHEVAIKSIEEMTDVEQQIKA 224

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSM--RGACSGCPSASETLKYGVANILNHFVP 181
           +LD  V+PAVA DGG+I    + +      M  +GACSGCPS++ TLK+G+  +L   +P
Sbjct: 225 ILDEYVQPAVANDGGNIELIEFDEQTKTAKMLLQGACSGCPSSTATLKHGIEGLLKQMLP 284

Query: 182 EV 183
           EV
Sbjct: 285 EV 286



 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 3  IQTEDTPNPATLKFI-PGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
          I TE+TPNP  LKF+ P Q  L  G + +     AE SPLA  + + P I  V+   +F+
Sbjct: 4  IYTENTPNPNILKFVCPTQ--LTAGGVEYKKDDSAENSPLAQVLLTFPFIDKVFITANFV 61

Query: 62 TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNG 95
           + K D   WE +   ++ +I EH+   D II+  
Sbjct: 62 ALEKIDTIKWEDVSDDLIEIIQEHY-DDDAIIYES 95


>gi|325115956|emb|CBZ51510.1| Nitrogen-fixing NifU, C-terminal, related [Neospora caninum
           Liverpool]
          Length = 191

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 93/176 (52%), Gaps = 9/176 (5%)

Query: 23  LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMI 81
           L  G I   + +    SPLA  +F I G +SV    D++TV K +  DW  L  PV   I
Sbjct: 4   LKRGMIDVLSVRAEGASPLADCLFKIDGTSSVLIAGDYVTVVKAKDTDWGDLEEPVKRSI 63

Query: 82  MEHFISGDPIIH------NGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
           ++H +SG P I          + + +  +       + +  + + I+E+L  R RP +  
Sbjct: 64  LDHLMSGLPAIQPVASSEEISVPEGRRQEPQQQSKPDEEEDLSEAIRELLHMRARPMLQA 123

Query: 136 DGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           DGGD+    + +  GIV++ ++G+C GCPS+  T+K G+  +L +++PEV+D+R  
Sbjct: 124 DGGDLEMMRFDEETGIVWVHLKGSCEGCPSSLITVKRGMKQMLQYYIPEVEDVRQC 179


>gi|295132490|ref|YP_003583166.1| nifU related protein [Zunongwangia profunda SM-A87]
 gi|294980505|gb|ADF50970.1| nifU related protein [Zunongwangia profunda SM-A87]
          Length = 309

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 95/186 (51%), Gaps = 13/186 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP  +KF+  + +++  A  F N  +A  SPLA ++F  P +  V+   ++++
Sbjct: 109 VYAESTPNPKVMKFVANRKLVLHAA-EFKNIDDAAESPLAQKLFHFPFVKEVFIDENYVS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF---------IE 112
           + K D   W+ +   +   I      G+ +++N  +        GS            I+
Sbjct: 168 INKYDVASWDEITMELREFIRNFIQEGNSVLNNDAITGAPEGKNGSETSKTAPKPQINID 227

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKY 170
                 Q++  +L+  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK 
Sbjct: 228 ELDDTSQQVVAILEEYIKPAVASDGGNILFDSYNEESRTVKVILQGACSGCPSSTMTLKS 287

Query: 171 GVANIL 176
           G+  +L
Sbjct: 288 GIETML 293



 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  + T  P  +KF   + +       F N  EA  SP+A ++F +P + +VY   +FI 
Sbjct: 6  INIQHTTQPEIVKFEANKFLTKHENFEFKNIDEAAKSPIAQQLFYLPFVKTVYISQNFIA 65

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPII 92
          + K D   W  +   V   I  +   G  +I
Sbjct: 66 IEKYDIVAWPEVENEVAEQIQNYLNKGGIVI 96


>gi|89889561|ref|ZP_01201072.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7]
 gi|89517834|gb|EAS20490.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7]
          Length = 214

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 101/185 (54%), Gaps = 8/185 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + ++V  +  F +  +   + LA ++++ P +  +Y   ++++
Sbjct: 21  VYAEATPNPSVMKFVANKKLVV-NSTEFKSIADTADNTLARQLYNFPFVKEIYADENYVS 79

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPI---IHNGGLGDMKLDDMGSGDFIESDSAVV 118
           + K D   W+ +   +   I E   +G  I    H  G    + +++    F E+   V 
Sbjct: 80  IQKHDIASWDEVTFEIRSFIKEAIENGAEIGSSKHEAGTVKKEGENIELPKF-ENLDDVS 138

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
           +++ E+LD  ++PAVA DGG+IVF  Y +    V + ++GACSGCPS++ TLK G+  +L
Sbjct: 139 KKVVEILDEYIKPAVASDGGNIVFDSYDENTKEVKVILQGACSGCPSSTMTLKSGIETML 198

Query: 177 NHFVP 181
              +P
Sbjct: 199 RDMLP 203


>gi|50593019|ref|NP_001002757.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 3
           [Homo sapiens]
 gi|50593023|ref|NP_001002756.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 3
           [Homo sapiens]
 gi|114577881|ref|XP_001137265.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 3 [Pan troglodytes]
 gi|114577883|ref|XP_001137343.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 4 [Pan troglodytes]
 gi|114577885|ref|XP_001137421.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 5 [Pan troglodytes]
 gi|332226736|ref|XP_003262548.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 4 [Nomascus leucogenys]
 gi|332226738|ref|XP_003262549.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 5 [Nomascus leucogenys]
 gi|332226740|ref|XP_003262550.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 6 [Nomascus leucogenys]
          Length = 113

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 68/108 (62%), Gaps = 8/108 (7%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           M+ F SG P++      +    + GS    E D  VV  IKE+LD R+RP V  DGGD++
Sbjct: 1   MDFFASGLPLVTE----ETPSGEAGS----EEDDEVVAMIKELLDTRIRPTVQEDGGDVI 52

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 53  YKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQV 100


>gi|42521822|ref|NP_967202.1| putative nitrogen-fixing protein NifU [Bdellovibrio bacteriovorus
           HD100]
 gi|39574352|emb|CAE77856.1| putative nitrogen-fixing protein NifU [Bdellovibrio bacteriovorus
           HD100]
          Length = 186

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 95/188 (50%), Gaps = 11/188 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I+ + TPNP   KF+  + VL +G   +++AKEAE S LAS +F + G+  V+F  + 
Sbjct: 6   VLIRIQATPNPNAWKFVLDRAVLNDGKATYADAKEAEQSILASSLFQVEGVRQVHFFQNV 65

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+  +   D E ++  V  +I     +     HN  +  M    +            VQ
Sbjct: 66  ITITHNFDADPEEIQRNVCSVIQTRMPA-----HNPAVTQMDEKKLRRASL----PPEVQ 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL-NH 178
           +I+E+LD  VRP +  DGGD+    Y D  +++  +GAC  CPSA+      +  IL + 
Sbjct: 117 QIEEILDQTVRPGLQGDGGDLDVVKYEDNKLYVFYQGACGTCPSATSGTLMAIEGILRDQ 176

Query: 179 FVPEVKDI 186
           F P ++ I
Sbjct: 177 FNPTIEVI 184


>gi|149912092|ref|ZP_01900681.1| hypothetical protein PE36_11562 [Moritella sp. PE36]
 gi|149804829|gb|EDM64868.1| hypothetical protein PE36_11562 [Moritella sp. PE36]
          Length = 215

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 89/178 (50%), Gaps = 5/178 (2%)

Query: 10  NPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QY 68
           +P T KFI  + +   G   F+N + A  SPL  ++F++PG+A+V      +T+ K+   
Sbjct: 21  DPDTCKFIVSRTLHPGGPFFFANKERAAGSPLGEQLFALPGVANVLIAESIVTICKEPTA 80

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNR 128
            W  L+  +   I    ++G P I    L      D  +G    SD+ ++  I+ +LD  
Sbjct: 81  SWSGLKAAIGTAIRAQLLTGVPAI----LEMYIHTDTQTGMQRRSDAELITVIQGLLDKE 136

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           +  ++A  GG I     R G +++SM G C GC SA  TL+ G   +L    PE+++I
Sbjct: 137 INRSIANHGGKISIVEIRQGKLYISMSGGCQGCASAQVTLRQGFEVMLKRVAPEIEEI 194


>gi|150026140|ref|YP_001296966.1| hypothetical protein FP2102 [Flavobacterium psychrophilum JIP02/86]
 gi|149772681|emb|CAL44164.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 298

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 97/187 (51%), Gaps = 6/187 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  +  L +  +   N  +   SPLA  +F  P +  ++   ++++
Sbjct: 107 VYAESTPNPAVMKFVASKK-LTKTIVECKNIDQTHASPLAKELFKFPFVKEIFIDENYLS 165

Query: 63  VGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K    +W+ +   +   I E   +G  ++    +   K ++       ++     Q+I
Sbjct: 166 ITKYAVAEWQEITLELRTFIKEFIENGKIVVDETKIVATKHEEKQEITNFDNLDVTSQKI 225

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  +RPAVA DGG+I+F  Y      V + ++GACSGCPS++ TLK G+ ++L   
Sbjct: 226 INIIEEYIRPAVAADGGNILFDSYCQDTKQVKVILQGACSGCPSSTFTLKNGIESMLKDM 285

Query: 180 V--PEVK 184
           +  PE++
Sbjct: 286 LNQPELR 292



 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 2  FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           I  +DT NP  LKF     +    +  + N  EA  SPLA ++F +P + +VY   +FI
Sbjct: 3  LITIKDTNNPNILKFEFSYFITPNQSYEYKNIDEAGASPLAQQLFYLPFVKTVYISGNFI 62

Query: 62 TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
           + K +   WE ++  V    ME F+S      NGG
Sbjct: 63 AIEKYNIVQWEDVKHDVADQ-MEAFVS------NGG 91


>gi|322827929|gb|EFZ31905.1| hypothetical protein TCSYLVIO_1772 [Trypanosoma cruzi]
          Length = 261

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 97/198 (48%), Gaps = 17/198 (8%)

Query: 1   MFIQTEDTPNPATLKF-IPGQVVLVEGAIHFSNAKE------AEISPLASRIFSIPG--I 51
           M +    TPNP  L F IP      +G I      E      A + PL++ IF   G  +
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTY--DGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEV 68

Query: 52  ASVYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF 110
           ASV+     +++      DW  L   +   I  + +  +  +       +  DD+     
Sbjct: 69  ASVFIAPRHVSITVYPNVDWSTLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDLR---I 125

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETL 168
            E DS V+Q IKE+L  +VRP V RDGGD+    + D  G+V L+M GAC  CPS+S TL
Sbjct: 126 HEEDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNDETGVVSLAMLGACRTCPSSSNTL 185

Query: 169 KYGVANILNHFVPEVKDI 186
           K G+  ++ HF+PEV ++
Sbjct: 186 KDGIERVMKHFLPEVTEV 203


>gi|313206892|ref|YP_004046069.1| nitrogen-fixing nifu domain protein [Riemerella anatipestifer DSM
           15868]
 gi|312446208|gb|ADQ82563.1| nitrogen-fixing NifU domain protein [Riemerella anatipestifer DSM
           15868]
          Length = 292

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 97/186 (52%), Gaps = 10/186 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIAS-VYFGYDFI 61
           I  E TPNP+ +KF+  +++L EG +   + +EA   PLA  IF     A  V+   +F+
Sbjct: 103 IYAEMTPNPSVMKFVASRLLL-EGFVEVKSREEAAEVPLAQAIFKEFDFAQEVFISDNFV 161

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLDDMGSGDFIESDSAVVQ 119
            V KD    W  +       I E+  +G  + H      +  ++ + + ++ +++    Q
Sbjct: 162 AVTKDDSVQWHEVMVVTRAFIAEYLQNGGEVSHKEPQKHENPVEKIINREYTDTE----Q 217

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM--RGACSGCPSASETLKYGVANILN 177
           +I ++L+  V PAV  DGG I    Y +      M  +GACSGCPS++ TLK G+ N+L 
Sbjct: 218 KISDILNEYVAPAVENDGGKISLMEYDESTKTAKMLLQGACSGCPSSTATLKGGIENVLK 277

Query: 178 HFVPEV 183
            F+P++
Sbjct: 278 QFLPDL 283



 Score = 42.7 bits (99), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 6  EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
          E T NP  +KF+     L+ G++      +    PLA  +F+ P +  ++   +FI V K
Sbjct: 7  EATENPRVMKFV-ADYNLIPGSLELDRNSDISEIPLAQELFNYPFVDKIFITANFIAVAK 65

Query: 66 -DQYDWEHLRPPVLGMIMEHFISG 88
           D  +WEH+   +  +I +  ++ 
Sbjct: 66 QDTVEWEHVVQSLKNVIEDELLAN 89


>gi|255534458|ref|YP_003094829.1| nifU related protein [Flavobacteriaceae bacterium 3519-10]
 gi|255340654|gb|ACU06767.1| nifU related protein [Flavobacteriaceae bacterium 3519-10]
          Length = 292

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 95/190 (50%), Gaps = 16/190 (8%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIAS-VYFGYDF 60
            I +E TPNP  +KF+     L++G +   +  EA   PLA  IF   G A  ++   +F
Sbjct: 102 LIYSEMTPNPMVMKFV-SSTELLDGFVEVKSPAEAGEVPLAKAIFDEFGFAKEIFISGNF 160

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGG----LGDMKLDDMGSGDFIESDS 115
           + V K+   +W  +      + M  FI+    + NGG    +   K +           +
Sbjct: 161 VAVTKNVSVEWHEVM-----ITMRDFIAN--YLQNGGAISNIATQKHETPVESSIQRDYT 213

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVA 173
           A  Q+I ++LD  V PAVA DGG I    Y +      + ++GACSGCPS++ TLK G+ 
Sbjct: 214 ANEQKISDILDEYVAPAVAGDGGKISLIEYDEASKTAKMLLQGACSGCPSSTATLKGGIE 273

Query: 174 NILNHFVPEV 183
           NIL  FVPE+
Sbjct: 274 NILKQFVPEL 283



 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NP  LKF+     L+ G++      +    PLA ++ + P +  ++   +FI 
Sbjct: 4  ILIEATENPKVLKFV-ADYNLLPGSLELDRQSDISEIPLAQKLLNFPFVDRIFITANFIA 62

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISG 88
          V K D  +WE +   +  +I +  I+ 
Sbjct: 63 VAKQDTVEWEFVADSLKNVIEDELIAN 89


>gi|71666135|ref|XP_820030.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885357|gb|EAN98179.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 261

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 97/198 (48%), Gaps = 17/198 (8%)

Query: 1   MFIQTEDTPNPATLKF-IPGQVVLVEGAIHFSNAKE------AEISPLASRIFSIPG--I 51
           M +    TPNP  L F IP      +G I      E      A + PL++ IF   G  +
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTY--DGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEV 68

Query: 52  ASVYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF 110
           ASV+     +++      DW  L   +   I  + +  +  +       +  DD+     
Sbjct: 69  ASVFIAPRHVSITVYPNVDWSTLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDL---RI 125

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETL 168
            E DS V+Q IKE+L  +VRP V RDGGD+    + +  G+V L+M GAC  CPS+S TL
Sbjct: 126 HEEDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTL 185

Query: 169 KYGVANILNHFVPEVKDI 186
           K G+  ++ HF+PEV ++
Sbjct: 186 KDGIERVMKHFLPEVTEV 203


>gi|294877892|ref|XP_002768179.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239870376|gb|EER00897.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 177

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 86/154 (55%), Gaps = 8/154 (5%)

Query: 39  SPLASRIFSIPGIASVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGL 97
           SPLA+ +F I G+  V       TV K  + DWE L+P V  ++M  F     I +   +
Sbjct: 11  SPLAASLFRIHGVDKVLLAARHATVTKSPETDWEMLQPNV-ELVMSQFFE---IPNVKPV 66

Query: 98  GDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMR 155
               ++    G    +D  VV+ I E+L+ R++P V RDGGD+ F  +    G + + + 
Sbjct: 67  SPEAIEYTPEGQDQHNDE-VVKSIHEILEQRIKPFVERDGGDVEFVSFDADSGELEIRLV 125

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           G+CSGCP +S TLK+G+  ++ H++PEVK++  +
Sbjct: 126 GSCSGCPKSSVTLKFGIQRMVCHYIPEVKNVTNI 159


>gi|256820781|ref|YP_003142060.1| nitrogen-fixing NifU domain-containing protein [Capnocytophaga
           ochracea DSM 7271]
 gi|256582364|gb|ACU93499.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea DSM
           7271]
          Length = 299

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 95/178 (53%), Gaps = 5/178 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFS-IPGIASVYFGYDFI 61
           + TE TPNP+ +KF+  +  LV   I + + +E + +P+A  +F+  P I  V+F  ++I
Sbjct: 107 VYTETTPNPSVMKFVANKR-LVPTIIEYKHIEETDEAPMAKALFTQFPFIEEVFFDDNYI 165

Query: 62  TV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V  KD  +W  +   +   I  +   G  +I +  +   +         + +   V ++
Sbjct: 166 SVTKKDNKEWAMVTSNIREFIKNYLSEGHILISSSEIKRHQQATQERLLSMVTTDEVSKQ 225

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANIL 176
           I  ++D  V+PAVA DGG+I F  Y     ++   ++GACSGCPS++ TLK G+  IL
Sbjct: 226 IIAIIDEFVKPAVASDGGNIQFISYNPETHYVEVILQGACSGCPSSTLTLKKGIEVIL 283



 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          +  + T +P  +K +     LV+G+  + N  EA+ SPLA  +F +P + +VY   +FI 
Sbjct: 6  LSVQPTSSPDIIK-LEANKALVKGSYEYKNIDEAKNSPLAKELFYLPFVKTVYISSNFIA 64

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
          + +    +W+ ++  V   ++ +  SG  I+   G
Sbjct: 65 LKRFPIIEWKDVQEEVAQQVLLYLQSGREIVSTEG 99


>gi|8118105|gb|AAF72894.1|AF228511_2 NU1 [Trypanosoma cruzi]
          Length = 261

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 97/198 (48%), Gaps = 17/198 (8%)

Query: 1   MFIQTEDTPNPATLKF-IPGQVVLVEGAIHFSNAKE------AEISPLASRIFSIPG--I 51
           M +    TPNP  L F IP      +G I      E      A + PL++ IF   G  +
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTY--DGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEV 68

Query: 52  ASVYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF 110
           ASV+     +++      +W  L   +   I  + +  +  +       +  DD+     
Sbjct: 69  ASVFIAPRHVSITVYPNVEWSKLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDL---RI 125

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETL 168
            E DS V+Q IKE+L  +VRP V RDGGD+    + +  G+V L+M GAC  CPS+S TL
Sbjct: 126 HEEDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTL 185

Query: 169 KYGVANILNHFVPEVKDI 186
           K G+  ++ HF+PEV ++
Sbjct: 186 KDGIERVMKHFLPEVTEV 203


>gi|21430120|gb|AAM50738.1| GM32035p [Drosophila melanogaster]
          Length = 104

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 50/69 (72%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  ++
Sbjct: 3   IKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYI 62

Query: 181 PEVKDIRTV 189
           PEV+ +  V
Sbjct: 63  PEVESVEQV 71


>gi|146103241|ref|XP_001469515.1| hypothetical protein [Leishmania infantum]
 gi|134073885|emb|CAM72624.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 299

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPG---QVVLVEG-AIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP    +  + +G +   ++   A + PL+  +F      + S
Sbjct: 50  MQLHAQRTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMS 109

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  I       +  DD+   D   
Sbjct: 110 VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLIEDDLELKD--- 166

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
           SDS V+Q IKE+L  +VRP V RDGGD+    +  + GIV L+M GAC  CPS+  TLK 
Sbjct: 167 SDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKD 226

Query: 171 GVANILNHFVPEVKDI 186
           G+  ++ HF+PEV ++
Sbjct: 227 GIERVMKHFLPEVTEV 242


>gi|149196448|ref|ZP_01873503.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
 gi|149140709|gb|EDM29107.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
          Length = 189

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 15/185 (8%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           T+ TPNP  +KFI    V+ +G + +SNA++   + LA+ +FSI  I  V+F  + ITV 
Sbjct: 7   TQPTPNPNAVKFILNLDVITKGRVSYSNAEDCHNNELAATLFSIACITQVHFFENVITVT 66

Query: 65  K--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
           +  D Y WE L   V+ ++ +     DP    G   + +   +         S  V++I+
Sbjct: 67  QNGDMY-WEELEDAVIALLQDGIDKHDPEFQVGEDEEERRAKL---------SPEVRQIE 116

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN-HF 179
           ++LD  VRP++  DGGD++  GY  G  I+ +   GAC+ C S++      + + L   F
Sbjct: 117 DILDRTVRPSLQGDGGDLMVMGYDLGSKILKVMYEGACNSCASSTTGTLMAIKSTLQAEF 176

Query: 180 VPEVK 184
            P+++
Sbjct: 177 DPDIE 181


>gi|315023968|gb|EFT36970.1| nifU related protein [Riemerella anatipestifer RA-YM]
 gi|325335671|gb|ADZ11945.1| Thioredoxin-like protein [Riemerella anatipestifer RA-GD]
          Length = 292

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 96/193 (49%), Gaps = 24/193 (12%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIAS-VYFGYDFI 61
           I  E TPNP+ +KF+  +++L +G +   + +EA   PLA  IF     A  V+   +F+
Sbjct: 103 IYAEMTPNPSVMKFVASRLLL-DGFVEVKSREEAAEVPLAQAIFKEFSFAQEVFISDNFV 161

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK--------LDDMGSGDFIE 112
            V KD    W  +       I E+       + NGG    K        ++ + + ++  
Sbjct: 162 AVTKDDSVQWHEVMVVTRAFIAEY-------LQNGGEVSQKEPQKHENPVEKIINREYTY 214

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM--RGACSGCPSASETLKY 170
           ++    Q+I +VL+  V PAV  DGG I    Y +      M  +GACSGCPS++ TLK 
Sbjct: 215 TE----QKISDVLNEYVAPAVENDGGKISLMEYDESTKTAKMLLQGACSGCPSSTATLKG 270

Query: 171 GVANILNHFVPEV 183
           G+ N+L  F+P++
Sbjct: 271 GIENVLKQFLPDL 283



 Score = 42.7 bits (99), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 6  EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
          E T NP  +KF+     L+ G++      +    PLA  +F+ P +  ++   +FI V K
Sbjct: 7  EATENPRVMKFV-ADYNLIPGSLELDRNSDISEIPLAQELFNYPFVDKIFITANFIAVAK 65

Query: 66 -DQYDWEHLRPPVLGMIMEHFISG 88
           D  +WEH+   +  +I +  ++ 
Sbjct: 66 QDTVEWEHVVQSLKNVIEDELLAN 89


>gi|159163237|pdb|1VEH|A Chain A, Solution Structure Of Rsgi Ruh-018, A Nifu-Like Domain Of
           Hirip5 Protein From Mouse Cdna
          Length = 92

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 54/73 (73%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 14  VVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNML 73

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 74  QFYIPEVEGVEQV 86


>gi|256089666|ref|XP_002580899.1| iron-sulfur cluster scaffold protein nfu-related [Schistosoma
           mansoni]
 gi|238666574|emb|CAZ37138.1| iron-sulfur cluster scaffold protein nfu-related [Schistosoma
           mansoni]
          Length = 153

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 63/101 (62%), Gaps = 1/101 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PG+ VL  G   F +  ++  SPLA ++F I G+  V+FG DF
Sbjct: 44  LFIQVQETPNPNSLKYFPGKPVLGSGTRDFPSCTQSTSSPLARQLFRIEGVERVFFGPDF 103

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           IT+ K D ++W  ++P V   IM+ + SG P++      D+
Sbjct: 104 ITITKNDDFEWAVIKPDVYATIMDFYSSGQPVVSEEKAQDL 144


>gi|297830796|ref|XP_002883280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329120|gb|EFH59539.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 96

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 54/76 (71%), Gaps = 2/76 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYG 171
           DS  V  IKE+L+ R+RPAV  DGGDI + G+    GIV L M+GACSGCPS+S TLK G
Sbjct: 2   DSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSG 61

Query: 172 VANILNHFVPEVKDIR 187
           + N+L H+V EVK + 
Sbjct: 62  IENMLMHYVSEVKGVE 77


>gi|126668356|ref|ZP_01739314.1| hypothetical protein MELB17_13022 [Marinobacter sp. ELB17]
 gi|126627172|gb|EAZ97811.1| hypothetical protein MELB17_13022 [Marinobacter sp. ELB17]
          Length = 211

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 88/178 (49%), Gaps = 9/178 (5%)

Query: 10  NPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QY 68
           +P T KFI  + +   G   F N + A  SPL  ++F++PG+A++      +TV K+   
Sbjct: 21  DPDTCKFIVSRTLHPGGPFFFGNKERAVGSPLGEQLFALPGVANLLIADSVVTVCKEPAA 80

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNR 128
            W  L+  +   I     SG P I      +M   +   G   ++D+ +   ++E+LD  
Sbjct: 81  SWSGLKAGIGMAIRTQLRSGVPAIL-----EMPAHNRRQG---KTDAELTTAVQELLDKE 132

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           V  ++A  GG I   G R G + ++M G C GC S+  TL+ G   +L    PE+++I
Sbjct: 133 VNRSIANHGGKISIVGVRQGKLSITMSGGCQGCASSQVTLRQGFEVMLKRVAPEIEEI 190


>gi|322503448|emb|CBZ38533.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 299

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPG---QVVLVEG-AIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP    +  + +G +   ++   A + PL+  +F      + S
Sbjct: 50  MQLHAQRTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMS 109

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  I       +  DD+   D   
Sbjct: 110 VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLIEDDLELKD--- 166

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    +  + GIV L+M GAC  CPS+  TLK 
Sbjct: 167 TDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKD 226

Query: 171 GVANILNHFVPEVKDI 186
           G+  ++ HF+PEV ++
Sbjct: 227 GIERVMKHFLPEVTEV 242


>gi|261332565|emb|CBH15560.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 261

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 1   MFIQTEDTPNPATLKF-IPGQV---VLVEG-AIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M + +  TPNP+   F IP       + +G     ++   A + PL+  IF      +AS
Sbjct: 11  MQLHSLPTPNPSCYTFHIPSSTYDNFIPDGQTCDVAHMSLAWVHPLSQGIFEQYPQEVAS 70

Query: 54  VYFG--YDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           V+    +  ITV     DW  L   +   I  + +  +          +  DD+      
Sbjct: 71  VFIAPRHTSITV-HPHVDWNKLEWSISSFIGHYLVFTNACFPAAAEYALLEDDLV---IH 126

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLK 169
           E DS V+Q IKE++  +VRP V RDGGD+    +  + G+V L+M GAC  CPS+  TLK
Sbjct: 127 EDDSEVLQCIKELVRGQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLK 186

Query: 170 YGVANILNHFVPEVKDI 186
            GV  +L HF+PEVK++
Sbjct: 187 DGVERLLKHFLPEVKEV 203


>gi|71747438|ref|XP_822774.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|70832442|gb|EAN77946.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
          Length = 261

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 1   MFIQTEDTPNPATLKF-IPGQV---VLVEG-AIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M + +  TPNP+   F IP       + +G     ++   A + PL+  IF      +AS
Sbjct: 11  MQLHSLPTPNPSCYTFHIPSSTYDNFIPDGQTCDVAHMGLAWVHPLSQGIFEQYPQEVAS 70

Query: 54  VYFG--YDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           V+    +  ITV     DW  L   +   I  + +  +          +  DD+      
Sbjct: 71  VFIAPRHTSITV-HPHVDWNKLEWSISSFIGHYLVFTNACFPAAAEYALLEDDLV---IH 126

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLK 169
           E DS V+Q IKE++  +VRP V RDGGD+    +  + G+V L+M GAC  CPS+  TLK
Sbjct: 127 EDDSEVLQCIKELVREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLK 186

Query: 170 YGVANILNHFVPEVKDI 186
            GV  +L HF+PEVK++
Sbjct: 187 DGVERLLKHFLPEVKEV 203


>gi|157876630|ref|XP_001686660.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68129735|emb|CAJ09041.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 311

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 94/189 (49%), Gaps = 13/189 (6%)

Query: 8   TPNPATLKF-IPG---QVVLVEG-AIHFSNAKEAEISPLASRIFSI--PGIASVYFGYDF 60
           TPNP    F IP    +  + +G +   ++   A + PL+  +F      + SV+     
Sbjct: 69  TPNPLCHTFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMSVFIAPRH 128

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +++      DW  +   +   +  + I  +  I       +  DD+   D   +D+ V+Q
Sbjct: 129 VSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLMEDDLELKD---TDTEVLQ 185

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L  +VRP V RDGGD+    +  + GIV L+M GAC  CPS+  TLK G+  ++ 
Sbjct: 186 CIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKDGIERVMK 245

Query: 178 HFVPEVKDI 186
           HFVPEV ++
Sbjct: 246 HFVPEVTEV 254


>gi|323308188|gb|EGA61437.1| Nfu1p [Saccharomyces cerevisiae FostersO]
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 58/84 (69%), Gaps = 2/84 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
           M   +  E D  V + I+E++D R+RPA+  DGGDI ++G+  + G V+L ++GAC+ C 
Sbjct: 1   MPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCS 60

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
           S+  TLKYG+ ++L H+V EVK++
Sbjct: 61  SSEVTLKYGIESMLKHYVDEVKEV 84


>gi|322490669|emb|CBZ25931.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 301

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPG---QVVLVEG-AIHFSNAKEAEISPLASRIFS--IPGIAS 53
           M +  + TPNP    F IP    +  + +G +   ++   A + PL+  +F      + S
Sbjct: 52  MQLHAQPTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYSQEVMS 111

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      +W  +   +   +  + I  +  I       +  DD+   D   
Sbjct: 112 VFIAPRHVSISVYTNVEWSKIEWSISSFLGHYLIFNNTCISPAKEYTLIEDDLELKD--- 168

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    +  + G+V L+M GAC  CPS+  TLK 
Sbjct: 169 TDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACKTCPSSQNTLKD 228

Query: 171 GVANILNHFVPEVKDI 186
           G+  ++ HF+PEV ++
Sbjct: 229 GIERVMKHFLPEVTEV 244


>gi|228472622|ref|ZP_04057382.1| nitrogen-fixing NifU domain protein [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276035|gb|EEK14791.1| nitrogen-fixing NifU domain protein [Capnocytophaga gingivalis ATCC
           33624]
          Length = 299

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 91/186 (48%), Gaps = 22/186 (11%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  +  LV     F   +EAE SPLA  +F    + SV+F  ++++
Sbjct: 111 IYVESTPNPMAMKFVANKK-LVSRPYEFKTIEEAENSPLAQALFGFDFVKSVFFDANYVS 169

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPII------HNGGLGDMKLDDMGSGDFIESD 114
           + +      WE +       + ++ + G  ++       +   G  +L D+ S       
Sbjct: 170 ITRLPRSTPWEEVMMETREFLRQYLMEGKTVVKVAVSEEDRPKGLPRLGDIYS------- 222

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGV 172
               ++I  +LD  +RPAV+ DGG+I F  Y      V + ++GAC+GCPS+  TLK G+
Sbjct: 223 ----KKIVALLDQYIRPAVSSDGGNIEFVSYDKETHKVKVVLQGACNGCPSSRITLKQGI 278

Query: 173 ANILNH 178
             +L  
Sbjct: 279 EGLLRE 284



 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          M +Q + T +P  ++ +   VVLV+G   +S     + SPLA  +  +P I +VYF  +F
Sbjct: 1  MKLQIKYTADPTIVQ-LEAPVVLVKGNYQYSKGDNTQDSPLAGELLRLPFIKTVYFSANF 59

Query: 61 ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
          I +       WE + P ++G I      G+ +++  G
Sbjct: 60 IALQSTGNIRWEEVAPELVGQIETALSQGEALVYLPG 96


>gi|301166538|emb|CBW26114.1| putative nitrogen fixation-related protein [Bacteriovorax marinus
           SJ]
          Length = 184

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 92/185 (49%), Gaps = 11/185 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M IQ + TPNP  LKFI  + V  EG   + +  +   + LA  +F++ G+  ++F  + 
Sbjct: 1   MDIQIQPTPNPNALKFILDKPVKNEGNSSYKSPMDCGDNNLALTLFTVRGVDQLHFYDNV 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K  Y DWE + P ++  I   +   DP            D     +   + S  ++
Sbjct: 61  ITITKFGYEDWESMEPTIMDYINSEYPKHDP---------NYFDPDPEAERRANLSPELK 111

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE-TLKYGVANILNH 178
            I+ +LD  +RP +  DGGDI    + D I+ +  +GAC  CPS++  TL+   A + + 
Sbjct: 112 EIEAILDKTIRPGLQGDGGDIQTISFEDNILLVQYQGACGTCPSSTTGTLEAIKAILRDE 171

Query: 179 FVPEV 183
           + P++
Sbjct: 172 YNPDI 176


>gi|154345572|ref|XP_001568723.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134066065|emb|CAM43852.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 260

 Score = 84.3 bits (207), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 96/196 (48%), Gaps = 13/196 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPG---QVVLVEG-AIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP    +  + +G +   ++   A + PL+  +F      +  
Sbjct: 11  MQLHAQPTPNPLCHSFSIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQEVMC 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  +       +  DD+   D   
Sbjct: 71  VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFNNACVSPAKEYTLIEDDLELKD--- 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    +  + G+V L+M GAC  CPS+  TLK 
Sbjct: 128 NDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKD 187

Query: 171 GVANILNHFVPEVKDI 186
           G+  ++ HF+PEV ++
Sbjct: 188 GIERVMKHFLPEVTEV 203


>gi|238568059|ref|XP_002386363.1| hypothetical protein MPER_15421 [Moniliophthora perniciosa FA553]
 gi|215438109|gb|EEB87293.1| hypothetical protein MPER_15421 [Moniliophthora perniciosa FA553]
          Length = 105

 Score = 84.3 bits (207), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          MFIQTE TPN  +LKFIPG  V+ EG   F + + A  SPLA R+  I G+ +V++G DF
Sbjct: 1  MFIQTETTPNDDSLKFIPGIPVMGEGTAEFLDTRSALASPLAIRLMGIEGVKAVFYGPDF 60

Query: 61 ITVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHN 94
          +T+ KD  + W  ++P V  ++ME F SG  +  +
Sbjct: 61 VTISKDSENPWAVIKPEVYSILMEFFSSGQKMFRS 95


>gi|237843489|ref|XP_002371042.1| NifU-like domain-containing protein [Toxoplasma gondii ME49]
 gi|211968706|gb|EEB03902.1| NifU-like domain-containing protein [Toxoplasma gondii ME49]
 gi|221484803|gb|EEE23097.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 235

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 11/155 (7%)

Query: 46  FSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLD 103
           F I G +SV     ++TV K +  DW+ L  PV   I +H  SG P +       D+   
Sbjct: 24  FQIDGTSSVLIAGGYVTVVKARDTDWKDLEEPVKRCIQDHLTSGIPAVQRAVSSEDVSGA 83

Query: 104 DMGSGDFIESDSA-------VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSM 154
             G  +  E  +A       + + I+E+L  R RP +  DGGD+    + +  GIV++ +
Sbjct: 84  AEGRPEVPEKKNAKSEEEEDLSEAIRELLHMRARPMLQADGGDLEMMRFDEETGIVWVHL 143

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +G+C GCPS+  T+K G+  +L +++PEV+ I  V
Sbjct: 144 KGSCEGCPSSLITVKRGMKQMLQYYIPEVRTILRV 178


>gi|221504979|gb|EEE30644.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 235

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 81/156 (51%), Gaps = 13/156 (8%)

Query: 46  FSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNG--------- 95
           F I G +SV     ++TV K +  DW+ L  PV   I +H  SG P +            
Sbjct: 24  FQIDGTSSVLIAGGYVTVVKARDTDWKDLEEPVKRCIQDHLTSGIPAVQRAVSSEDVSGA 83

Query: 96  GLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLS 153
             G  ++ +  +    E +  + + I+E+L  R RP +  DGGD+    + +  GIV++ 
Sbjct: 84  AEGRPQVPEKKNAKS-EEEEDLSEAIRELLHMRARPMLQADGGDLEMMRFDEETGIVWVH 142

Query: 154 MRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           ++G+C GCPS+  T+K G+  +L +++PEV+ I  V
Sbjct: 143 LKGSCEGCPSSLITVKRGMKQMLQYYIPEVRTILRV 178


>gi|145544593|ref|XP_001457981.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124425800|emb|CAK90584.1| unnamed protein product [Paramecium tetraurelia]
          Length = 196

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 95/190 (50%), Gaps = 16/190 (8%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           + IQ +  PNP  LKFIP G+    +  + F+      + P+        G+   ++G D
Sbjct: 10  LLIQVKQVPNPNFLKFIPIGKQS--KRCLMFTTC----LKPIQHN-----GVTREFYGMD 58

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +I++ K ++  W+ LR  +   I + + S         L +    +  S    + DS  +
Sbjct: 59  YISISKKNESKWDDLRSRIFEQIFDQYESNQEGSEKQFLFEGFKQNKDSV-IQDDDSKPI 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
           Q IK++L++R+RP     GGDIVF+ + +  GI++L  +G+C  CP+ + TLK     +L
Sbjct: 118 QLIKDILNHRIRPDFQEIGGDIVFREFDELNGILYLYKKGSCVECPATATTLKNRFEKML 177

Query: 177 NHFVPEVKDI 186
              V +VK +
Sbjct: 178 CQNVDQVKQV 187


>gi|213407222|ref|XP_002174382.1| NifU-like protein c [Schizosaccharomyces japonicus yFS275]
 gi|212002429|gb|EEB08089.1| NifU-like protein c [Schizosaccharomyces japonicus yFS275]
          Length = 183

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 56/78 (71%), Gaps = 2/78 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETL 168
           ++SDS  V  IKE++D+ +RP++  DGGD+ ++G+  + G V+L +RG+C  C S+  TL
Sbjct: 66  LDSDSETVAMIKELIDSSIRPSIQEDGGDLEYRGFDEQTGTVYLKLRGSCRTCASSEITL 125

Query: 169 KYGVANILNHFVPEVKDI 186
           K G+  +L H++PEVK++
Sbjct: 126 KSGIQQMLMHYIPEVKNV 143


>gi|325982994|ref|YP_004295396.1| Scaffold protein Nfu/NifU [Nitrosomonas sp. AL212]
 gi|325532513|gb|ADZ27234.1| Scaffold protein Nfu/NifU [Nitrosomonas sp. AL212]
          Length = 186

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 6/180 (3%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPN   LKFI  + +    A  F NA+ A   PLAS +F I  + +V++   +ITV +
Sbjct: 8   EGTPNKNALKFILKEPLTWGVARSFDNAEAARDDPLASALFDIDHVTNVFYIDHWITVTQ 67

Query: 66  D-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
           D + +W+ L   +   I     +              L ++   D +      +++I  +
Sbjct: 68  DGEANWQDLARDIADPIRAAPAASAQSAETVATASQALANLNPEDQLR-----LEKINIL 122

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           LD  VRP +  DGGD+   G    I+ +  +GAC  CPS+      G+ N+L    P+++
Sbjct: 123 LDEEVRPYLQSDGGDLHILGLEGNILHIHYQGACGTCPSSISGTLRGIENMLRTLEPDIQ 182


>gi|149195565|ref|ZP_01872622.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
 gi|149141027|gb|EDM29423.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
          Length = 185

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 90/182 (49%), Gaps = 17/182 (9%)

Query: 6   EDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK 65
           E TPNP  LK++  + +L +G   FS A+EA    LA   F++ G+ S+++  ++IT+ K
Sbjct: 8   ETTPNPNALKYVLNETILEDGICQFSAAEEA-TDDLARACFAVEGVVSIFYRDNYITITK 66

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
            D  DW  +   +           D I +     + K   +   +F E  + V + I ++
Sbjct: 67  NDSADWFEIEMTI----------KDEINNRVEAIEFKAQAVPEINFGEKQTLVFE-IDDI 115

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMR--GACSGCPSASETLKYGVANILN-HFVP 181
           LD  +RP +A DGG +      D +V LS+R  GAC  CPS++      + NIL   F P
Sbjct: 116 LDETIRPGLAMDGGGVDIIDLSDEMV-LSVRYQGACGSCPSSTTGTLMAIENILQEQFDP 174

Query: 182 EV 183
            +
Sbjct: 175 RI 176


>gi|30249416|ref|NP_841486.1| nitrogen-fixing protein NifU [Nitrosomonas europaea ATCC 19718]
 gi|30138779|emb|CAD85356.1| Nitrogen-fixing protein NifU [Nitrosomonas europaea ATCC 19718]
          Length = 186

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (46%), Gaps = 6/182 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + E TPNP  LKF+  + +    A  + +A++A   PLA+ +F I  + +V++   +IT+
Sbjct: 6   EIEGTPNPNALKFVLKEPLTWGVAKSYDHAEQAVDDPLAAALFDIDHVTNVFYVDRWITI 65

Query: 64  GKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D   DW+ L   V   I     + D            L D+      E D   ++RI 
Sbjct: 66  TQDGGADWQDLAREVADPIRAAPAATDQSAAVVAAASRTLADLS-----EEDQQRLERIN 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +LD  VRP +  DGGD+        I+ +  +GAC  CPS+      G+  +L    P+
Sbjct: 121 ILLDEEVRPFLQHDGGDLHVLALEGNILRIHYQGACGTCPSSISGTLRGIEQLLRTIEPD 180

Query: 183 VK 184
           ++
Sbjct: 181 IR 182


>gi|313230548|emb|CBY18764.1| unnamed protein product [Oikopleura dioica]
          Length = 140

 Score = 77.4 bits (189), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 68/118 (57%), Gaps = 7/118 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FI TE TPNP  LKF+PG+ VL  GA   F + +EA  SPLA RIF++ G+   +FG D
Sbjct: 15  LFITTEVTPNPNALKFVPGRDVLGAGATCDFPDIREAYKSPLAKRIFAVDGVKGCFFGPD 74

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL----DDMGSGDFI 111
           F+T+ +  +  DW  ++  +  ++ + F S  PII+   L +       DD+  G FI
Sbjct: 75  FVTIIRHDETDDWPVMKAELFAVLTDFFDSNLPIINEDALPNQDTIIYDDDVMLGFFI 132


>gi|313220326|emb|CBY31182.1| unnamed protein product [Oikopleura dioica]
          Length = 140

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 68/118 (57%), Gaps = 7/118 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FI TE TPNP  LKF+PG+ VL  GA   F + +EA  SPLA RIF++ G+   +FG D
Sbjct: 15  LFITTEVTPNPNALKFVPGRDVLGAGATCDFPDIREAYKSPLAKRIFAVDGVKGCFFGPD 74

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL----DDMGSGDFI 111
           F+T+ +  +  DW  ++  +  ++ + F S  PII+   L +       DD+  G FI
Sbjct: 75  FVTIIRHDETDDWPVMKAELFAVLTDFFDSNLPIINEDALPNQDTIIYDDDVMLGFFI 132


>gi|313230549|emb|CBY18765.1| unnamed protein product [Oikopleura dioica]
          Length = 146

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%), Gaps = 2/80 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLK 169
           +S + VV  IKE+LD R+RP V  DGGDI F  +    G++ LS+ GAC+ CPS+  TLK
Sbjct: 44  KSANEVVAMIKELLDTRIRPTVMEDGGDIAFVSFDPDTGVLQLSLIGACATCPSSVVTLK 103

Query: 170 YGVANILNHFVPEVKDIRTV 189
           +GV N++  ++PE+ ++  +
Sbjct: 104 HGVENMMKFYIPEITEVEQI 123


>gi|313220324|emb|CBY31180.1| unnamed protein product [Oikopleura dioica]
          Length = 95

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (2%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+LD R+RP V  DGGDI F  +    G++ LS+ GAC+ CPS+  TLK+GV N++  
Sbjct: 2   IKELLDTRIRPTVMEDGGDIAFVSFDPDTGVLQLSLIGACATCPSSVVTLKHGVENMMKF 61

Query: 179 FVPEVKDIRTV 189
           ++PE+ ++  +
Sbjct: 62  YIPEITEVEQI 72


>gi|294877894|ref|XP_002768180.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239870377|gb|EER00898.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 251

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 92/172 (53%), Gaps = 14/172 (8%)

Query: 22  VLVEGA--IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVL 78
           +L  GA  + F + + +  SPLA  +F I G+  V   +  + V K    DW  ++P V 
Sbjct: 70  ILPSGAKGMTFDSKEGSSQSPLALSLFKIEGVERVVLTHHNVAVSKVSSIDWCFVKPKVE 129

Query: 79  GMIMEHF-ISGDPIIHNGGLG-DMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARD 136
            ++   F + G   ++   L  + ++++      +E       RI EVLD+R+RP +  D
Sbjct: 130 SVLSNFFAVPGLQSVYRSALQFETEVEEAEKAKLME-------RIAEVLDDRIRPVLQDD 182

Query: 137 GGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           GGD+    + +  G++ + ++GAC+GCP +S TL++ + N+L   VPEVK +
Sbjct: 183 GGDVDVADFDEETGVLSVRLKGACAGCPMSSVTLRFRIENMLVQSVPEVKKV 234


>gi|294941309|ref|XP_002783074.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239895342|gb|EER14870.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 165

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
           VV+ I E+L+ R++P V RDGGD+ F  +    G++ + + G+C+GCP +S TLK+G+  
Sbjct: 41  VVKSIHEILEQRIKPFVERDGGDVEFIAFDSDTGVLQIRLVGSCAGCPKSSVTLKFGIQR 100

Query: 175 ILNHFVPEVKDI 186
           ++ H++PEVK++
Sbjct: 101 MVCHYIPEVKNV 112


>gi|149036648|gb|EDL91266.1| histone cell cycle regulation defective interacting protein 5
           (predicted), isoform CRA_b [Rattus norvegicus]
          Length = 79

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 44/60 (73%)

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 6   RPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQV 65


>gi|169350337|ref|ZP_02867275.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552]
 gi|169293120|gb|EDS75253.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552]
          Length = 83

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            + + ++ I++V+ N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK GV
Sbjct: 2   ENMSTIEEIEKVI-NKLRPYLNRDGGDIELVDFKDGIVYVKMLGACAGCAMLDETLKDGV 60

Query: 173 ANILNHFVPEVKDIRTV 189
             IL   VP V +++ V
Sbjct: 61  EQILMEEVPGVLEVKNV 77


>gi|320526969|ref|ZP_08028158.1| NifU-like domain protein [Solobacterium moorei F0204]
 gi|320132554|gb|EFW25095.1| NifU-like domain protein [Solobacterium moorei F0204]
          Length = 109

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++QRI+  LD ++RP +  DGGD+   GY DG+V ++M GAC+GC     TL  G+  IL
Sbjct: 26  LLQRIQHTLD-KIRPYIQADGGDVFLVGYADGVVTVTMTGACNGCMVMDSTLNDGIKAIL 84

Query: 177 NHFVPEVKDIR 187
              VPEV D+R
Sbjct: 85  LDEVPEVHDVR 95


>gi|70940575|ref|XP_740685.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56518569|emb|CAH83895.1| hypothetical protein PC401665.00.0 [Plasmodium chabaudi chabaudi]
          Length = 191

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 51/80 (63%), Gaps = 2/80 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLK 169
           E    ++  IK +++ RVRP V  DGGDI F  +    GIV++ ++GAC GC  +  TL+
Sbjct: 105 EEIMEIISSIKLLIEKRVRPIVVNDGGDIKFVCFDMDSGIVYVQLQGACVGCSQSEVTLQ 164

Query: 170 YGVANILNHFVPEVKDIRTV 189
           Y + N+L +++ E+K+I+ +
Sbjct: 165 YMIKNMLTYYISEIKEIKNI 184


>gi|238604262|ref|XP_002396156.1| hypothetical protein MPER_03666 [Moniliophthora perniciosa FA553]
 gi|215468178|gb|EEB97086.1| hypothetical protein MPER_03666 [Moniliophthora perniciosa FA553]
          Length = 115

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRD---GIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
            ++ RVRPA+  DGGDI ++G+ +   G+V + ++G+C GC S++ TLK G+  +L H++
Sbjct: 21  AVETRVRPAIQEDGGDIEYRGFDEDGSGLVKIKLKGSCRGCDSSTVTLKSGIERMLMHYI 80

Query: 181 PEVKDIRTV 189
           PEVK +  V
Sbjct: 81  PEVKGVEQV 89


>gi|156081764|ref|XP_001608375.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148800946|gb|EDL42351.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 191

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVAN 174
           ++  IK +++ RVRP +  DGGDI F  +   DGIV++ + GAC  C  +  TL+Y + N
Sbjct: 110 IISSIKLLIEKRVRPVIVNDGGDIKFICFDIDDGIVYVQLEGACVTCSQSEITLQYMIKN 169

Query: 175 ILNHFVPEVKDIRTV 189
           +L +++ E+K+I+ V
Sbjct: 170 MLTYYISEIKEIKNV 184


>gi|312213452|emb|CBX93534.1| hypothetical protein [Leptosphaeria maculans]
          Length = 186

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--------AIHFSNAKEAEISPLASRIFSIPGIA 52
           MFIQTE TPN   LKF P   VL E             S       SPLA+ + +I G+ 
Sbjct: 71  MFIQTEPTPNDDALKFNPNARVLSESISSPYLEYLTPRSTLAPPHPSPLAAALMNIDGVT 130

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPI 91
           SV+FG D+ITV KD    W H++P V  +I E   SG  I
Sbjct: 131 SVFFGTDYITVTKDSGTPWAHIKPEVFALITEFMTSGQAI 170


>gi|221054900|ref|XP_002258589.1| NifU-like protein [Plasmodium knowlesi strain H]
 gi|193808658|emb|CAQ39361.1| NifU-like protein, putative [Plasmodium knowlesi strain H]
          Length = 191

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVAN 174
           ++  IK +++ RVRP +  DGGDI F  +   DGIV++ + GAC  C  +  TL+Y + N
Sbjct: 110 IISSIKLLIEKRVRPVIVNDGGDIKFICFDVDDGIVYVQLEGACVTCSQSEITLQYMIKN 169

Query: 175 ILNHFVPEVKDIRTV 189
           +L +++ E+K+I+ V
Sbjct: 170 MLTYYISEIKEIKNV 184


>gi|89900651|ref|YP_523122.1| nitrogen-fixing NifU-like protein [Rhodoferax ferrireducens T118]
 gi|89345388|gb|ABD69591.1| nitrogen-fixing NifU-like [Rhodoferax ferrireducens T118]
          Length = 186

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 84/184 (45%), Gaps = 6/184 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + EDTPNP   KF+  + +    A  + NA++A+   LAS +F+I  + +V++   ++TV
Sbjct: 6   EIEDTPNPNARKFVLREPLTWGIAHSYENAEQAQGDALASALFAIDHVTNVFYIDRWLTV 65

Query: 64  GKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D Q +W+ L   +   +        P         +        D    D   +  I+
Sbjct: 66  TQDGQANWDALVREIAVPL-----RAAPAASEQSAAAVFEARAHVADLSAQDRQRLDDIE 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +LD  +RP +  DGGD+   G     + +  +GAC  CPSA      G+ + L    P+
Sbjct: 121 LILDQEIRPYLQSDGGDLHILGLAGNQLIVHYQGACGTCPSAISGTLQGIESRLRTLEPD 180

Query: 183 VKDI 186
           ++ I
Sbjct: 181 IEVI 184


>gi|82701834|ref|YP_411400.1| nitrogen-fixing NifU-like [Nitrosospira multiformis ATCC 25196]
 gi|82409899|gb|ABB74008.1| Nitrogen-fixing NifU-like protein [Nitrosospira multiformis ATCC
           25196]
          Length = 186

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 6/184 (3%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            ++ E TPN   LKFI  + +       + NA++A+  PLA  +F I  + +V++   +I
Sbjct: 4   IVEIEGTPNRNALKFILKEPLTWGVTRSYDNAEQAKGDPLAEALFDIDHVTNVFYVDRWI 63

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV +D   DW+ L   V   I     +             ++ ++        D   +  
Sbjct: 64  TVTQDGAADWQDLAREVADPIRAAPAADAQTAATIAAAGAEIANLSP-----EDQQRLNL 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I E+LD  +RP +  DGGD+   G     + +  +GAC  CPS+      G+ N+L    
Sbjct: 119 INEMLDEEIRPYLQSDGGDLHVLGLEGNRLSVHYQGACGTCPSSITGTLRGIQNMLRSIE 178

Query: 181 PEVK 184
           P+++
Sbjct: 179 PDLE 182


>gi|302342797|ref|YP_003807326.1| nitrogen-fixing NifU domain protein [Desulfarculus baarsii DSM
           2075]
 gi|301639410|gb|ADK84732.1| nitrogen-fixing NifU domain protein [Desulfarculus baarsii DSM
           2075]
          Length = 73

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           QR++E LD ++RPA+ +DGGD+      D G+V + ++GAC GCP +  TLK G+  +L 
Sbjct: 3   QRVQEALD-KIRPALQKDGGDVKLVDVSDDGVVKVQLQGACHGCPMSQMTLKMGIEKVLK 61

Query: 178 HFVPEVKDIRTV 189
             VPEV+ + +V
Sbjct: 62  QNVPEVQKVESV 73


>gi|167756739|ref|ZP_02428866.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402]
 gi|167702914|gb|EDS17493.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402]
          Length = 83

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +++ ++ +++V+ N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK GV
Sbjct: 2   ENTSTIEEVEKVI-NKLRPYLNRDGGDIELIDFKDGIVYVKMLGACAGCSMLDETLKDGV 60

Query: 173 ANILNHFVPEVKDIRTV 189
             IL   VP V  ++ +
Sbjct: 61  EQILMEEVPGVLGVQNI 77


>gi|120434576|ref|YP_860269.1| hypothetical protein GFO_0207 [Gramella forsetii KT0803]
 gi|117576726|emb|CAL65195.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 257

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 5/144 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  +  LV  A+ F N  +A+ +PL  ++F  P +  ++   ++++
Sbjct: 110 VYAESTPNPAVMKFVANKK-LVLKAVEFKNIDDAKNAPLVQKLFHFPFVKEIFIDENYVS 168

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL---GDMKLDDMGSGDFIESDSAVV 118
           + K D   WE +   +   I  +   G+ +++   +    D   +        E+     
Sbjct: 169 IQKYDMAGWEEITMELREFIRNYIEEGNEVLNVESVQVAADSSSEKGTKTPEFENLDDTS 228

Query: 119 QRIKEVLDNRVRPAVARDGGDIVF 142
           Q+I  +LD  ++PAVA DGG+I+F
Sbjct: 229 QQIIAILDEYIKPAVASDGGNILF 252



 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 8  TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-D 66
          T  P+  KF   + +    +  F N  EA  SP+A ++F +P + +VY   +FI + K D
Sbjct: 11 TTTPSIAKFEADKFLTRHESFEFKNIDEASRSPIAQQLFYLPFVKTVYIAQNFIAIEKYD 70

Query: 67 QYDWEHLRPPVLGMIMEHFISGDPIIH 93
            +WE +   V   I  +   G  +I 
Sbjct: 71 IVEWEDVEKEVAEQIETYLNKGGEVIK 97


>gi|71416241|ref|XP_810158.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70874651|gb|EAN88307.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 452

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  V  ++ +H  SG P + +        D +      E DS VV  +KE++   +
Sbjct: 301 WSELKLHVSALLTDHLFSGRPHV-DPDAPHPHPDTLPQ----EGDSEVVLILKELISTTI 355

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           RP +  DGGDI F     G++++ M GAC  C S+  TL   +     H+VPEV ++R
Sbjct: 356 RPQLQLDGGDIRFVSLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVR 413


>gi|91200475|emb|CAJ73523.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 72

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I+E L   +RPA+  DGGDI    Y DGIV + ++GAC  CPS+  TLKYGV   L  
Sbjct: 3   EKIEEALKG-IRPALQADGGDIELVDYEDGIVKVRLKGACGSCPSSLATLKYGVEARLKE 61

Query: 179 FVPEVKDI 186
            +PE++ +
Sbjct: 62  IIPEIESV 69


>gi|322820651|gb|EFZ27204.1| HIRA-interacting protein 5, putative [Trypanosoma cruzi]
          Length = 452

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  V  ++ +H  SG P + +        D +      E DS VV  +KE++   +
Sbjct: 300 WSELKLHVSALLTDHLFSGRPHV-DPDAPHPHPDTLPQ----EGDSEVVLILKELISTTI 354

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           RP +  DGGDI F     G++++ M GAC  C S+  TL   +     H+VPEV ++R
Sbjct: 355 RPQLQLDGGDIRFVSLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVR 412


>gi|312880024|ref|ZP_07739824.1| nitrogen-fixing NifU domain protein [Aminomonas paucivorans DSM
           12260]
 gi|310783315|gb|EFQ23713.1| nitrogen-fixing NifU domain protein [Aminomonas paucivorans DSM
           12260]
          Length = 76

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANIL 176
           QR+ +V+  ++RP +   GGDI FKG+ +  G V +++ GAC GCP A ETL+  V  +L
Sbjct: 3   QRVLQVIQEQIRPNLQAHGGDIEFKGFDEVEGAVTVALTGACGGCPFAQETLRVQVEQVL 62

Query: 177 NHFVPEVKDIR 187
              +PEVK +R
Sbjct: 63  RAAIPEVKSVR 73


>gi|71665794|ref|XP_819863.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885183|gb|EAN98012.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 426

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  V  ++ +H  SG P + +        D +      E DS VV  +KE++   +
Sbjct: 274 WSELKLHVSALLTDHLFSGRPHV-DPDAPHPHPDTLPQ----EGDSEVVLILKELISTTI 328

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           RP +  DGGDI F     G++++ M GAC  C S+  TL   +     H+VPEV ++R
Sbjct: 329 RPQLQLDGGDIRFVSLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVR 386


>gi|254439456|ref|ZP_05052950.1| NifU-like domain protein [Octadecabacter antarcticus 307]
 gi|198254902|gb|EDY79216.1| NifU-like domain protein [Octadecabacter antarcticus 307]
          Length = 414

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 10  NPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QY 68
           +P TL+FI    V    ++ + +A  +  +PLA  +F+I G+  V      I V +    
Sbjct: 18  DPQTLRFILDAPVQDSTSVCYDDA--SADAPLARALFAISGVQRVEVDGASIYVSRSADV 75

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNR 128
           DW  L+ P+   I +       ++    L   +  +   G+    D+ +   + ++LD+ 
Sbjct: 76  DWSALKAPIAAAIRD-------VLEREALPLGQRSEAPKGE----DALLFLAVADLLDSE 124

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
             PA+A  GG +  +   +  V+L M G C GC ++S TL+ G+  +L   +P + +I
Sbjct: 125 ANPAIASHGGSVAVERVENSDVYLRMSGGCQGCAASSATLRQGIETMLRAGLPAIGEI 182


>gi|296005287|ref|XP_002808974.1| NifU-like protein, putative [Plasmodium falciparum 3D7]
 gi|225631861|emb|CAX64255.1| NifU-like protein, putative [Plasmodium falciparum 3D7]
          Length = 192

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVAN 174
           ++  IK +++ RVRP +  DGGDI F  +    GIV++ + GAC  C  +  TL+Y + N
Sbjct: 111 IISSIKLLIEKRVRPIILNDGGDIKFICFDVDKGIVYVQLEGACVTCAQSEVTLQYMIKN 170

Query: 175 ILNHFVPEVKDIRTV 189
           +L +++ E+K+I+ V
Sbjct: 171 MLTYYISEIKEIKNV 185


>gi|118340603|gb|ABK80653.1| uncharacterized protein [uncultured marine Nitrospinaceae
           bacterium]
          Length = 253

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 84/189 (44%), Gaps = 14/189 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           + I+ + +P      F   + ++   + +F++ + AE S LA R+FS   + +V      
Sbjct: 61  VLIKAQPSPTGDQCLFTVNRSLMTGHSWYFADFESAEGSSLAERLFSQEDVETVLVCECT 120

Query: 61  ITVG---KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +T+    K  +DW  L   V   I E    G+ +I    + D+            ++  V
Sbjct: 121 VTITRKDKTLFDWGPLAKDVGTAIREAIQDGEGLIAEKIIADLP-----------TEEEV 169

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++V+D  V P VA  GG+I     R   V + M G C GC +A  TLK G+     
Sbjct: 170 REGIQKVIDVEVNPGVAGHGGNISLLDVRGNSVTIQMGGGCQGCSAADLTLKQGIHTSFR 229

Query: 178 HFVPEVKDI 186
             VP+V  I
Sbjct: 230 TAVPKVGAI 238


>gi|313683413|ref|YP_004061151.1| nitrogen-fixing nifu domain protein [Sulfuricurvum kujiense DSM
           16994]
 gi|313156273|gb|ADR34951.1| nitrogen-fixing NifU domain protein [Sulfuricurvum kujiense DSM
           16994]
          Length = 91

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++Q ++ V+D ++RP +A DGGDI F G ++G +++ ++GAC GC S+  TLKYGV
Sbjct: 5   SDEELMQPVRNVID-KIRPTLALDGGDIAFLGVKNGTIYVQLQGACIGCSSSGNTLKYGV 63

Query: 173 ANIL 176
              L
Sbjct: 64  ERQL 67


>gi|260892780|ref|YP_003238877.1| nitrogen-fixing NifU domain protein [Ammonifex degensii KC4]
 gi|260864921|gb|ACX52027.1| nitrogen-fixing NifU domain protein [Ammonifex degensii KC4]
          Length = 72

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           ++RP + RDGGD+      DG+V + ++GAC GCP A  TLK G+  IL   VPEVK++ 
Sbjct: 11  QIRPHLQRDGGDVELVAVEDGVVKVRLKGACGGCPMAMVTLKQGIERILKEAVPEVKEVV 70

Query: 188 TV 189
            V
Sbjct: 71  AV 72


>gi|15615981|ref|NP_244286.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans
           C-125]
 gi|10176042|dbj|BAB07138.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans
           C-125]
          Length = 79

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E+ + + +++KEVLD ++RP + RDGGD+      DGIV + + GAC  CPS++ TLK 
Sbjct: 1   METSTEMHEQVKEVLD-KLRPFLLRDGGDVELVDVEDGIVKVRLLGACGSCPSSTITLKA 59

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+   L   VP VK+I  V
Sbjct: 60  GIERALLEEVPGVKEIEQV 78


>gi|237653650|ref|YP_002889964.1| nitrogen-fixing NifU domain protein [Thauera sp. MZ1T]
 gi|237624897|gb|ACR01587.1| nitrogen-fixing NifU domain protein [Thauera sp. MZ1T]
          Length = 202

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 82/183 (44%), Gaps = 10/183 (5%)

Query: 8   TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67
           TPNP   KF+    +      HFS         L   + ++PG+  +Y    FIT+ +D 
Sbjct: 10  TPNPLANKFMLDAPLYTGAPRHFSAGVAVVGDTLGESLLAVPGVVDIYCTGGFITITRDP 69

Query: 68  -YDWEHLRPPVLGMIMEHF------ISGDPIIHNGGLGDMKLDDMGSGDFIE---SDSAV 117
              W  + P V  +I  H       I+            +   +  + + +E    D+ +
Sbjct: 70  GTPWSAIEPAVTELIEGHKARRVIGIANPAGPGGAAGAAIGAGEAVAEEPVEVEADDAEL 129

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + RI ++LD  +RP + +DGG +     ++  + +  +GAC GCPS+S    + + N+L 
Sbjct: 130 LMRINQILDEHIRPFLDQDGGGLDVVKLKEFTLTVRYKGACGGCPSSSTGTLFAINNLLQ 189

Query: 178 HFV 180
           ++V
Sbjct: 190 NYV 192


>gi|288553995|ref|YP_003425930.1| hypothetical protein BpOF4_04870 [Bacillus pseudofirmus OF4]
 gi|288545155|gb|ADC49038.1| hypothetical protein BpOF4_04870 [Bacillus pseudofirmus OF4]
          Length = 79

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           + + +V++++EVLD ++RP + RDGGD+      DGIV + + GAC  CPS++ TLK G+
Sbjct: 3   TSTEMVEQVQEVLD-KLRPFLLRDGGDVELVEVEDGIVKVRLLGACGSCPSSTITLKAGI 61

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP VK+I  V
Sbjct: 62  ERALLEEVPGVKEIEQV 78


>gi|114331232|ref|YP_747454.1| NifU domain-containing protein [Nitrosomonas eutropha C91]
 gi|114308246|gb|ABI59489.1| nitrogen-fixing NifU domain protein [Nitrosomonas eutropha C91]
          Length = 186

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 86/187 (45%), Gaps = 16/187 (8%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + E TPNP  LKFI  + +       ++NA++A   PLA+ +F I  + +V++   +IT+
Sbjct: 6   EIEGTPNPNALKFILKEPLTWGVTKSYNNAEQAADDPLAAALFDIDHVINVFYVDRWITI 65

Query: 64  GKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG-----DFIESDSAV 117
            +D   DW+ L   V           DPI       D     + +      +  E D   
Sbjct: 66  TQDGGADWQDLAREV----------ADPIRAAPAATDQSATVVAAASEALANLSEEDQQR 115

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++RI  +L+  VRP +  DGGD+        ++ +  +GAC  CPS+      G+  +L 
Sbjct: 116 LERINILLEEEVRPYLQHDGGDLHVLALEGSLLRIHYQGACGTCPSSISGTLRGIEQLLR 175

Query: 178 HFVPEVK 184
              P+++
Sbjct: 176 TIEPDIR 182


>gi|258514732|ref|YP_003190954.1| nitrogen-fixing NifU domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778437|gb|ACV62331.1| nitrogen-fixing NifU domain protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 73

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++KEVL  +VRP + RDGGD+ +     DGIV + ++GACSGCP A  TLK G+  +L 
Sbjct: 3   EKVKEVL-GKVRPYLQRDGGDVELVDITADGIVRVKLKGACSGCPGALITLKQGIERVLK 61

Query: 178 HFVPEVKDI 186
             +PEVK +
Sbjct: 62  QEIPEVKGV 70


>gi|294901264|ref|XP_002777311.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239884853|gb|EER09127.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 299

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKY 170
           S + V +RI+ +LD RVRP +A+DGGD  F  +  + G V L++ G+C GCP + +TLK 
Sbjct: 103 SSNEVEERIQSLLDTRVRPVIAQDGGDCEFISFDSQTGRVTLALHGSCEGCPQSVKTLKD 162

Query: 171 GVANILNHFVPEVKDI 186
            +   L  +V EV  +
Sbjct: 163 SIERTLKFYVEEVSSV 178


>gi|291287157|ref|YP_003503973.1| nitrogen-fixing NifU domain protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884317|gb|ADD68017.1| nitrogen-fixing NifU domain protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 75

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           QR++EVLD +VRP +  DGGDI +     DGIV + + GAC  CP ++ TLK+GV   L 
Sbjct: 5   QRVEEVLD-QVRPTLQADGGDIELLDVSEDGIVKVQLTGACGSCPFSTMTLKHGVEARLK 63

Query: 178 HFVPEVKDIRTV 189
             +PEVK++ ++
Sbjct: 64  DMIPEVKEVLSI 75


>gi|329904748|ref|ZP_08273923.1| nitrogen-fixing NifU-like protein [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547851|gb|EGF32611.1| nitrogen-fixing NifU-like protein [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 186

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 6/181 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + +DTPNP  +KF   + +    A  + N  +A   PLA+ +F++  + +V++   ++TV
Sbjct: 6   EIDDTPNPNAVKFTLHEPLSWGVAHAYDNPAQAAGDPLATALFALDHVTNVFYTDRWLTV 65

Query: 64  GKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D + DW     P L  ++   +   P         +    +      E +     RI 
Sbjct: 66  TQDGEADW-----PALVRLIAVPLRAAPAAAAQSAELVSAARLAVHTMSEDEQDRFARIT 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           ++LD ++RPA+  DGGD+   G     + +  +GAC  CPS+       + N+L    P+
Sbjct: 121 DLLDLQIRPALQADGGDLHVLGLSGDTLSIHYQGACGTCPSSIGGTLASIENLLRSIEPD 180

Query: 183 V 183
           +
Sbjct: 181 I 181


>gi|226314372|ref|YP_002774268.1| iron-sulfur cluster assembly protein [Brevibacillus brevis NBRC
           100599]
 gi|226097322|dbj|BAH45764.1| putative iron-sulfur cluster assembly protein [Brevibacillus brevis
           NBRC 100599]
          Length = 89

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E +  ++ +++EVLD ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G
Sbjct: 12  ECNMDIMDQVQEVLD-KLRPYLQRDGGDVQLVDVEDGIVKLRLMGACGSCPSSTITLKAG 70

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +P +K+++ V
Sbjct: 71  IERALVEEIPGIKEVQQV 88


>gi|237734458|ref|ZP_04564939.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229382278|gb|EEO32369.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 75

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK GV  IL   VP V  +
Sbjct: 7   NKLRPYLNRDGGDIELIDFKDGIVYVKMLGACAGCSMLDETLKDGVEQILMEEVPGVLGV 66

Query: 187 RTV 189
           + +
Sbjct: 67  QNI 69


>gi|224543029|ref|ZP_03683568.1| hypothetical protein CATMIT_02223 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524054|gb|EEF93159.1| hypothetical protein CATMIT_02223 [Catenibacterium mitsuokai DSM
           15897]
          Length = 84

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ IKEV+ +++RP + RDGGD+ F  ++DGIV++ M GAC+GC     T+K GV  IL 
Sbjct: 14  IEAIKEVI-HKLRPYLQRDGGDLEFVDFKDGIVYVHMLGACAGCMMLDSTIKDGVEQILI 72

Query: 178 HFVPEVKDIRTV 189
             VP V +++ +
Sbjct: 73  EEVPGVIEVQAI 84


>gi|261333257|emb|CBH16252.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 337

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 5/120 (4%)

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  V  ++ +H  SG   I +        D +      + DS VV  +KE++   +
Sbjct: 209 WSELKLHVSALLTDHLYSGRAHI-DADAPHPHPDTIPQ----DGDSEVVVVLKELISTTI 263

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           RP +  DGGDI F G  D ++ + M GAC  C S+  TL+  +     H+VPEV+ +  V
Sbjct: 264 RPQLQADGGDIRFVGLADSVMLVEMLGACRKCRSSKTTLRDMIERTTRHWVPEVQKVEEV 323


>gi|169333923|ref|ZP_02861116.1| hypothetical protein ANASTE_00309 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259488|gb|EDS73454.1| hypothetical protein ANASTE_00309 [Anaerofustis stercorihominis DSM
           17244]
          Length = 100

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S ++++I++VL+ +VRP++   GGD+V K Y D I+ + + G CSGCP+A  T +  +  
Sbjct: 9   SMMIEKIEKVLNEKVRPSLNSHGGDVVIKSYEDNILRIKLIGKCSGCPAARTTNEDLIKI 68

Query: 175 ILNHFVPEVKDI 186
            +   +PEVKD+
Sbjct: 69  SVMEEIPEVKDV 80


>gi|300087175|ref|YP_003757697.1| nitrogen-fixing NifU domain-containing protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299526908|gb|ADJ25376.1| nitrogen-fixing NifU domain protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 74

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++KEVL+ +VRP +  DGGD+ +     DGIV + + G+C+GCP +  TLK G+  IL 
Sbjct: 3   EKVKEVLE-QVRPNLQADGGDVELVSVSEDGIVTVKLTGSCAGCPMSQMTLKNGIERILK 61

Query: 178 HFVPEVKDI 186
             VPEVK++
Sbjct: 62  REVPEVKEV 70


>gi|157874760|ref|XP_001685794.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68128867|emb|CAJ06031.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 426

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P  H          D       E DS VV  IKE++ 
Sbjct: 216 ETDWSELKLHVSALLTDHICSGNP--HVDPSAPHPHADTAPE---EGDSEVVLMIKELVS 270

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV 
Sbjct: 271 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVS 330

Query: 185 DIRTV 189
            +R V
Sbjct: 331 AVRDV 335


>gi|322494548|emb|CBZ29850.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 426

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P + +        D +      E DS VV  IKE++ 
Sbjct: 216 ETDWSELKLHVSALLTDHICSGNPHV-DPSSSHPHADTLPE----EGDSEVVLLIKELVS 270

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV+
Sbjct: 271 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVR 330

Query: 185 DIRTV 189
            ++ V
Sbjct: 331 AVKDV 335


>gi|319938275|ref|ZP_08012672.1| Fe/S-biogenesis protein NfuA [Coprobacillus sp. 29_1]
 gi|319806568|gb|EFW03226.1| Fe/S-biogenesis protein NfuA [Coprobacillus sp. 29_1]
          Length = 74

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + IK+V+ +++RP + RDGGDI F  + +GIV++ M GAC+GC     TLK GV  IL  
Sbjct: 5   EEIKKVI-HKLRPYLQRDGGDIEFIKFEEGIVYVQMHGACAGCTMLDATLKDGVEQILIE 63

Query: 179 FVPEVKDIRTV 189
            VP V +++ +
Sbjct: 64  EVPGVLEVQAI 74


>gi|283768905|ref|ZP_06341815.1| NifU-like domain protein [Bulleidia extructa W1219]
 gi|283104458|gb|EFC05832.1| NifU-like domain protein [Bulleidia extructa W1219]
          Length = 100

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +++RI+  LD ++RP +  DGGD    G+ DG V +SM GAC GC     TL  G+  IL
Sbjct: 17  LLKRIQHTLD-KIRPYIQADGGDCELVGFDDGTVIISMTGACQGCGIIDITLNDGIKAIL 75

Query: 177 NHFVPEVKDIRTV 189
              VPEVKD++ +
Sbjct: 76  MDEVPEVKDVKML 88


>gi|294897644|ref|XP_002776034.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239882510|gb|EER07850.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 154

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 48  IPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHF-ISGDPIIHNGGLG-DMKLDD 104
           I G+  V   +  + V K    DW  ++P V  ++   F + G   ++   L  + ++++
Sbjct: 1   IEGVERVVLTHHNVAVSKVSSIDWCFVKPKVESVLSNFFAVPGLQSVYRYALQFETEVEE 60

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCP 162
                 +E       RI EVLD+R+RP +  DGGD+    + +  G++ + ++GAC+GCP
Sbjct: 61  AEKAKLME-------RIAEVLDDRIRPVLQDDGGDVDVADFDEETGVLSVRLKGACAGCP 113

Query: 163 SASETLKYGVANILNHFVPEVKDI 186
            +S TL++ + N+L   VPEVK +
Sbjct: 114 MSSVTLRFRIENMLVQSVPEVKKV 137


>gi|56964703|ref|YP_176434.1| nitrogen fixation protein [Bacillus clausii KSM-K16]
 gi|56910946|dbj|BAD65473.1| nitrogen fixation protein [Bacillus clausii KSM-K16]
          Length = 79

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E+ + ++++++EVLD ++RP + RDGGD+      DG+V + + GAC  CPS++ TLK 
Sbjct: 1   METSTELMEQVQEVLD-KLRPFLLRDGGDVELIDVEDGVVKVRLLGACGSCPSSTITLKA 59

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+   L   VP + +I  V
Sbjct: 60  GIERALLEEVPGITEIEQV 78


>gi|71748540|ref|XP_823325.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|70832993|gb|EAN78497.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
          Length = 243

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           DS VV  +KE++   +RP +  DGGDI F G  D ++ + M GAC  C S+  TL+  + 
Sbjct: 154 DSEVVVVLKELISTTIRPQLQADGGDIRFVGLADSVMLVEMLGACRKCRSSKTTLRDMIE 213

Query: 174 NILNHFVPEVKDIRTV 189
               H+VPEV+ +  V
Sbjct: 214 RTTRHWVPEVQKVEEV 229


>gi|224437749|ref|ZP_03658696.1| hypothetical protein HcinC1_07235 [Helicobacter cinaedi CCUG 18818]
 gi|313144195|ref|ZP_07806388.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129226|gb|EFR46843.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 86

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +Q   E++ ++VRP +  DGGDI   G RD  V++ + GAC GCPS++ TLKY + N L 
Sbjct: 9   LQTPVELVIDKVRPTLTLDGGDITLLGIRDAKVYVRLEGACKGCPSSANTLKYAIENRLK 68


>gi|123976981|ref|XP_001314690.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
 gi|121897307|gb|EAY02432.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
          Length = 103

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           F ++      ++  V+D RVRP +  DGGDIV K   DGIV + + G CSGCPS   TL 
Sbjct: 18  FAKATKEFFDKVNAVIDERVRPVLQMDGGDIVLKDITDGIVSVQLTGHCSGCPSRKNTLN 77

Query: 170 YGVANILNH 178
            G+   L  
Sbjct: 78  AGILGCLQE 86


>gi|167042854|gb|ABZ07571.1| putative NifU-like domain protein [uncultured marine microorganism
           HF4000_ANIW137J11]
          Length = 225

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 92/185 (49%), Gaps = 16/185 (8%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I+ E T +    +F+  +  L +G   F++   AE +PLA  +F++P +++V    D ++
Sbjct: 6   IRGEPTADQQVCRFVVDRS-LHDGNASFTSTAAAEGAPLAEALFALPDVSAVTIARDTVS 64

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K    +W  +   +   I     SG+P +     G+M      SG+       + +R+
Sbjct: 65  VTKQGDAEWPEIGKLIGDAIRAQIASGEPAV-----GEMT---PASGE------ELFERV 110

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + VL N + P++A  GG +  +   +G  ++ M G C GC  A  TLK+G+ + L   VP
Sbjct: 111 QAVLVNEINPSIANHGGVVTLQRIEEGKAYVQMGGGCQGCGMADVTLKHGIESYLRQKVP 170

Query: 182 EVKDI 186
           E+ ++
Sbjct: 171 EISEV 175


>gi|189485737|ref|YP_001956678.1| hypothetical protein TGRD_734 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287696|dbj|BAG14217.1| conserved hypothetical protein [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 75

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++++ L++ VRP +  D GD+ +     DGIV + + G+C GCP A+ TL+YGV N + 
Sbjct: 5   EKVEKALES-VRPHLQADCGDVELIDVSEDGIVKVKLTGSCGGCPMAAMTLQYGVTNTIK 63

Query: 178 HFVPEVKDIRTV 189
             VPEVKD++++
Sbjct: 64  QAVPEVKDVQSI 75


>gi|291279936|ref|YP_003496771.1| nitrogen-fixing NifU domain protein [Deferribacter desulfuricans
           SSM1]
 gi|290754638|dbj|BAI81015.1| nitrogen-fixing NifU domain protein [Deferribacter desulfuricans
           SSM1]
          Length = 75

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL N+VRP +  DGGD+ +     DG+V + + GAC  CP ++ TLK+G+   L 
Sbjct: 5   ERVQEVL-NQVRPGLQADGGDVELLDVTEDGVVKVQLTGACGSCPFSTMTLKHGIEMRLK 63

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 64  EMIPEVKEV 72


>gi|317130102|ref|YP_004096384.1| nitrogen-fixing NifU domain protein [Bacillus cellulosilyticus DSM
           2522]
 gi|315475050|gb|ADU31653.1| nitrogen-fixing NifU domain protein [Bacillus cellulosilyticus DSM
           2522]
          Length = 78

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +++ +  +++EVLD ++RP + RDGGD+      DGIV + + GAC  CPS++ TLK G+
Sbjct: 2   AEATMESQVQEVLD-KLRPFLLRDGGDVELVDVEDGIVKVRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP VK++  V
Sbjct: 61  ERALLEEVPGVKELEQV 77


>gi|307720216|ref|YP_003891356.1| nitrogen-fixing NifU domain-containing protein [Sulfurimonas
           autotrophica DSM 16294]
 gi|306978309|gb|ADN08344.1| nitrogen-fixing NifU domain protein [Sulfurimonas autotrophica DSM
           16294]
          Length = 91

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +K V+D +VRP++A DGGDI F   ++G V++ ++GAC GC S+  TLKYGV
Sbjct: 5   SDEELLEPVKHVID-KVRPSLALDGGDIDFITVKNGNVYVQLKGACIGCASSGSTLKYGV 63

Query: 173 ANILNHFV-PEV 183
              L   + PE+
Sbjct: 64  ERQLRMDIHPEI 75


>gi|32267366|ref|NP_861398.1| hypothetical protein HH1867 [Helicobacter hepaticus ATCC 51449]
 gi|32263419|gb|AAP78464.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 91

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           E++  +VRP +  DGGDI   G +D  V++ + GAC GCPS++ TLKY + N L  
Sbjct: 14  EIVIQKVRPTLTLDGGDITLLGIKDAKVYVRLEGACKGCPSSANTLKYAIENRLKE 69


>gi|146097555|ref|XP_001468136.1| hypothetical protein [Leishmania infantum]
 gi|134072503|emb|CAM71216.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 448

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAVVQRIKEV 124
           + DW  L+  V  ++ +H  SG+P +                D +  E DS VV  IKE+
Sbjct: 238 ETDWSELKLHVSALLTDHICSGNPHVDPSA-------PHPHADTVPEEGDSEVVLMIKEL 290

Query: 125 LDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           +   +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PE
Sbjct: 291 VSTTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPE 350

Query: 183 VKDIRTV 189
           V  ++ V
Sbjct: 351 VSAVKDV 357


>gi|295401381|ref|ZP_06811352.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109659|ref|YP_003987975.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
 gi|294976596|gb|EFG52203.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214760|gb|ADP73364.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
          Length = 78

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  + ++++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   SDQEIKEQVQEVLD-KLRPFLLRDGGDCELIDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIVEVEQV 77


>gi|322502114|emb|CBZ37197.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 448

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAVVQRIKEV 124
           + DW  L+  V  ++ +H  SG+P +                D +  E DS VV  IKE+
Sbjct: 238 ETDWSELKLHVSALLTDHICSGNPHVDPSA-------PHPHADTVPEEGDSEVVLMIKEL 290

Query: 125 LDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           +   +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PE
Sbjct: 291 VSTTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPE 350

Query: 183 VKDIRTV 189
           V  ++ V
Sbjct: 351 VSAVKDV 357


>gi|293375093|ref|ZP_06621383.1| NifU-like protein [Turicibacter sanguinis PC909]
 gi|325841245|ref|ZP_08167346.1| NifU-like protein [Turicibacter sp. HGF1]
 gi|292646287|gb|EFF64307.1| NifU-like protein [Turicibacter sanguinis PC909]
 gi|325489926|gb|EGC92273.1| NifU-like protein [Turicibacter sp. HGF1]
          Length = 78

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+L+ ++RP + RDGGD+ +  + DGIV++ M GAC GC S   TLK G+  IL  
Sbjct: 6   KQIVEILE-KLRPYLQRDGGDVEYIKFEDGIVYVRMLGACVGCASMDSTLKDGIEQILLE 64

Query: 179 FVPEVKDIRTV 189
            VP V  +  V
Sbjct: 65  EVPGVIGVENV 75


>gi|71029204|ref|XP_764245.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68351199|gb|EAN31962.1| hypothetical protein TP04_0610 [Theileria parva]
          Length = 180

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASET 167
           + + D   V+ IK ++D R+RP + +DGGD+ F  Y    G V++ + GAC GC  +  T
Sbjct: 84  YSDEDIETVESIKILIDKRIRPVIQQDGGDVSFVSYDPSTGYVYVRLSGACVGCIQSDVT 143

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK+ +  +L H++ E+  +  V
Sbjct: 144 LKHMIQGMLCHYLEEITAVYNV 165


>gi|315453542|ref|YP_004073812.1| nifU protein-like protein [Helicobacter felis ATCC 49179]
 gi|315132594|emb|CBY83222.1| nifU protein homolog [Helicobacter felis ATCC 49179]
          Length = 89

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
            I SD  + + +++ L+ +VRP + RDGGD+V  G ++  V++S+ GAC GC S++ TLK
Sbjct: 1   MIFSDQELQKPVEKALE-KVRPMLLRDGGDVVLLGIKNAKVYVSLEGACKGCASSANTLK 59

Query: 170 YGVANILNH 178
           +G+   L  
Sbjct: 60  FGIERCLQE 68


>gi|229816700|ref|ZP_04446988.1| hypothetical protein COLINT_03748 [Collinsella intestinalis DSM
           13280]
 gi|229807752|gb|EEP43566.1| hypothetical protein COLINT_03748 [Collinsella intestinalis DSM
           13280]
          Length = 98

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 2/70 (2%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +KEVL+ ++RP +  DGGD+ + G   DG+V L ++GAC+GCP +S TL  GV  IL   
Sbjct: 13  LKEVLE-QIRPNLQADGGDMEYIGVTEDGVVKLELQGACAGCPMSSLTLSMGVERILKEH 71

Query: 180 VPEVKDIRTV 189
           VP V  +  V
Sbjct: 72  VPGVTRVEQV 81


>gi|218192692|gb|EEC75119.1| hypothetical protein OsI_11301 [Oryza sativa Indica Group]
          Length = 288

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+     + +  VLD+ VRP +  DGGD+      DG++ L + GAC  CPS++ T+K G
Sbjct: 72  ETYELTAENVDRVLDD-VRPYLIADGGDVTVASVEDGVISLKLEGACGSCPSSTTTMKMG 130

Query: 172 VANILNH-FVPEVKDIRTV 189
           +  +L   F   VKDIR V
Sbjct: 131 IERVLKEKFGDAVKDIRQV 149


>gi|282875569|ref|ZP_06284440.1| NifU-like protein [Staphylococcus epidermidis SK135]
 gi|281295596|gb|EFA88119.1| NifU-like protein [Staphylococcus epidermidis SK135]
          Length = 80

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +S +  ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENSTMFDQVAEVIE-RLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|258516727|ref|YP_003192949.1| nitrogen-fixing NifU domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780432|gb|ACV64326.1| nitrogen-fixing NifU domain protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 73

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++++EVL  +VRP + RDGGD+       DG+V + ++GACSG P A+ TLK G+  +L 
Sbjct: 3   EKVEEVL-GKVRPYLQRDGGDVELVDITPDGVVQVKLKGACSGUPGATITLKQGIERVLK 61

Query: 178 HFVPEVKDI 186
             VPEVK +
Sbjct: 62  QEVPEVKGV 70


>gi|295695724|ref|YP_003588962.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
 gi|295411326|gb|ADG05818.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
          Length = 73

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++++E L+ R+RP +  DGGD+      DG+V L + GAC  CP ++ TLK G+   L  
Sbjct: 4   EKVEEALE-RIRPGLQFDGGDVELVDVEDGVVTLHLIGACGACPMSTMTLKMGIERALRA 62

Query: 179 FVPEVKDIRTV 189
            VPEVK++  V
Sbjct: 63  AVPEVKEVIAV 73


>gi|15923926|ref|NP_371460.1| hypothetical protein SAV0936 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926525|ref|NP_374058.1| hypothetical protein SA0797 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282547|ref|NP_645635.1| hypothetical protein MW0818 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483096|ref|YP_040320.1| hypothetical protein SAR0898 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485712|ref|YP_042933.1| hypothetical protein SAS0806 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|82750551|ref|YP_416292.1| hypothetical protein SAB0802c [Staphylococcus aureus RF122]
 gi|87159950|ref|YP_493539.1| hypothetical protein SAUSA300_0839 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194630|ref|YP_499426.1| hypothetical protein SAOUHSC_00873 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267370|ref|YP_001246313.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393423|ref|YP_001316098.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151221019|ref|YP_001331841.1| hypothetical protein NWMN_0807 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979262|ref|YP_001441521.1| hypothetical protein SAHV_0931 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509138|ref|YP_001574797.1| hypothetical protein USA300HOU_0897 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141927|ref|ZP_03566420.1| hypothetical protein SauraJ_09890 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316824|ref|ZP_04840037.1| hypothetical protein SauraC_11885 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731543|ref|ZP_04865708.1| NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732709|ref|ZP_04866874.1| NifU family protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005726|ref|ZP_05144327.2| hypothetical protein SauraM_04635 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424985|ref|ZP_05601412.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427651|ref|ZP_05604050.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257430286|ref|ZP_05606669.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432983|ref|ZP_05609343.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435887|ref|ZP_05611935.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257795329|ref|ZP_05644308.1| nitrogen fixation protein NifU [Staphylococcus aureus A9781]
 gi|258406978|ref|ZP_05680131.1| nitrogen fixation protein NifU [Staphylococcus aureus A9763]
 gi|258421946|ref|ZP_05684867.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258424377|ref|ZP_05687257.1| nitrogen fixation protein [Staphylococcus aureus A9635]
 gi|258435343|ref|ZP_05689082.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258441555|ref|ZP_05690915.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus A8115]
 gi|258447254|ref|ZP_05695403.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258450014|ref|ZP_05698112.1| nitrogen fixation protein NifU [Staphylococcus aureus A6224]
 gi|258452112|ref|ZP_05700128.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258455527|ref|ZP_05703486.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262049630|ref|ZP_06022498.1| hypothetical protein SAD30_1213 [Staphylococcus aureus D30]
 gi|262052935|ref|ZP_06025116.1| hypothetical protein SA930_0147 [Staphylococcus aureus 930918-3]
 gi|269202551|ref|YP_003281820.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893963|ref|ZP_06302194.1| thioredoxin [Staphylococcus aureus A8117]
 gi|282903473|ref|ZP_06311364.1| NifU domain protein [Staphylococcus aureus subsp. aureus C160]
 gi|282905251|ref|ZP_06313108.1| thioredoxin-family protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908231|ref|ZP_06316062.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282910512|ref|ZP_06318316.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282913708|ref|ZP_06321497.1| NifU domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282916186|ref|ZP_06323948.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus D139]
 gi|282918634|ref|ZP_06326371.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C427]
 gi|282922215|ref|ZP_06329910.1| thioredoxin-like protein [Staphylococcus aureus A9765]
 gi|282923624|ref|ZP_06331304.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C101]
 gi|282927159|ref|ZP_06334781.1| thioredoxin-like protein [Staphylococcus aureus A10102]
 gi|283770001|ref|ZP_06342893.1| thioredoxin protein [Staphylococcus aureus subsp. aureus H19]
 gi|283957674|ref|ZP_06375127.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284023863|ref|ZP_06378261.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           132]
 gi|293500750|ref|ZP_06666601.1| thioredoxin protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509700|ref|ZP_06668411.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus M809]
 gi|293524288|ref|ZP_06670975.1| NifU domain protein [Staphylococcus aureus subsp. aureus M1015]
 gi|294850211|ref|ZP_06790947.1| thioredoxin-like protein [Staphylococcus aureus A9754]
 gi|295405741|ref|ZP_06815550.1| thioredoxin-like protein [Staphylococcus aureus A8819]
 gi|295427419|ref|ZP_06820054.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275869|ref|ZP_06858376.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297208429|ref|ZP_06924859.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245332|ref|ZP_06929203.1| hypothetical protein SLAG_01427 [Staphylococcus aureus A8796]
 gi|297590221|ref|ZP_06948860.1| NifU domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|300912505|ref|ZP_07129948.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381511|ref|ZP_07364161.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13700740|dbj|BAB42036.1| SA0797 [Staphylococcus aureus subsp. aureus N315]
 gi|14246705|dbj|BAB57098.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21203984|dbj|BAB94683.1| MW0818 [Staphylococcus aureus subsp. aureus MW2]
 gi|49241225|emb|CAG39904.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244155|emb|CAG42581.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|82656082|emb|CAI80490.1| nitrogen fixation protein [Staphylococcus aureus RF122]
 gi|87125924|gb|ABD20438.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202188|gb|ABD29998.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147740439|gb|ABQ48737.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945875|gb|ABR51811.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150373819|dbj|BAF67079.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721397|dbj|BAF77814.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367947|gb|ABX28918.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724786|gb|EES93515.1| NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729320|gb|EES98049.1| NifU family protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|257272555|gb|EEV04678.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275844|gb|EEV07317.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257279063|gb|EEV09674.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282398|gb|EEV12533.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285078|gb|EEV15197.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257789301|gb|EEV27641.1| nitrogen fixation protein NifU [Staphylococcus aureus A9781]
 gi|257841517|gb|EEV65958.1| nitrogen fixation protein NifU [Staphylococcus aureus A9763]
 gi|257842279|gb|EEV66707.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257845390|gb|EEV69424.1| nitrogen fixation protein [Staphylococcus aureus A9635]
 gi|257849004|gb|EEV72987.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257852345|gb|EEV76271.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus A8115]
 gi|257854002|gb|EEV76956.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257856934|gb|EEV79837.1| nitrogen fixation protein NifU [Staphylococcus aureus A6224]
 gi|257860327|gb|EEV83159.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257862345|gb|EEV85114.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|259159186|gb|EEW44249.1| hypothetical protein SA930_0147 [Staphylococcus aureus 930918-3]
 gi|259162272|gb|EEW46846.1| hypothetical protein SAD30_1213 [Staphylococcus aureus D30]
 gi|262074841|gb|ACY10814.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940438|emb|CBI48815.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314492|gb|EFB44882.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C101]
 gi|282317768|gb|EFB48140.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C427]
 gi|282319626|gb|EFB49974.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus D139]
 gi|282322740|gb|EFB53062.1| NifU domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282325904|gb|EFB56212.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282327896|gb|EFB58178.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282331658|gb|EFB61170.1| thioredoxin-family protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590848|gb|EFB95923.1| thioredoxin-like protein [Staphylococcus aureus A10102]
 gi|282593505|gb|EFB98499.1| thioredoxin-like protein [Staphylococcus aureus A9765]
 gi|282596428|gb|EFC01389.1| NifU domain protein [Staphylococcus aureus subsp. aureus C160]
 gi|282763449|gb|EFC03578.1| thioredoxin [Staphylococcus aureus A8117]
 gi|283460148|gb|EFC07238.1| thioredoxin protein [Staphylococcus aureus subsp. aureus H19]
 gi|283470135|emb|CAQ49346.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283791125|gb|EFC29940.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285816615|gb|ADC37102.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus
           04-02981]
 gi|290921251|gb|EFD98312.1| NifU domain protein [Staphylococcus aureus subsp. aureus M1015]
 gi|291095755|gb|EFE26016.1| thioredoxin protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467797|gb|EFF10312.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus M809]
 gi|294822985|gb|EFG39418.1| thioredoxin-like protein [Staphylococcus aureus A9754]
 gi|294969176|gb|EFG45196.1| thioredoxin-like protein [Staphylococcus aureus A8819]
 gi|295128807|gb|EFG58438.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887168|gb|EFH26071.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177635|gb|EFH36885.1| hypothetical protein SLAG_01427 [Staphylococcus aureus A8796]
 gi|297576520|gb|EFH95235.1| NifU domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|298694175|gb|ADI97397.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300886751|gb|EFK81953.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|302332549|gb|ADL22742.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302750764|gb|ADL64941.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339874|gb|EFM05818.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312438702|gb|ADQ77773.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829333|emb|CBX34175.1| nifU-like domain protein [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315130484|gb|EFT86471.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315194468|gb|EFU24860.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315197289|gb|EFU27627.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141247|gb|EFW33094.1| NifU-like domain protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143019|gb|EFW34810.1| NifU-like domain protein [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440910|gb|EGA98618.1| NifU domain-containing protein [Staphylococcus aureus O11]
 gi|323443798|gb|EGB01410.1| NifU domain-containing protein [Staphylococcus aureus O46]
 gi|329313603|gb|AEB88016.1| Nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726251|gb|EGG62721.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21189]
 gi|329728166|gb|EGG64605.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21172]
 gi|329733972|gb|EGG70294.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 80

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            D+ +  ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   EDTTMFDQVAEVIE-RLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|189426530|ref|YP_001953707.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ]
 gi|189422789|gb|ACD97187.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ]
          Length = 74

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 50/74 (67%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           ++++++ VLD +VRP + RDGGD+ + +   DGIV + ++GAC  CP ++ TLK G+   
Sbjct: 1   MIEKVQAVLD-QVRPMLQRDGGDVELIEVTADGIVKVKLQGACGSCPMSTMTLKMGIEKA 59

Query: 176 LNHFVPEVKDIRTV 189
           +   +PE+ +++ V
Sbjct: 60  IKEQIPEIVEVQQV 73


>gi|222624810|gb|EEE58942.1| hypothetical protein OsJ_10617 [Oryza sativa Japonica Group]
          Length = 224

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+     + +  VLD+ VRP +  DGGD+      DG++ L + GAC  CPS++ T+K G
Sbjct: 72  ETYELTAENVDRVLDD-VRPYLIADGGDVTVASVEDGVISLKLEGACGSCPSSTTTMKMG 130

Query: 172 VANILNH-FVPEVKDIRTV 189
           +  +L   F   VKDIR V
Sbjct: 131 IERVLKEKFGDAVKDIRQV 149


>gi|115452669|ref|NP_001049935.1| Os03g0314700 [Oryza sativa Japonica Group]
 gi|108707815|gb|ABF95610.1| NifU-like domain containing protein, expressed [Oryza sativa
           Japonica Group]
 gi|113548406|dbj|BAF11849.1| Os03g0314700 [Oryza sativa Japonica Group]
 gi|215697309|dbj|BAG91303.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 224

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+     + +  VLD+ VRP +  DGGD+      DG++ L + GAC  CPS++ T+K G
Sbjct: 72  ETYELTAENVDRVLDD-VRPYLIADGGDVTVASVEDGVISLKLEGACGSCPSSTTTMKMG 130

Query: 172 VANILNH-FVPEVKDIRTV 189
           +  +L   F   VKDIR V
Sbjct: 131 IERVLKEKFGDAVKDIRQV 149


>gi|223984131|ref|ZP_03634283.1| hypothetical protein HOLDEFILI_01575 [Holdemania filiformis DSM
           12042]
 gi|223963925|gb|EEF68285.1| hypothetical protein HOLDEFILI_01575 [Holdemania filiformis DSM
           12042]
          Length = 82

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++K V++ ++RP + RDGGD+ F    DGIV + M GACS C S   TLK G+  IL   
Sbjct: 7   QVKNVIE-KIRPYIQRDGGDVEFVSLEDGIVTVKMLGACSECLSLDATLKDGIEAILLDE 65

Query: 180 VPEVKDIR 187
           VP V ++R
Sbjct: 66  VPGVTEVR 73


>gi|332968729|gb|EGK07781.1| NifU domain protein [Desmospora sp. 8437]
          Length = 73

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++++EVLD ++RP + RDGGD+      DG+V + + GAC  CPS++ TLK G+   L  
Sbjct: 3   EQVQEVLD-KLRPFIQRDGGDVELVNVEDGVVKVRLLGACGSCPSSTITLKAGIERALME 61

Query: 179 FVPEVKDIRTV 189
            +P V ++  V
Sbjct: 62  EIPGVTEVEQV 72


>gi|229543324|ref|ZP_04432384.1| nitrogen-fixing NifU domain protein [Bacillus coagulans 36D1]
 gi|229327744|gb|EEN93419.1| nitrogen-fixing NifU domain protein [Bacillus coagulans 36D1]
          Length = 78

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + ++++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   
Sbjct: 5   TITEQVQEVLD-KLRPFLLRDGGDCELIDVEDGIVKLRLLGACGSCPSSTITLKAGIERA 63

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V ++  V
Sbjct: 64  LFEEVPGVMEVEQV 77


>gi|152012745|gb|AAI50438.1| Hirip5 protein [Danio rerio]
          Length = 157

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 6/101 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFS---NAKEAEISPLASRIFSIPGIASVYFG 57
           MFIQT+DTPNP +LKF+PG+ VL  G + F+   +A  A+ +P       +  I  +   
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAPRADTAPSEDDDEVVAMIKELLDT 110

Query: 58  YDFITVGKD---QYDWEHLRPPVLGMIMEHFISGDPIIHNG 95
               TV +D   + +W+ ++P V   IM+ F SG P+++  
Sbjct: 111 RIRPTVQEDGSGETEWKVIKPDVFATIMDFFTSGLPVVNEA 151



 Score = 37.0 bits (84), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFI--ESDSAVVQRIKEVLDNRVRPAVARDG-GDI 140
            F+ G  ++ +G +      D    D    E D  VV  IKE+LD R+RP V  DG G+ 
Sbjct: 65  KFLPGRAVLDSGTMDFAGPRDAPRADTAPSEDDDEVVAMIKELLDTRIRPTVQEDGSGET 124

Query: 141 VFKGYRDGIVFLSMRGACSGCPSASE 166
            +K  +  +    M    SG P  +E
Sbjct: 125 EWKVIKPDVFATIMDFFTSGLPVVNE 150


>gi|313673639|ref|YP_004051750.1| nitrogen-fixing nifu domain protein [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940395|gb|ADR19587.1| nitrogen-fixing NifU domain protein [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 75

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL  +VRPA+  DGGD+   G  D G+V + + GAC  CP ++ TLK+G+   L 
Sbjct: 5   ERVEEVL-KKVRPALQADGGDVELLGVTDDGVVKVQLTGACGSCPFSTMTLKHGIEMRLK 63

Query: 178 HFVPEVKDI 186
             +PE+K++
Sbjct: 64  DEIPEIKEV 72


>gi|210630137|ref|ZP_03296252.1| hypothetical protein COLSTE_00136 [Collinsella stercoris DSM 13279]
 gi|210160610|gb|EEA91581.1| hypothetical protein COLSTE_00136 [Collinsella stercoris DSM 13279]
          Length = 93

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           Q + EVL+ ++RP +  DGGD+ + G  D G+V L ++GAC+GCP +S TL  G+  IL 
Sbjct: 6   QLLLEVLE-QIRPNLQADGGDMAYVGVTDEGVVQLELQGACAGCPMSSLTLSMGIERILK 64

Query: 178 HFVPEVKDIRTV 189
             VP V  +  V
Sbjct: 65  EHVPGVTRVEQV 76


>gi|84997065|ref|XP_953254.1| hypothetical protein [Theileria annulata strain Ankara]
 gi|65304250|emb|CAI76629.1| hypothetical protein, conserved [Theileria annulata]
          Length = 179

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVAN 174
            V+ IK ++D R+RP + +DGGD+ F  Y    G V++ + GAC GC  +  TLK+ +  
Sbjct: 91  TVESIKLLIDKRIRPVIQQDGGDVFFVSYDPSTGYVYVRLSGACVGCIQSDITLKHMIQG 150

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++ E+  +  V
Sbjct: 151 MLCHYLEEITAVYNV 165


>gi|255536379|ref|YP_003096750.1| Nitrogen-fixing NifU, C-terminal [Flavobacteriaceae bacterium
           3519-10]
 gi|255342575|gb|ACU08688.1| Nitrogen-fixing NifU, C-terminal [Flavobacteriaceae bacterium
           3519-10]
          Length = 77

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           ++RP + +DGGDI     R+ IV++ ++G C+GCP +  T+K GV N +    PE++++ 
Sbjct: 15  KIRPFLNKDGGDIELVDVRESIVYVKLQGNCNGCPMSFSTMKLGVENTIKQHAPEIQEVI 74

Query: 188 TV 189
            V
Sbjct: 75  NV 76


>gi|322379101|ref|ZP_08053503.1| conserved hypothetical nifU-like protein [Helicobacter suis HS1]
 gi|322380564|ref|ZP_08054730.1| NifU-like protein [Helicobacter suis HS5]
 gi|321147026|gb|EFX41760.1| NifU-like protein [Helicobacter suis HS5]
 gi|321148473|gb|EFX42971.1| conserved hypothetical nifU-like protein [Helicobacter suis HS1]
          Length = 89

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  + + ++  L+ ++RP + RDGGD+V  G ++  V++S+ GAC GC S++ TLK+G+
Sbjct: 4   SDQELQKPVQRALE-KIRPVLLRDGGDVVLLGIKEAKVYVSLEGACKGCSSSANTLKFGI 62

Query: 173 ANILNH 178
              L  
Sbjct: 63  ERCLQE 68


>gi|51892183|ref|YP_074874.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855872|dbj|BAD40030.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 77

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           ++  + +R++  LD  +RPA+  DGG++      DG+  + M GAC GCP ++ TLK G+
Sbjct: 2   AEETLFERVERALDL-IRPAIRMDGGEVELVAVEDGVARIRMVGACGGCPMSTMTLKMGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              +   VPE++ +  V
Sbjct: 61  ERAVRQQVPEIRAVEAV 77


>gi|126698430|ref|YP_001087327.1| hypothetical protein CD0850 [Clostridium difficile 630]
 gi|254974469|ref|ZP_05270941.1| hypothetical protein CdifQC_04113 [Clostridium difficile QCD-66c26]
 gi|255091862|ref|ZP_05321340.1| hypothetical protein CdifC_04255 [Clostridium difficile CIP 107932]
 gi|255099963|ref|ZP_05328940.1| hypothetical protein CdifQCD-6_04105 [Clostridium difficile
           QCD-63q42]
 gi|255305852|ref|ZP_05350024.1| hypothetical protein CdifA_04615 [Clostridium difficile ATCC 43255]
 gi|255313596|ref|ZP_05355179.1| hypothetical protein CdifQCD-7_04573 [Clostridium difficile
           QCD-76w55]
 gi|255516280|ref|ZP_05383956.1| hypothetical protein CdifQCD-_04157 [Clostridium difficile
           QCD-97b34]
 gi|255649377|ref|ZP_05396279.1| hypothetical protein CdifQCD_04212 [Clostridium difficile
           QCD-37x79]
 gi|255654901|ref|ZP_05400310.1| hypothetical protein CdifQCD-2_04194 [Clostridium difficile
           QCD-23m63]
 gi|260682549|ref|YP_003213834.1| hypothetical protein CD196_0799 [Clostridium difficile CD196]
 gi|260686148|ref|YP_003217281.1| hypothetical protein CDR20291_0780 [Clostridium difficile R20291]
 gi|306519465|ref|ZP_07405812.1| hypothetical protein CdifQ_04665 [Clostridium difficile QCD-32g58]
 gi|115249867|emb|CAJ67684.1| putative NifU-like protein [Clostridium difficile]
 gi|260208712|emb|CBA61527.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260212164|emb|CBE02822.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 74

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 47/69 (68%), Gaps = 1/69 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++++VL+ +++P + RDGGD+ +     +G+V + ++GACSGCP A+ T+K  + N+L 
Sbjct: 3   EKVEKVLEEKIKPVLQRDGGDVELIDVNENGVVLVRLQGACSGCPGATMTIKAIIENVLV 62

Query: 178 HFVPEVKDI 186
             VP V  +
Sbjct: 63  SEVPGVTQV 71


>gi|332798963|ref|YP_004460462.1| nitrogen-fixing NifU domain-containing protein [Tepidanaerobacter
           sp. Re1]
 gi|332696698|gb|AEE91155.1| nitrogen-fixing NifU domain-containing protein [Tepidanaerobacter
           sp. Re1]
          Length = 74

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           EV+ N++RP++  DGGD+      +  GIV + + GAC GCP A+ TLK G+   L   +
Sbjct: 6   EVVLNKIRPSLQADGGDVELVDVDEVAGIVKVRLTGACGGCPFATMTLKNGIEEALKEEI 65

Query: 181 PEVKDIRTV 189
           PEVK+++ V
Sbjct: 66  PEVKEVQQV 74


>gi|242308908|ref|ZP_04808063.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239524572|gb|EEQ64438.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 81

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 51/78 (65%), Gaps = 2/78 (2%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           F+ SD  +++ ++ V++ +VRP +  DGG++      +G V++ + GAC GCPS+S+TLK
Sbjct: 2   FVFSDQELLKPVEMVIE-KVRPMLINDGGNVTLLKIENGKVYVRLEGACKGCPSSSQTLK 60

Query: 170 YGVANIL-NHFVPEVKDI 186
           +G+   L N   P+++ I
Sbjct: 61  FGIERALKNEIHPDIELI 78


>gi|296449646|ref|ZP_06891419.1| NifU family protein [Clostridium difficile NAP08]
 gi|296878033|ref|ZP_06902051.1| NifU family protein [Clostridium difficile NAP07]
 gi|296261502|gb|EFH08324.1| NifU family protein [Clostridium difficile NAP08]
 gi|296430988|gb|EFH16817.1| NifU family protein [Clostridium difficile NAP07]
          Length = 95

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           A+ +++++VL+ +++P + RDGGD+ +     +G+V + ++GACSGCP A+ T+K  + N
Sbjct: 21  AMREKVEKVLEEKIKPVLQRDGGDVELIDVNENGVVLVRLQGACSGCPGATMTIKAIIEN 80

Query: 175 ILNHFVPEVKDIRTV 189
           +L   VP V  +  V
Sbjct: 81  VLVSEVPGVTQVLGV 95


>gi|149183085|ref|ZP_01861537.1| YutI [Bacillus sp. SG-1]
 gi|148849214|gb|EDL63412.1| YutI [Bacillus sp. SG-1]
          Length = 78

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +   +V +++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 2   TQQELVPQVQEVLD-KLRPFLLRDGGDCELVDIEDGIVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIVEVEQV 77


>gi|70727016|ref|YP_253930.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus
           JCSC1435]
 gi|223043066|ref|ZP_03613114.1| nitrogen fixation protein NifU [Staphylococcus capitis SK14]
 gi|228474235|ref|ZP_04058970.1| nitrogen fixation protein NifU [Staphylococcus hominis SK119]
 gi|239636541|ref|ZP_04677543.1| nitrogen fixation protein NifU [Staphylococcus warneri L37603]
 gi|242373103|ref|ZP_04818677.1| nitrogen fixation protein NifU [Staphylococcus epidermidis
           M23864:W1]
 gi|289551248|ref|YP_003472152.1| nitrogen-fixing NifU domain protein [Staphylococcus lugdunensis
           HKU09-01]
 gi|314933148|ref|ZP_07840513.1| NifU domain protein [Staphylococcus caprae C87]
 gi|314936844|ref|ZP_07844191.1| NifU domain protein [Staphylococcus hominis subsp. hominis C80]
 gi|315658750|ref|ZP_07911619.1| NifU domain protein [Staphylococcus lugdunensis M23590]
 gi|68447740|dbj|BAE05324.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus
           JCSC1435]
 gi|222443920|gb|EEE50017.1| nitrogen fixation protein NifU [Staphylococcus capitis SK14]
 gi|228271594|gb|EEK12941.1| nitrogen fixation protein NifU [Staphylococcus hominis SK119]
 gi|239597896|gb|EEQ80391.1| nitrogen fixation protein NifU [Staphylococcus warneri L37603]
 gi|242349257|gb|EES40858.1| nitrogen fixation protein NifU [Staphylococcus epidermidis
           M23864:W1]
 gi|289180780|gb|ADC88025.1| nitrogen-fixing NifU domain protein [Staphylococcus lugdunensis
           HKU09-01]
 gi|313653298|gb|EFS17055.1| NifU domain protein [Staphylococcus caprae C87]
 gi|313655463|gb|EFS19208.1| NifU domain protein [Staphylococcus hominis subsp. hominis C80]
 gi|315496205|gb|EFU84531.1| NifU domain protein [Staphylococcus lugdunensis M23590]
 gi|330684919|gb|EGG96601.1| NifU-like protein [Staphylococcus epidermidis VCU121]
          Length = 80

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            ++ +  ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENATMFDQVAEVIE-RLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|297544959|ref|YP_003677261.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842734|gb|ADH61250.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 73

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL+  +RP++  DGGD+ +    +DGIV + + GAC GCP A+ TLK G+   + 
Sbjct: 3   ERVEEVLE-LLRPSLQADGGDVELIDVTKDGIVKIRLTGACGGCPFATLTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 62  EEIPEVKEV 70


>gi|152977236|ref|YP_001376753.1| NifU domain-containing protein [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025988|gb|ABS23758.1| nitrogen-fixing NifU domain protein [Bacillus cytotoxicus NVH
           391-98]
          Length = 78

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++ EVLD ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L  
Sbjct: 8   EQVLEVLD-KLRPFLLRDGGDVELVDIEDGIVKLRLMGACGSCPSSTITLKAGIERALLE 66

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 67  EVPGVIEVEQV 77


>gi|224126131|ref|XP_002329668.1| predicted protein [Populus trichocarpa]
 gi|222870549|gb|EEF07680.1| predicted protein [Populus trichocarpa]
          Length = 149

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   L  
Sbjct: 10  ENVEKVLDE-VRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETKLRD 68

Query: 179 FVPEVKDIRTV 189
            +PE+ D+  +
Sbjct: 69  KIPEIMDVEQI 79


>gi|154148473|ref|YP_001407292.1| NifU family protein [Campylobacter hominis ATCC BAA-381]
 gi|153804482|gb|ABS51489.1| NifU family protein [Campylobacter hominis ATCC BAA-381]
          Length = 88

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +++ LD  +RP + +DGGD+   G ++ +V++ ++GAC GC ++++TLKYGV
Sbjct: 5   SDDELIEPVQKSLD-LIRPMLQKDGGDLELLGIKNAVVYVRLKGACHGCSASAQTLKYGV 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|52081716|ref|YP_080507.1| hypothetical protein BL02118 [Bacillus licheniformis ATCC 14580]
 gi|52787102|ref|YP_092931.1| YutI [Bacillus licheniformis ATCC 14580]
 gi|319647633|ref|ZP_08001851.1| nitrogen fixation protein [Bacillus sp. BT1B_CT2]
 gi|52004927|gb|AAU24869.1| Conserved protein YutI [Bacillus licheniformis ATCC 14580]
 gi|52349604|gb|AAU42238.1| YutI [Bacillus licheniformis ATCC 14580]
 gi|317389974|gb|EFV70783.1| nitrogen fixation protein [Bacillus sp. BT1B_CT2]
          Length = 79

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L  
Sbjct: 9   EQVQEVLD-KLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIERALLE 67

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 68  EVPGVIEVEQV 78


>gi|224126127|ref|XP_002329667.1| predicted protein [Populus trichocarpa]
 gi|222870548|gb|EEF07679.1| predicted protein [Populus trichocarpa]
          Length = 167

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   L  
Sbjct: 19  ENVEKVLDE-VRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETKLRD 77

Query: 179 FVPEVKDIRTV 189
            +PE+ D+  +
Sbjct: 78  KIPEIMDVEQI 88


>gi|58177342|pdb|1XHJ|A Chain A, Solution Structure Of The Staphylococcus Epidermidis
           Protein Se0630. Northest Structural Genomics Consortium
           Target Ser8
          Length = 88

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  
Sbjct: 11  QVAEVIE-RLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEE 69

Query: 180 VPEVKDIRTV 189
           VP V ++  V
Sbjct: 70  VPGVIEVEQV 79


>gi|224419202|ref|ZP_03657208.1| hypothetical protein HcanM9_08008 [Helicobacter canadensis MIT
           98-5491]
 gi|253828131|ref|ZP_04871016.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142706|ref|ZP_07804899.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253511537|gb|EES90196.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131737|gb|EFR49354.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 81

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 50/75 (66%), Gaps = 2/75 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ ++ V+D +VRP +  DGG++      +G V++ + GAC GCPS+S+TLK+G+
Sbjct: 5   SDQKLLKPVEIVID-KVRPMLINDGGNVTLLKIENGKVYVRLEGACKGCPSSSKTLKFGI 63

Query: 173 ANIL-NHFVPEVKDI 186
            + L N   P+++ I
Sbjct: 64  ESALKNEIHPDIELI 78


>gi|154343762|ref|XP_001567825.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134065159|emb|CAM40585.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 431

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES-DSAVVQRIKEVLDN 127
           DW  L+  V  ++ +H  SG+P +      D    +  +    E+ DS +V  IKE++  
Sbjct: 223 DWSELKFHVSALLTDHICSGNPHV------DPNAPNPHADTVAEAGDSEIVLMIKELVAT 276

Query: 128 RVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
            +RP +  DGGD+ F G+    G + + + GAC  C ++   L   +     H++PEVK 
Sbjct: 277 TIRPQLQEDGGDLRFVGFDPVLGDMRVELLGACRTCKNSKTALVDLIERTTRHWIPEVKA 336

Query: 186 IRTV 189
           ++ V
Sbjct: 337 VKEV 340


>gi|118487917|gb|ABK95780.1| unknown [Populus trichocarpa]
          Length = 224

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   L  
Sbjct: 76  ENVEKVLDE-VRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETKLRD 134

Query: 179 FVPEVKDIRTV 189
            +PE+ D+  +
Sbjct: 135 KIPEIMDVEQI 145


>gi|27467548|ref|NP_764185.1| nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC
           12228]
 gi|57866465|ref|YP_188114.1| NifU domain-containing protein [Staphylococcus epidermidis RP62A]
 gi|242242226|ref|ZP_04796671.1| NifU family protein [Staphylococcus epidermidis W23144]
 gi|251810309|ref|ZP_04824782.1| NifU family protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|293368312|ref|ZP_06614940.1| NifU domain protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|27315092|gb|AAO04227.1|AE016746_17 nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC
           12228]
 gi|57637123|gb|AAW53911.1| NifU domain protein [Staphylococcus epidermidis RP62A]
 gi|242234321|gb|EES36633.1| NifU family protein [Staphylococcus epidermidis W23144]
 gi|251806191|gb|EES58848.1| NifU family protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|291317559|gb|EFE57977.1| NifU domain protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319401786|gb|EFV89994.1| nifU-like domain protein [Staphylococcus epidermidis FRI909]
 gi|329726827|gb|EGG63287.1| NifU-like protein [Staphylococcus epidermidis VCU144]
 gi|329736812|gb|EGG73077.1| NifU-like protein [Staphylococcus epidermidis VCU028]
 gi|329737604|gb|EGG73850.1| NifU-like protein [Staphylococcus epidermidis VCU045]
          Length = 80

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  
Sbjct: 11  QVAEVIE-RLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEE 69

Query: 180 VPEVKDIRTV 189
           VP V ++  V
Sbjct: 70  VPGVIEVEQV 79


>gi|164688813|ref|ZP_02212841.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM
           16795]
 gi|164602289|gb|EDQ95754.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM
           16795]
          Length = 73

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++  VLD +VRP + RDGGD+ + +   DG+V + ++GACSGCP A+ TLK  + N+L 
Sbjct: 3   EQVAAVLD-KVRPVLQRDGGDVELVEVSDDGVVLVRLKGACSGCPGATMTLKAVIENLLV 61

Query: 178 HFVPEVKDI 186
             VP V  +
Sbjct: 62  KEVPGVTRV 70


>gi|156088839|ref|XP_001611826.1| NifU-like domain containing protein [Babesia bovis]
 gi|154799080|gb|EDO08258.1| NifU-like domain containing protein [Babesia bovis]
          Length = 123

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASET 167
           + E+D  VV  IK ++D R+ P V +DGGD+ F  Y    G V++ + GAC GC  +  T
Sbjct: 26  YSEADLEVVDSIKLLIDKRIAPVVRQDGGDVSFISYDPETGFVYVRLSGACVGCAQSDIT 85

Query: 168 LKYGVANILNHFVPEV 183
           LK+ +   L H++ +V
Sbjct: 86  LKHMIQGTLCHYLDDV 101


>gi|167465184|ref|ZP_02330273.1| nitrogen-fixing NifU domain protein [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322384547|ref|ZP_08058227.1| iron-sulfur scaffold-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150602|gb|EFX44079.1| iron-sulfur scaffold-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 82

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            DS +   + EVLD ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+
Sbjct: 6   QDSTMYDEVLEVLD-KLRPFLQRDGGDVELVDVEDGIVKLRLMGACGSCPSSTITLKAGI 64

Query: 173 ANILNHFVPEVKDIRTV 189
              L   V EV+ I+ V
Sbjct: 65  ERAL---VEEVEGIQEV 78


>gi|152993863|ref|YP_001359584.1| hypothetical protein SUN_2287 [Sulfurovum sp. NBC37-1]
 gi|151425724|dbj|BAF73227.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 92

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  +   +K+V++ +VRP++  DGGDI     +DG+V++ ++GAC GC SA  T+K+GV
Sbjct: 5   TDEELEPAVKDVIE-KVRPSIKLDGGDIELVDIKDGVVYVQLQGACVGCGSAGTTIKFGV 63

Query: 173 ANILNHFV-PEV 183
              L   + PE+
Sbjct: 64  ERQLKTLIHPEI 75


>gi|297583473|ref|YP_003699253.1| nitrogen-fixing NifU domain-containing protein [Bacillus
           selenitireducens MLS10]
 gi|297141930|gb|ADH98687.1| nitrogen-fixing NifU domain protein [Bacillus selenitireducens
           MLS10]
          Length = 78

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +++EVLD ++RP + RDGGD+      DG+V + + GAC  CPS++ TLK G+   L   
Sbjct: 9   QVQEVLD-KLRPFLLRDGGDVELVDVEDGVVKVRLMGACGSCPSSTITLKAGIERALLEE 67

Query: 180 VPEVKDIRTV 189
           VP V ++  V
Sbjct: 68  VPGVTELEQV 77


>gi|298528227|ref|ZP_07015631.1| nitrogen-fixing NifU domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511879|gb|EFI35781.1| nitrogen-fixing NifU domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 73

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 49/72 (68%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++++EVL+ ++RP++  DGGD+ + +   D +V + ++GAC GCP +  TLK G+  ++ 
Sbjct: 3   EQVQEVLE-KIRPSLQADGGDVELVEVTEDNVVKVQLQGACKGCPMSQMTLKNGIERLIM 61

Query: 178 HFVPEVKDIRTV 189
             +P++K + +V
Sbjct: 62  QELPQIKSVESV 73


>gi|20808161|ref|NP_623332.1| thioredoxin domain-containing protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516751|gb|AAM24936.1| Thioredoxin-like proteins and domains [Thermoanaerobacter
           tengcongensis MB4]
          Length = 73

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++E+L N ++P++  DGGD+ +     DG+V + + GAC GCP A+ TLK G+   + 
Sbjct: 3   ERVEEIL-NLIKPSLQADGGDVELVDVTEDGVVKVKLTGACGGCPFATLTLKEGIERAIK 61

Query: 178 HFVPEVKDIRTV 189
             +PEVK++  V
Sbjct: 62  EEIPEVKEVIAV 73


>gi|162448199|ref|YP_001621331.1| NifU-like domain-containing protein [Acholeplasma laidlawii PG-8A]
 gi|161986306|gb|ABX81955.1| NifU-like domain protein [Acholeplasma laidlawii PG-8A]
          Length = 77

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            RVRP + RDGGDI      DGIV++ M GAC GC +   TLK G+  ++   VP +  +
Sbjct: 15  KRVRPYIQRDGGDIELVNIEDGIVYVKMGGACDGCAAIDITLKQGIETMMLENVPGIIAV 74

Query: 187 RTV 189
            TV
Sbjct: 75  VTV 77


>gi|311031755|ref|ZP_07709845.1| NifU-like protein [Bacillus sp. m3-13]
          Length = 78

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           S+  +  +++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 2   SNPEINAQVQEVLD-KLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIIEVEQV 77


>gi|126652035|ref|ZP_01724224.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905]
 gi|169826170|ref|YP_001696328.1| NifU-like protein [Lysinibacillus sphaericus C3-41]
 gi|299536342|ref|ZP_07049655.1| NifU-like protein [Lysinibacillus fusiformis ZC1]
 gi|126591125|gb|EAZ85235.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905]
 gi|168990658|gb|ACA38198.1| NifU-like protein [Lysinibacillus sphaericus C3-41]
 gi|298728328|gb|EFI68890.1| NifU-like protein [Lysinibacillus fusiformis ZC1]
          Length = 78

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +++ +  +++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   AEATINDQVQEVLD-KLRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIVEVEQV 77


>gi|261409236|ref|YP_003245477.1| nitrogen-fixing NifU domain-containing protein [Paenibacillus sp.
           Y412MC10]
 gi|315649387|ref|ZP_07902475.1| nitrogen-fixing NifU domain protein [Paenibacillus vortex V453]
 gi|329926903|ref|ZP_08281306.1| NifU-like protein [Paenibacillus sp. HGF5]
 gi|261285699|gb|ACX67670.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. Y412MC10]
 gi|315275163|gb|EFU38533.1| nitrogen-fixing NifU domain protein [Paenibacillus vortex V453]
 gi|328938890|gb|EGG35263.1| NifU-like protein [Paenibacillus sp. HGF5]
          Length = 81

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           + + V   + EVLD ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+
Sbjct: 5   TQTTVYDEVAEVLD-KLRPFLQRDGGDVELVDVEDGIVKLKLMGACGSCPSSTITLKAGI 63

Query: 173 ANILNHFVPEVKDIRTV 189
              L   V EV+ I+ V
Sbjct: 64  ERAL---VEEVEGIQEV 77


>gi|328954876|ref|YP_004372209.1| nitrogen-fixing NifU domain protein [Coriobacterium glomerans PW2]
 gi|328455200|gb|AEB06394.1| nitrogen-fixing NifU domain protein [Coriobacterium glomerans PW2]
          Length = 92

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +K VLD  +RP +  DGGD+ F G  D G+V L ++GAC+GCP +S TL  G+  +L 
Sbjct: 6   EHLKRVLD-EIRPNLQADGGDLTFVGVDDDGVVQLELQGACAGCPMSSMTLSMGIERVLK 64

Query: 178 HFVPEVKDIRTV 189
             V  V  +  V
Sbjct: 65  EHVAGVTRVEAV 76


>gi|289578725|ref|YP_003477352.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter italicus
           Ab9]
 gi|289528438|gb|ADD02790.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter italicus
           Ab9]
          Length = 73

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL+  +RP++  DGGD+ +     DGIV + + GAC GCP A+ TLK G+   + 
Sbjct: 3   KRVEEVLE-LLRPSLQADGGDVELIDVTEDGIVKIRLTGACGGCPFATLTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 62  EEIPEVKEV 70


>gi|167037171|ref|YP_001664749.1| NifU domain-containing protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040690|ref|YP_001663675.1| NifU domain-containing protein [Thermoanaerobacter sp. X514]
 gi|256751269|ref|ZP_05492149.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914731|ref|ZP_07132047.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X561]
 gi|307724035|ref|YP_003903786.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           sp. X513]
 gi|320115589|ref|YP_004185748.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854930|gb|ABY93339.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X514]
 gi|166856005|gb|ABY94413.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256749824|gb|EEU62848.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889666|gb|EFK84812.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X561]
 gi|307581096|gb|ADN54495.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X513]
 gi|319928680|gb|ADV79365.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 73

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL+  +RP++  DGGD+ +     DGIV + + GAC GCP A+ TLK G+   + 
Sbjct: 3   ERVEEVLE-LLRPSLQADGGDVELIDVTEDGIVKVRLTGACGGCPFATLTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 62  EEIPEVKEV 70


>gi|218961333|ref|YP_001741108.1| NifU-like domain protein [Candidatus Cloacamonas acidaminovorans]
 gi|167729990|emb|CAO80902.1| NifU-like domain protein [Candidatus Cloacamonas acidaminovorans]
          Length = 75

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++I+ +L  +VRP++  DGGD+     R D ++ + ++G C+GCP A+ TLK G+  ++ 
Sbjct: 5   EKIESIL-AKVRPSIQADGGDVELINIREDNVIEVRLKGTCNGCPMATLTLKAGIERLIK 63

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 64  EEIPEVKEV 72


>gi|326494232|dbj|BAJ90385.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 224

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-F 179
           +  VLD+ VRP +  DGGD+      DG+V L + GACS CPS++ T+  G+  +L   F
Sbjct: 81  VDRVLDD-VRPYLISDGGDVAVVSVEDGVVSLRLEGACSSCPSSTTTMNMGIERVLKEKF 139

Query: 180 VPEVKDIRTV 189
              +KDIR V
Sbjct: 140 GDAIKDIRQV 149


>gi|289523173|ref|ZP_06440027.1| NifU domain protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503716|gb|EFD24880.1| NifU domain protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 89

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGV 172
           + V + I +V++  +RPA+   GGDI F GY +    V + + GAC GCP A ETL++ V
Sbjct: 11  TQVQKDITDVIEKDIRPALVSHGGDIEFVGYDEAEKKVMVRLTGACGGCPFARETLRFQV 70

Query: 173 ANILNHFVPEV 183
            N+L   +P++
Sbjct: 71  ENVLKDRLPDI 81


>gi|229916513|ref|YP_002885159.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b]
 gi|229467942|gb|ACQ69714.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b]
          Length = 75

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +++EVLD ++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L   
Sbjct: 6   QVQEVLD-KLRPFLLRDGGDVELVDVEEGIVKLRLMGACGSCPSSTITLKAGIERALIEE 64

Query: 180 VPEVKDIRTV 189
           VP + ++  V
Sbjct: 65  VPGIVEVEQV 74


>gi|23099811|ref|NP_693277.1| nitrogen fixation protein [Oceanobacillus iheyensis HTE831]
 gi|22778042|dbj|BAC14312.1| nitrogen fixation protein (NifU protein) [Oceanobacillus iheyensis
           HTE831]
          Length = 74

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++++EVL N++RP + RDGGD+ +     +G+V L + GAC  CPS++ TLK G+   L 
Sbjct: 3   EQVQEVL-NKLRPFLLRDGGDVELIDVDEEGVVLLRLMGACGNCPSSTITLKAGIERALM 61

Query: 178 HFVPEVKDIRTV 189
             VP V++I  V
Sbjct: 62  AEVPGVREIEQV 73


>gi|254458634|ref|ZP_05072058.1| NifU family protein [Campylobacterales bacterium GD 1]
 gi|207084400|gb|EDZ61688.1| NifU family protein [Campylobacterales bacterium GD 1]
          Length = 91

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +V  N++RP++A DGGDI F   ++G V++ ++GAC GC S+  TLKYGV
Sbjct: 14  QVAINKIRPSLALDGGDIDFITVKNGNVYVQLKGACIGCASSGSTLKYGV 63


>gi|228993673|ref|ZP_04153580.1| hypothetical protein bpmyx0001_43990 [Bacillus pseudomycoides DSM
           12442]
 gi|228999709|ref|ZP_04159285.1| hypothetical protein bmyco0003_42630 [Bacillus mycoides Rock3-17]
 gi|229007266|ref|ZP_04164867.1| hypothetical protein bmyco0002_41480 [Bacillus mycoides Rock1-4]
 gi|229087461|ref|ZP_04219595.1| hypothetical protein bcere0022_40270 [Bacillus cereus Rock3-44]
 gi|228695883|gb|EEL48734.1| hypothetical protein bcere0022_40270 [Bacillus cereus Rock3-44]
 gi|228754020|gb|EEM03457.1| hypothetical protein bmyco0002_41480 [Bacillus mycoides Rock1-4]
 gi|228760071|gb|EEM09041.1| hypothetical protein bmyco0003_42630 [Bacillus mycoides Rock3-17]
 gi|228766102|gb|EEM14749.1| hypothetical protein bpmyx0001_43990 [Bacillus pseudomycoides DSM
           12442]
          Length = 78

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++ EVLD ++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L  
Sbjct: 8   EQVLEVLD-KLRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGIERALLE 66

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 67  EVPGVIEVEQV 77


>gi|229032593|ref|ZP_04188558.1| hypothetical protein bcere0028_46300 [Bacillus cereus AH1271]
 gi|229135778|ref|ZP_04264548.1| hypothetical protein bcere0014_46610 [Bacillus cereus BDRD-ST196]
 gi|228647644|gb|EEL03709.1| hypothetical protein bcere0014_46610 [Bacillus cereus BDRD-ST196]
 gi|228728778|gb|EEL79789.1| hypothetical protein bcere0028_46300 [Bacillus cereus AH1271]
          Length = 78

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++ EVLD ++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L  
Sbjct: 8   EQVLEVLD-KLRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGIERALLE 66

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 67  EVPGVIEVEQV 77


>gi|57651628|ref|YP_185809.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           COL]
 gi|57285814|gb|AAW37908.1| NifU domain protein [Staphylococcus aureus subsp. aureus COL]
          Length = 73

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++ EV++ R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  
Sbjct: 4   QVAEVIE-RLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEE 62

Query: 180 VPEVKDIRTV 189
           VP V ++  V
Sbjct: 63  VPGVIEVEQV 72


>gi|30022992|ref|NP_834623.1| NifU protein [Bacillus cereus ATCC 14579]
 gi|30264992|ref|NP_847369.1| NifU domain-containing protein [Bacillus anthracis str. Ames]
 gi|42784132|ref|NP_981379.1| NifU domain-containing protein [Bacillus cereus ATCC 10987]
 gi|47530492|ref|YP_021841.1| NifU domain-containing protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47566983|ref|ZP_00237700.1| NifU protein-related protein [Bacillus cereus G9241]
 gi|49187811|ref|YP_031064.1| NifU domain-containing protein [Bacillus anthracis str. Sterne]
 gi|49481022|ref|YP_038969.1| NifU domain-containing protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52140580|ref|YP_086250.1| NifU domain-containing protein [Bacillus cereus E33L]
 gi|75758910|ref|ZP_00739021.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|118480036|ref|YP_897187.1| NifU-like domain-containing protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|163942665|ref|YP_001647549.1| NifU domain-containing protein [Bacillus weihenstephanensis KBAB4]
 gi|165870953|ref|ZP_02215605.1| nifU domain protein [Bacillus anthracis str. A0488]
 gi|167634861|ref|ZP_02393179.1| nifU domain protein [Bacillus anthracis str. A0442]
 gi|167639907|ref|ZP_02398175.1| nifU domain protein [Bacillus anthracis str. A0193]
 gi|170685656|ref|ZP_02876879.1| nifU domain protein [Bacillus anthracis str. A0465]
 gi|170706993|ref|ZP_02897450.1| nifU domain protein [Bacillus anthracis str. A0389]
 gi|177652329|ref|ZP_02934832.1| nifU domain protein [Bacillus anthracis str. A0174]
 gi|190567150|ref|ZP_03020065.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|196033148|ref|ZP_03100561.1| nifU domain protein [Bacillus cereus W]
 gi|196040592|ref|ZP_03107892.1| nifU domain protein [Bacillus cereus NVH0597-99]
 gi|196043939|ref|ZP_03111176.1| nifU domain protein [Bacillus cereus 03BB108]
 gi|206970391|ref|ZP_03231344.1| nifU domain protein [Bacillus cereus AH1134]
 gi|206976476|ref|ZP_03237383.1| nifU domain protein [Bacillus cereus H3081.97]
 gi|217962417|ref|YP_002340989.1| nifU domain protein [Bacillus cereus AH187]
 gi|218235090|ref|YP_002369752.1| nifU domain protein [Bacillus cereus B4264]
 gi|218900105|ref|YP_002448516.1| nifU domain protein [Bacillus cereus G9842]
 gi|218906144|ref|YP_002453978.1| nifU domain protein [Bacillus cereus AH820]
 gi|222098402|ref|YP_002532460.1| nitrogen-fixing nifu domain protein [Bacillus cereus Q1]
 gi|225866921|ref|YP_002752299.1| nifU domain protein [Bacillus cereus 03BB102]
 gi|227817723|ref|YP_002817732.1| nifU domain protein [Bacillus anthracis str. CDC 684]
 gi|228903455|ref|ZP_04067581.1| hypothetical protein bthur0014_46170 [Bacillus thuringiensis IBL
           4222]
 gi|228910790|ref|ZP_04074599.1| hypothetical protein bthur0013_49320 [Bacillus thuringiensis IBL
           200]
 gi|228917578|ref|ZP_04081122.1| hypothetical protein bthur0012_47840 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228923687|ref|ZP_04086965.1| hypothetical protein bthur0011_46620 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228929976|ref|ZP_04092987.1| hypothetical protein bthur0010_46580 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228936248|ref|ZP_04099047.1| hypothetical protein bthur0009_46860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228942118|ref|ZP_04104658.1| hypothetical protein bthur0008_47490 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228948675|ref|ZP_04110953.1| hypothetical protein bthur0007_47990 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228955216|ref|ZP_04117224.1| hypothetical protein bthur0006_45740 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228961200|ref|ZP_04122821.1| hypothetical protein bthur0005_46480 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228968061|ref|ZP_04129067.1| hypothetical protein bthur0004_48450 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228975048|ref|ZP_04135607.1| hypothetical protein bthur0003_47960 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981687|ref|ZP_04141982.1| hypothetical protein bthur0002_48460 [Bacillus thuringiensis Bt407]
 gi|228988194|ref|ZP_04148291.1| hypothetical protein bthur0001_48520 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229014137|ref|ZP_04171258.1| hypothetical protein bmyco0001_45420 [Bacillus mycoides DSM 2048]
 gi|229020189|ref|ZP_04176962.1| hypothetical protein bcere0030_46810 [Bacillus cereus AH1273]
 gi|229026415|ref|ZP_04182772.1| hypothetical protein bcere0029_46920 [Bacillus cereus AH1272]
 gi|229049643|ref|ZP_04194200.1| hypothetical protein bcere0027_46010 [Bacillus cereus AH676]
 gi|229062619|ref|ZP_04199928.1| hypothetical protein bcere0026_46850 [Bacillus cereus AH603]
 gi|229072441|ref|ZP_04205643.1| hypothetical protein bcere0025_46020 [Bacillus cereus F65185]
 gi|229076327|ref|ZP_04209292.1| hypothetical protein bcere0024_46310 [Bacillus cereus Rock4-18]
 gi|229082198|ref|ZP_04214662.1| hypothetical protein bcere0023_48160 [Bacillus cereus Rock4-2]
 gi|229094055|ref|ZP_04225139.1| hypothetical protein bcere0021_47700 [Bacillus cereus Rock3-42]
 gi|229099409|ref|ZP_04230339.1| hypothetical protein bcere0020_46280 [Bacillus cereus Rock3-29]
 gi|229105568|ref|ZP_04236202.1| hypothetical protein bcere0019_46970 [Bacillus cereus Rock3-28]
 gi|229112395|ref|ZP_04241933.1| hypothetical protein bcere0018_46350 [Bacillus cereus Rock1-15]
 gi|229118422|ref|ZP_04247776.1| hypothetical protein bcere0017_46890 [Bacillus cereus Rock1-3]
 gi|229124488|ref|ZP_04253673.1| hypothetical protein bcere0016_47720 [Bacillus cereus 95/8201]
 gi|229130213|ref|ZP_04259172.1| hypothetical protein bcere0015_46490 [Bacillus cereus BDRD-Cer4]
 gi|229141670|ref|ZP_04270200.1| hypothetical protein bcere0013_47600 [Bacillus cereus BDRD-ST26]
 gi|229147497|ref|ZP_04275844.1| hypothetical protein bcere0012_46260 [Bacillus cereus BDRD-ST24]
 gi|229153141|ref|ZP_04281320.1| hypothetical protein bcere0011_46710 [Bacillus cereus m1550]
 gi|229158547|ref|ZP_04286606.1| hypothetical protein bcere0010_47200 [Bacillus cereus ATCC 4342]
 gi|229163931|ref|ZP_04291871.1| hypothetical protein bcere0009_46940 [Bacillus cereus R309803]
 gi|229169674|ref|ZP_04297374.1| hypothetical protein bcere0007_46180 [Bacillus cereus AH621]
 gi|229175651|ref|ZP_04303159.1| hypothetical protein bcere0006_47280 [Bacillus cereus MM3]
 gi|229181250|ref|ZP_04308580.1| hypothetical protein bcere0005_45920 [Bacillus cereus 172560W]
 gi|229187187|ref|ZP_04314332.1| hypothetical protein bcere0004_47230 [Bacillus cereus BGSC 6E1]
 gi|229193231|ref|ZP_04320182.1| hypothetical protein bcere0002_48780 [Bacillus cereus ATCC 10876]
 gi|229199099|ref|ZP_04325782.1| hypothetical protein bcere0001_46120 [Bacillus cereus m1293]
 gi|229604077|ref|YP_002869195.1| nifU domain protein [Bacillus anthracis str. A0248]
 gi|254687285|ref|ZP_05151142.1| nifU domain protein [Bacillus anthracis str. CNEVA-9066]
 gi|254725297|ref|ZP_05187080.1| nifU domain protein [Bacillus anthracis str. A1055]
 gi|254735378|ref|ZP_05193086.1| nifU domain protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254740645|ref|ZP_05198336.1| nifU domain protein [Bacillus anthracis str. Kruger B]
 gi|254753093|ref|ZP_05205129.1| nifU domain protein [Bacillus anthracis str. Vollum]
 gi|254761435|ref|ZP_05213456.1| nifU domain protein [Bacillus anthracis str. Australia 94]
 gi|296505392|ref|YP_003667092.1| NifU protein [Bacillus thuringiensis BMB171]
 gi|301056437|ref|YP_003794648.1| nitrogen-fixing NifU domain-containing protein [Bacillus anthracis
           CI]
 gi|29898552|gb|AAP11824.1| NifU protein [Bacillus cereus ATCC 14579]
 gi|30259669|gb|AAP28855.1| nifU domain protein [Bacillus anthracis str. Ames]
 gi|42740063|gb|AAS43987.1| nifU domain protein [Bacillus cereus ATCC 10987]
 gi|47505640|gb|AAT34316.1| nifU domain protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|47556301|gb|EAL14635.1| NifU protein-related protein [Bacillus cereus G9241]
 gi|49181738|gb|AAT57114.1| nifU domain protein [Bacillus anthracis str. Sterne]
 gi|49332578|gb|AAT63224.1| nitrogen-fixing NifU domain protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974049|gb|AAU15599.1| nitrogen-fixing NifU domain protein [Bacillus cereus E33L]
 gi|74493584|gb|EAO56689.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|118419261|gb|ABK87680.1| NifU-like domain protein [Bacillus thuringiensis str. Al Hakam]
 gi|163864862|gb|ABY45921.1| nitrogen-fixing NifU domain protein [Bacillus weihenstephanensis
           KBAB4]
 gi|164713462|gb|EDR18987.1| nifU domain protein [Bacillus anthracis str. A0488]
 gi|167511988|gb|EDR87366.1| nifU domain protein [Bacillus anthracis str. A0193]
 gi|167529611|gb|EDR92360.1| nifU domain protein [Bacillus anthracis str. A0442]
 gi|170128096|gb|EDS96966.1| nifU domain protein [Bacillus anthracis str. A0389]
 gi|170670120|gb|EDT20860.1| nifU domain protein [Bacillus anthracis str. A0465]
 gi|172082335|gb|EDT67401.1| nifU domain protein [Bacillus anthracis str. A0174]
 gi|190561654|gb|EDV15624.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|195994577|gb|EDX58532.1| nifU domain protein [Bacillus cereus W]
 gi|196025275|gb|EDX63945.1| nifU domain protein [Bacillus cereus 03BB108]
 gi|196028724|gb|EDX67331.1| nifU domain protein [Bacillus cereus NVH0597-99]
 gi|206734968|gb|EDZ52137.1| nifU domain protein [Bacillus cereus AH1134]
 gi|206745400|gb|EDZ56800.1| nifU domain protein [Bacillus cereus H3081.97]
 gi|217063374|gb|ACJ77624.1| nifU domain protein [Bacillus cereus AH187]
 gi|218163047|gb|ACK63039.1| nifU domain protein [Bacillus cereus B4264]
 gi|218538404|gb|ACK90802.1| nifU domain protein [Bacillus cereus AH820]
 gi|218541315|gb|ACK93709.1| nifU domain protein [Bacillus cereus G9842]
 gi|221242461|gb|ACM15171.1| nitrogen-fixing NifU domain protein [Bacillus cereus Q1]
 gi|225790034|gb|ACO30251.1| nifU domain protein [Bacillus cereus 03BB102]
 gi|227002453|gb|ACP12196.1| nifU domain protein [Bacillus anthracis str. CDC 684]
 gi|228584370|gb|EEK42505.1| hypothetical protein bcere0001_46120 [Bacillus cereus m1293]
 gi|228590208|gb|EEK48076.1| hypothetical protein bcere0002_48780 [Bacillus cereus ATCC 10876]
 gi|228596197|gb|EEK53872.1| hypothetical protein bcere0004_47230 [Bacillus cereus BGSC 6E1]
 gi|228602143|gb|EEK59634.1| hypothetical protein bcere0005_45920 [Bacillus cereus 172560W]
 gi|228607792|gb|EEK65106.1| hypothetical protein bcere0006_47280 [Bacillus cereus MM3]
 gi|228613713|gb|EEK70838.1| hypothetical protein bcere0007_46180 [Bacillus cereus AH621]
 gi|228619552|gb|EEK76438.1| hypothetical protein bcere0009_46940 [Bacillus cereus R309803]
 gi|228624861|gb|EEK81629.1| hypothetical protein bcere0010_47200 [Bacillus cereus ATCC 4342]
 gi|228630240|gb|EEK86890.1| hypothetical protein bcere0011_46710 [Bacillus cereus m1550]
 gi|228635923|gb|EEK92406.1| hypothetical protein bcere0012_46260 [Bacillus cereus BDRD-ST24]
 gi|228641738|gb|EEK98039.1| hypothetical protein bcere0013_47600 [Bacillus cereus BDRD-ST26]
 gi|228653146|gb|EEL09025.1| hypothetical protein bcere0015_46490 [Bacillus cereus BDRD-Cer4]
 gi|228658828|gb|EEL14483.1| hypothetical protein bcere0016_47720 [Bacillus cereus 95/8201]
 gi|228664992|gb|EEL20480.1| hypothetical protein bcere0017_46890 [Bacillus cereus Rock1-3]
 gi|228671043|gb|EEL26349.1| hypothetical protein bcere0018_46350 [Bacillus cereus Rock1-15]
 gi|228677838|gb|EEL32081.1| hypothetical protein bcere0019_46970 [Bacillus cereus Rock3-28]
 gi|228684033|gb|EEL37981.1| hypothetical protein bcere0020_46280 [Bacillus cereus Rock3-29]
 gi|228689267|gb|EEL43086.1| hypothetical protein bcere0021_47700 [Bacillus cereus Rock3-42]
 gi|228701116|gb|EEL53638.1| hypothetical protein bcere0023_48160 [Bacillus cereus Rock4-2]
 gi|228706762|gb|EEL58970.1| hypothetical protein bcere0024_46310 [Bacillus cereus Rock4-18]
 gi|228710417|gb|EEL62390.1| hypothetical protein bcere0025_46020 [Bacillus cereus F65185]
 gi|228716589|gb|EEL68286.1| hypothetical protein bcere0026_46850 [Bacillus cereus AH603]
 gi|228722556|gb|EEL73944.1| hypothetical protein bcere0027_46010 [Bacillus cereus AH676]
 gi|228734878|gb|EEL85516.1| hypothetical protein bcere0029_46920 [Bacillus cereus AH1272]
 gi|228741085|gb|EEL91310.1| hypothetical protein bcere0030_46810 [Bacillus cereus AH1273]
 gi|228747091|gb|EEL96973.1| hypothetical protein bmyco0001_45420 [Bacillus mycoides DSM 2048]
 gi|228771491|gb|EEM19960.1| hypothetical protein bthur0001_48520 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228777799|gb|EEM26071.1| hypothetical protein bthur0002_48460 [Bacillus thuringiensis Bt407]
 gi|228784569|gb|EEM32589.1| hypothetical protein bthur0003_47960 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228791616|gb|EEM39212.1| hypothetical protein bthur0004_48450 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228798494|gb|EEM45486.1| hypothetical protein bthur0005_46480 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228804349|gb|EEM50960.1| hypothetical protein bthur0006_45740 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228810982|gb|EEM57325.1| hypothetical protein bthur0007_47990 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228817452|gb|EEM63537.1| hypothetical protein bthur0008_47490 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228823364|gb|EEM69197.1| hypothetical protein bthur0009_46860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228829656|gb|EEM75282.1| hypothetical protein bthur0010_46580 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228835816|gb|EEM81179.1| hypothetical protein bthur0011_46620 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228842058|gb|EEM87161.1| hypothetical protein bthur0012_47840 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228848741|gb|EEM93586.1| hypothetical protein bthur0013_49320 [Bacillus thuringiensis IBL
           200]
 gi|228856185|gb|EEN00719.1| hypothetical protein bthur0014_46170 [Bacillus thuringiensis IBL
           4222]
 gi|229268485|gb|ACQ50122.1| nifU domain protein [Bacillus anthracis str. A0248]
 gi|296326444|gb|ADH09372.1| NifU protein [Bacillus thuringiensis BMB171]
 gi|300378606|gb|ADK07510.1| nitrogen-fixing NifU domain protein [Bacillus cereus biovar
           anthracis str. CI]
 gi|324328882|gb|ADY24142.1| nitrogen-fixing NifU domain-containing protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
 gi|326942769|gb|AEA18665.1| NifU protein [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 78

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++ EVLD ++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L  
Sbjct: 8   EQVLEVLD-KLRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGIERALLE 66

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 67  EVPGVIEVEQV 77


>gi|254455102|ref|ZP_05068538.1| NifU-like domain protein [Octadecabacter antarcticus 238]
 gi|198263804|gb|EDY88075.1| NifU-like domain protein [Octadecabacter antarcticus 238]
          Length = 419

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 10  NPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-Y 68
           +P TL+FI    V    ++ + +A  +  +PLA  +F+I G+  V      I V +    
Sbjct: 18  DPQTLRFILEAPVQDSTSVCYDDA--SADAPLARALFAISGVQRVEVDGASIYVSRSTDV 75

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNR 128
           DW  L+ P+   I +       ++ +  L   +  +   G+    D+ ++  + E+LD  
Sbjct: 76  DWSALKAPIAVAIRD-------VLDSEALPLGQRSEAPKGE----DALLLLAVAELLDCE 124

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
             PA+A  GG +  +   +  V+L M G C GC ++S TL+ G+  +L   +P + +I
Sbjct: 125 ANPAIASHGGSVAVERVENSDVYLRMSGGCQGCAASSATLRQGIETMLRAGLPAIGEI 182


>gi|78224272|ref|YP_386019.1| nitrogen-fixing NifU-like [Geobacter metallireducens GS-15]
 gi|78195527|gb|ABB33294.1| Nitrogen-fixing NifU-like protein [Geobacter metallireducens GS-15]
          Length = 74

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K+VLD  VRPA+  DGGD+ + +   DG+V + + GAC  CP ++ TLK G+   
Sbjct: 1   MLEEVKKVLDT-VRPALQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERT 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP VK++ +V
Sbjct: 60  LKEKVPGVKEVISV 73


>gi|302389972|ref|YP_003825793.1| nitrogen-fixing NifU domain protein [Thermosediminibacter oceani
           DSM 16646]
 gi|302200600|gb|ADL08170.1| nitrogen-fixing NifU domain protein [Thermosediminibacter oceani
           DSM 16646]
          Length = 74

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI--VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++EVL N++RP++  DGGD+  V      GIV + + G+C GCP ++ TLK G+  +L
Sbjct: 3   EKVQEVL-NKIRPSLQADGGDVELVDVDEEKGIVKVRLTGSCFGCPFSTLTLKNGIEQVL 61

Query: 177 NHFVPEVKDIRTV 189
              VP VK++++V
Sbjct: 62  KEEVPGVKEVQSV 74


>gi|269792680|ref|YP_003317584.1| nitrogen-fixing NifU domain-containing protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100315|gb|ACZ19302.1| nitrogen-fixing NifU domain protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 76

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++IK++++  +RPA+   GGDI FKG+    G+V +++ GAC  CP A ETL+  V  ++
Sbjct: 3   EQIKKLIEEEIRPALQSHGGDIDFKGFDQASGVVTVALTGACGTCPFAQETLRVQVEQVI 62

Query: 177 NHFVPEVKDIR 187
               P V  ++
Sbjct: 63  RRSFPSVTAVK 73


>gi|304317418|ref|YP_003852563.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778920|gb|ADL69479.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 73

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL N +RP++  DGGD+ +     DG+V + + GAC GCP A  TLK G+   + 
Sbjct: 3   ERVEEVL-NLLRPSLQADGGDVELIDVTDDGVVQVKLTGACGGCPFAVMTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 62  EELPEVKEV 70


>gi|154413784|ref|XP_001579921.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
 gi|121914133|gb|EAY18935.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
          Length = 112

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 96  GLGDMKLDDMGSGDFIESDS-AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM 154
           G G+  +         E+D+  + QR+ ++++ +VRP + +D GDI     ++G + + +
Sbjct: 11  GFGNFFIRSFAKEAVKETDADKLFQRVNKIIEEKVRPFIKQDHGDIELVDIKNGCMIVQL 70

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
            GAC GC   + TL  GV   +   +PE+ +IR
Sbjct: 71  EGACEGCGCKNTTLYNGVLGTVQEEIPEITNIR 103


>gi|237752984|ref|ZP_04583464.1| NifU family protein [Helicobacter winghamensis ATCC BAA-430]
 gi|229375251|gb|EEO25342.1| NifU family protein [Helicobacter winghamensis ATCC BAA-430]
          Length = 81

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD+ +++ ++  +D +VRP + +DGG++      +G V++ + GAC GCPS+++TLK+G+
Sbjct: 5   SDTELLKPVEASID-KVRPMLIKDGGNVTLIKIENGKVYVRLEGACKGCPSSTQTLKFGI 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERTLK 68


>gi|317154501|ref|YP_004122549.1| nitrogen-fixing NifU domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944752|gb|ADU63803.1| nitrogen-fixing NifU domain protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 74

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++ +VLD +VRPA+  DGGD+      D GIV + + GAC GCP +  TLK G+  I+ 
Sbjct: 3   EKVMKVLD-KVRPALQGDGGDVELVDITDKGIVQVRLTGACKGCPMSQMTLKNGIERIIL 61

Query: 178 HFVPEVKDIRTV 189
             +PE+K +  V
Sbjct: 62  KEIPEIKGVEAV 73


>gi|198414946|ref|XP_002131248.1| PREDICTED: similar to NFU1 iron-sulfur cluster scaffold homolog
           (HIRA-interacting protein 5) [Ciona intestinalis]
          Length = 201

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 12/182 (6%)

Query: 16  FIPGQVVL---VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD----QY 68
           F PG  VL    E  I + +      SPL  +I  I GI SV      I V K+      
Sbjct: 3   FHPGCPVLHNLNEQKIKYHSRHPCYHSPLVRQIMKIDGIESVTLFTKHIHVQKNTDTLSP 62

Query: 69  DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA--VVQRIKEVLD 126
            W  ++P ++  ++  F S  P   +     +      SG+ +       +   I ++++
Sbjct: 63  QWSSIKPIIVATLINFFASQLPTTTHHQSKRLHYHK-ESGECVAYGKLDDIEYVIDDLIN 121

Query: 127 NRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +R+RP V  +GGD+++K +   +G V++ + G+C   P A+  +      +L + VP V 
Sbjct: 122 SRIRPTVQDEGGDVIYKDFNRGNGTVYVLLLGSCLYTPKATNAITSATLLLLQYHVPCVT 181

Query: 185 DI 186
            +
Sbjct: 182 SV 183


>gi|323488633|ref|ZP_08093875.1| NifU-like protein [Planococcus donghaensis MPA1U2]
 gi|323397651|gb|EGA90455.1| NifU-like protein [Planococcus donghaensis MPA1U2]
          Length = 78

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +++ +  ++ EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 2   TEALLEDQVMEVLD-KLRPFLLRDGGDCELVDIEDGIVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALVEEVPGIVEVEQV 77


>gi|317472464|ref|ZP_07931786.1| NifU domain-containing protein [Anaerostipes sp. 3_2_56FAA]
 gi|316900037|gb|EFV22029.1| NifU domain-containing protein [Anaerostipes sp. 3_2_56FAA]
          Length = 99

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 45/70 (64%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +++ I++VL+  VRP +    G++    Y++GI+ + + G CSGCPSA+ T +  +A  +
Sbjct: 1   MLREIEKVLEEDVRPYLLEHEGNVRISEYKEGILKVRLTGQCSGCPSAALTTEELIAEAV 60

Query: 177 NHFVPEVKDI 186
              +PEVKD+
Sbjct: 61  KKKIPEVKDV 70


>gi|65316943|ref|ZP_00389902.1| COG0694: Thioredoxin-like proteins and domains [Bacillus anthracis
           str. A2012]
          Length = 95

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++ EVLD ++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L  
Sbjct: 8   EQVLEVLD-KLRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGIERALLE 66

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 67  EVPGVIEVEQV 77


>gi|218289813|ref|ZP_03494013.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|258510957|ref|YP_003184391.1| nitrogen-fixing NifU domain-containing protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218240104|gb|EED07289.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|257477683|gb|ACV58002.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 81

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
           RI+E +++ +R A+ +DGGD+ F  Y D    V++S++GAC GCP++  TLK G+   + 
Sbjct: 11  RIREAIES-IREAIQQDGGDVEFVSYDDLSKTVYVSLQGACVGCPASVMTLKMGIERAVK 69

Query: 178 HFVPEVKDIRTV 189
              P+V+ +  V
Sbjct: 70  KVAPDVEYVEAV 81


>gi|313206297|ref|YP_004045474.1| nitrogen-fixing nifu domain protein [Riemerella anatipestifer DSM
           15868]
 gi|312445613|gb|ADQ81968.1| nitrogen-fixing NifU domain protein [Riemerella anatipestifer DSM
           15868]
 gi|315023020|gb|EFT36033.1| Nitrogen-fixing NifU, C-terminal [Riemerella anatipestifer RA-YM]
 gi|325336260|gb|ADZ12534.1| Thioredoxin-like protein [Riemerella anatipestifer RA-GD]
          Length = 78

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E++S  V R++  L++ +RP + +DGGDI      D +V++ + G CSGCP +  T+K 
Sbjct: 1   MENNSLEV-RVENALES-IRPFLNKDGGDIELIKIEDTVVYVKLLGNCSGCPVSFSTMKL 58

Query: 171 GVANILNHFVPEVKDIRTV 189
           GV N +   VPE+  +  V
Sbjct: 59  GVENTVKEKVPEITRVENV 77


>gi|73663148|ref|YP_301929.1| hypothetical protein SSP1839 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72495663|dbj|BAE18984.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 80

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++ EV++ ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  
Sbjct: 11  QVAEVIE-KLRPFLLRDGGDCSLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEE 69

Query: 180 VPEVKDIRTV 189
           VP V ++  V
Sbjct: 70  VPGVIEVEQV 79


>gi|163784585|ref|ZP_02179431.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880146|gb|EDP73804.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 89

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 4/81 (4%)

Query: 112 ESDSAVVQRIK--EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETL 168
           E++ A + R K  EVL+ ++RPA+  DGGD+       DG V++ + GACSGC  +  TL
Sbjct: 3   ENNQATIDRAKVEEVLE-KIRPALRFDGGDVELVDIGEDGTVYVRLMGACSGCAMSLMTL 61

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+   L   +PEVK++  V
Sbjct: 62  KGGIEQRLKQEIPEVKEVVAV 82


>gi|258591187|emb|CBE67482.1| conserved protein of unknown function [NC10 bacterium 'Dutch
           sediment']
          Length = 197

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSG 160
           K+D+  SG + +  +A VQR   V+D R+ P VA  GG +     +DGI +++  G C G
Sbjct: 91  KIDNPNSG-WTDPVAAAVQR---VIDARINPGVAAHGGYVTLLDVKDGIAYITFGGGCHG 146

Query: 161 CPSASETLKYGVANILNHFVPEVKDI 186
           C  A  TLK GVA  +   VPE+  +
Sbjct: 147 CGMADVTLKQGVAVEIQKAVPEIHQV 172


>gi|150016970|ref|YP_001309224.1| NifU domain-containing protein [Clostridium beijerinckii NCIMB
           8052]
 gi|149903435|gb|ABR34268.1| nitrogen-fixing NifU domain protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 93

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++  I  V++ +++P +A   GDI      +G+ ++ + GACSGCPSA  T++  ++ +L
Sbjct: 5   MIDEINNVINTKIKPLLAEHNGDIELVEVNNGVAYVKLLGACSGCPSARFTMEELISCVL 64

Query: 177 NHFVPEVKDIRTV 189
              +PE+KD++ V
Sbjct: 65  KE-IPEIKDVQLV 76


>gi|330837803|ref|YP_004412444.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta
           coccoides DSM 17374]
 gi|329749706|gb|AEC03062.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta
           coccoides DSM 17374]
          Length = 78

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++IKE ++  +RPA+  DGGDI F    D  V + + GAC+GCP A  TLK GV   L+H
Sbjct: 3   EQIKEAIEA-IRPAIQNDGGDIEFVQLDDNKVIVRLTGACAGCPMAKMTLKGGVERYLHH 61

Query: 179 FV 180
            V
Sbjct: 62  AV 63


>gi|212640233|ref|YP_002316753.1| thioredoxin-like protein [Anoxybacillus flavithermus WK1]
 gi|212561713|gb|ACJ34768.1| Thioredoxin-like protein [Anoxybacillus flavithermus WK1]
          Length = 80

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + Q+++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 4   ADQDIKQQVQEVLD-KLRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 62

Query: 173 ANIL 176
              L
Sbjct: 63  ERAL 66


>gi|308070638|ref|YP_003872243.1| thioredoxin-like protein [Paenibacillus polymyxa E681]
 gi|305859917|gb|ADM71705.1| Thioredoxin-like protein [Paenibacillus polymyxa E681]
          Length = 81

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 113 SDSAVVQRIKEVLD--NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           S++  VQ   EV D  +++RP + RDGGD+      DGIV L + GAC  CPS++ TLK 
Sbjct: 2   SETQSVQMYDEVADVLDKLRPFLQRDGGDVELVDVEDGIVKLKLVGACGSCPSSTITLKA 61

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+   L   V  V+++  V
Sbjct: 62  GIERALLEEVDGVQEVVQV 80


>gi|332296888|ref|YP_004438810.1| nitrogen-fixing NifU domain-containing protein [Treponema
           brennaborense DSM 12168]
 gi|332179991|gb|AEE15679.1| nitrogen-fixing NifU domain-containing protein [Treponema
           brennaborense DSM 12168]
          Length = 76

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++K+ LD ++RP +  DGGD+ F     G  VF+ + GAC  CP A+ TLK GV   L  
Sbjct: 6   KVKDALD-KIRPQLQADGGDLEFVSMEAGGKVFVKLTGACGNCPMATMTLKQGVERFLKD 64

Query: 179 FVPEVKDI 186
            +PEV ++
Sbjct: 65  TIPEVTEV 72


>gi|301168132|emb|CBW27720.1| conserved hypothetical protein [Bacteriovorax marinus SJ]
          Length = 85

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 45/70 (64%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++I+ + D +VRPA+A  GG++      +G +F+ + G C GC S+S TLK G+  ++
Sbjct: 1   MIRKIENLFDEQVRPALAAHGGNVEVIDIDNGKLFVKLSGGCQGCSSSSATLKDGIERMV 60

Query: 177 NHFVPEVKDI 186
               PE++++
Sbjct: 61  KQNFPEIEEV 70


>gi|78776531|ref|YP_392846.1| nitrogen-fixing NifU-like protein [Sulfurimonas denitrificans DSM
           1251]
 gi|78497071|gb|ABB43611.1| Nitrogen-fixing NifU-like protein [Sulfurimonas denitrificans DSM
           1251]
          Length = 91

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  ++  ++ V+D +VRP++A D GDI F   ++  V++ ++GAC GC S+  TLKYGV
Sbjct: 5   TDEELMNPVRNVID-KVRPSLALDSGDISFITVKNSKVYIQLKGACVGCASSGTTLKYGV 63

Query: 173 ANILNHFV-PEV 183
              L   + PE+
Sbjct: 64  ERQLKMDIHPEI 75


>gi|302392635|ref|YP_003828455.1| nitrogen-fixing NifU domain protein [Acetohalobium arabaticum DSM
           5501]
 gi|302204712|gb|ADL13390.1| nitrogen-fixing NifU domain protein [Acetohalobium arabaticum DSM
           5501]
          Length = 72

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           +++RP++  DGG +      +G+V + + GAC GCP +  TLK G+  +L   +PEV+ +
Sbjct: 10  DKIRPSLEADGGGVELIDVEEGVVKVKLTGACGGCPMSQMTLKNGIERVLKEEIPEVEKV 69

Query: 187 RTV 189
            +V
Sbjct: 70  ESV 72


>gi|113476915|ref|YP_722976.1| nitrogen-fixing NifU-like protein [Trichodesmium erythraeum IMS101]
 gi|110167963|gb|ABG52503.1| nitrogen-fixing NifU-like [Trichodesmium erythraeum IMS101]
          Length = 80

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (62%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + +RP +A DGG++        IV L ++GACS CPS++ TLK G+   L   +PE
Sbjct: 13  EIVLDELRPYLAADGGNVELVDIEGPIVKLRLQGACSSCPSSTMTLKMGIERKLREEIPE 72

Query: 183 VKDIRTV 189
           + ++ +V
Sbjct: 73  IAEVESV 79


>gi|288574803|ref|ZP_06393160.1| nitrogen-fixing NifU domain protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570544|gb|EFC92101.1| nitrogen-fixing NifU domain protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 77

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
           +++ RI EV+D  +RPA+   GGD+    +    G++   ++GAC  CP A ETL+  V 
Sbjct: 2   SLIDRINEVVDKSIRPALQSHGGDVEVVSFDEESGVISARLQGACGTCPFAQETLRMQVE 61

Query: 174 NILNHFVPEVKDI 186
            +L   +PEV  +
Sbjct: 62  AVLKREIPEVSSV 74


>gi|327439123|dbj|BAK15488.1| thioredoxin-like protein [Solibacillus silvestris StLB046]
          Length = 78

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +++EVLD ++RP + RDGGD       +GIV L + GAC  CPS++ TLK G+   L   
Sbjct: 9   QVQEVLD-KLRPFLLRDGGDCELVDIEEGIVKLRLLGACGSCPSSTITLKAGIERALLEE 67

Query: 180 VPEVKDIRTV 189
           VP + ++  V
Sbjct: 68  VPGIVEVEQV 77


>gi|258405531|ref|YP_003198273.1| nitrogen-fixing NifU domain-containing protein [Desulfohalobium
           retbaense DSM 5692]
 gi|257797758|gb|ACV68695.1| nitrogen-fixing NifU domain protein [Desulfohalobium retbaense DSM
           5692]
          Length = 73

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILN 177
           ++I+  LD +VRP +  DGGDI      D  IV + ++GAC GCP +  TLK GV  +L 
Sbjct: 3   EKIEAALD-KVRPVLQADGGDIELVEITDNNIVRVRLQGACKGCPMSQMTLKNGVERVLL 61

Query: 178 HFVPEVKDIRTV 189
             VPE+K + +V
Sbjct: 62  KEVPEIKGVESV 73


>gi|195952454|ref|YP_002120744.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932066|gb|ACG56766.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 87

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANI 175
            V+ ++E LD  +RPA+  DGGDI       DG V + + GACSGC  ++ TLK GV   
Sbjct: 5   TVEEVEEALDE-IRPALRFDGGDIELVSIEEDGTVLVRLMGACSGCGMSTLTLKAGVERA 63

Query: 176 LNHFVPEVKDIRTV 189
           L    P++K+++ V
Sbjct: 64  LKQKFPDIKEVKDV 77


>gi|300776481|ref|ZP_07086339.1| nitrogen fixation protein NifU [Chryseobacterium gleum ATCC 35910]
 gi|300501991|gb|EFK33131.1| nitrogen fixation protein NifU [Chryseobacterium gleum ATCC 35910]
          Length = 82

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V R+ E L++ +RP + +DGGDI     +D  VF+ + G CSGC     TLK GV N + 
Sbjct: 11  VTRVMEALES-IRPFLNKDGGDIELIDVKDNQVFVKLLGNCSGCSLNFSTLKLGVENTIK 69

Query: 178 HFVPEVKDIRTV 189
              PE++ +  V
Sbjct: 70  QHAPEIEKVINV 81


>gi|154414462|ref|XP_001580258.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
 gi|121914474|gb|EAY19272.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
          Length = 103

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           F ++      ++  V++ RVRPA+  DGGDI  K   DGIV + M G C GCPS   TL 
Sbjct: 18  FAKASKEFFDKVNAVIEERVRPALLSDGGDITLKDITDGIVTVQMFGHCVGCPSKQITLN 77

Query: 170 YGVANILN 177
             + + L 
Sbjct: 78  SRILDCLQ 85


>gi|56421496|ref|YP_148814.1| nitrogen fixation NifU protein [Geobacillus kaustophilus HTA426]
 gi|138896548|ref|YP_001127001.1| nitrogen fixation protein NifU [Geobacillus thermodenitrificans
           NG80-2]
 gi|56381338|dbj|BAD77246.1| nitrogen fixation protein (NifU protein) [Geobacillus kaustophilus
           HTA426]
 gi|134268061|gb|ABO68256.1| Nitrogen fixation protein NifU [Geobacillus thermodenitrificans
           NG80-2]
          Length = 80

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 4   TDQEIKEQVQEVLD-KLRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 62

Query: 173 ANIL 176
              L
Sbjct: 63  ERAL 66


>gi|319760689|ref|YP_004124627.1| Fe/S biogenesis protein nfuA [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039403|gb|ADV33953.1| Fe/S biogenesis protein nfuA [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 202

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           I ++S++  RIK V+  ++ P +A  GG + + K   DG+  L   G C+GC  A  T+K
Sbjct: 112 ITNNSSLTDRIKYVITQQINPQLAMHGGSVSLIKVNTDGMAILQFHGGCNGCSMALYTIK 171

Query: 170 YGVANILNHFVPEVKDI 186
            G+   L  F PE+K +
Sbjct: 172 EGIEKTLKKFFPELKGV 188


>gi|261420397|ref|YP_003254079.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC61]
 gi|297528899|ref|YP_003670174.1| nitrogen-fixing NifU domain protein [Geobacillus sp. C56-T3]
 gi|319768064|ref|YP_004133565.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC52]
 gi|261376854|gb|ACX79597.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC61]
 gi|297252151|gb|ADI25597.1| nitrogen-fixing NifU domain protein [Geobacillus sp. C56-T3]
 gi|317112930|gb|ADU95422.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC52]
          Length = 78

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   TDQEIKEQVQEVLD-KLRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANIL 176
              L
Sbjct: 61  ERAL 64


>gi|239828215|ref|YP_002950839.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70]
 gi|239808508|gb|ACS25573.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70]
          Length = 78

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD ++RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   TDQEIKEQVQEVLD-KLRPFLLRDGGDCELIDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANIL 176
              L
Sbjct: 61  ERAL 64


>gi|323699074|ref|ZP_08110986.1| nitrogen-fixing NifU domain protein [Desulfovibrio sp. ND132]
 gi|323459006|gb|EGB14871.1| nitrogen-fixing NifU domain protein [Desulfovibrio desulfuricans
           ND132]
          Length = 73

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++++ VLD +VRP +  DGGD+      D GIV + + GAC GCP +  TLK G+  I+ 
Sbjct: 3   KKVEAVLD-KVRPMLQGDGGDVELVEVTDNGIVKVRLTGACKGCPMSQMTLKNGIERIIL 61

Query: 178 HFVPEVKDIRTV 189
             +PEVK +  V
Sbjct: 62  KEIPEVKGVEAV 73


>gi|326534082|dbj|BAJ89391.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 216

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++ RDGG++        +V L ++GAC  CPS++ TLK G+ + L  
Sbjct: 68  ENVERVLDE-VRPSLMRDGGNVALHEIDGLVVVLMLQGACGSCPSSTMTLKMGIESRLRD 126

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  +
Sbjct: 127 KIPEILEVEQI 137


>gi|332982274|ref|YP_004463715.1| nitrogen-fixing NifU domain-containing protein [Mahella
           australiensis 50-1 BON]
 gi|332699952|gb|AEE96893.1| nitrogen-fixing NifU domain protein [Mahella australiensis 50-1
           BON]
          Length = 73

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 127 NRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
            ++RPA+  DGGD+ +     DG+V + + GAC  CP A  TLK G+   L   VPEVK+
Sbjct: 10  EKIRPALKADGGDVELVDVASDGVVKVKLTGACGACPFALMTLKQGIEETLKESVPEVKE 69

Query: 186 IRTV 189
           +  V
Sbjct: 70  VVAV 73


>gi|160915579|ref|ZP_02077790.1| hypothetical protein EUBDOL_01587 [Eubacterium dolichum DSM 3991]
 gi|158432699|gb|EDP10988.1| hypothetical protein EUBDOL_01587 [Eubacterium dolichum DSM 3991]
          Length = 76

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++ IK V+ N++RP + RDGGD+ F  + +GIV + + GAC GC S  ET+  G+  IL
Sbjct: 5   IEEIKHVI-NKIRPYIQRDGGDVEFVSFDNGIVAVRLLGACIGCASVDETISGGIEAIL 62


>gi|39995588|ref|NP_951539.1| NifU-like domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982351|gb|AAR33812.1| NifU-like domain protein [Geobacter sulfurreducens PCA]
 gi|298504607|gb|ADI83330.1| thioredoxin/NifU-like domain protein [Geobacter sulfurreducens
           KN400]
          Length = 74

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K+VLD  VRPA+  DGGD+ + +   DG+V + + GAC  CP ++ TLK G+   
Sbjct: 1   MLEDVKKVLD-LVRPALQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERT 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP VK++ +V
Sbjct: 60  LKEKVPGVKEVVSV 73


>gi|83816071|ref|YP_445990.1| hypothetical protein SRU_1878 [Salinibacter ruber DSM 13855]
 gi|294507901|ref|YP_003571959.1| conserved hypothetical protein containing thioredoxin-like domain
           [Salinibacter ruber M8]
 gi|83757465|gb|ABC45578.1| conserved hypothetical protein [Salinibacter ruber DSM 13855]
 gi|294344229|emb|CBH25007.1| conserved hypothetical protein containing thioredoxin-like domain
           [Salinibacter ruber M8]
          Length = 142

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            Q E TPNP +LKF       + G +  +S+A EA   PLA R+F + G+  V+    F+
Sbjct: 55  TQAESTPNPNSLKFTTDDGPFLSGGVAAYSSADEAAEDPLARRLFGVSGVDDVFITPQFV 114

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHF 85
           TV K    DW  ++P V  ++ EH 
Sbjct: 115 TVSKAPSVDWGSVKPDVETILAEHL 139


>gi|90021654|ref|YP_527481.1| hypothetical protein Sde_2009 [Saccharophagus degradans 2-40]
 gi|89951254|gb|ABD81269.1| HesB/YadR/YfhF [Saccharophagus degradans 2-40]
          Length = 203

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPSASETLK 169
           I  DS +  RI  VL N V P +A  GG++  +   D + + L   G C GC +   TLK
Sbjct: 113 ITEDSTIEDRINYVLYNEVNPGLAAHGGNVSLEAITDDMHIVLKFGGGCQGCSAVDMTLK 172

Query: 170 YGVANILNHFVPEVKDIR 187
            GV   L   VPE+K +R
Sbjct: 173 QGVEKTLMERVPEIKGVR 190


>gi|134300123|ref|YP_001113619.1| NifU domain-containing protein [Desulfotomaculum reducens MI-1]
 gi|134052823|gb|ABO50794.1| nitrogen-fixing NifU domain protein [Desulfotomaculum reducens
           MI-1]
          Length = 74

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++KE L+ +VRP + RDGGD+ F    + G+V + +RGAC  CP A  TLK G+  +L 
Sbjct: 3   EQVKEALE-QVRPFLQRDGGDVEFVDCDEKGVVKVKLRGACGSCPGALYTLKNGIERVLK 61

Query: 178 HFVPEVKDI 186
             VP V ++
Sbjct: 62  QQVPGVTEV 70


>gi|57233705|ref|YP_182326.1| NifU-like protein [Dehalococcoides ethenogenes 195]
 gi|57224153|gb|AAW39210.1| NifU-like protein [Dehalococcoides ethenogenes 195]
          Length = 72

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++++ VLD ++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL
Sbjct: 1   MLEKVEAVLD-KIRPALEADGGNVELVEVVDGVVKVKLVGACAGCPMSTMTLKNGIEKIL 59

Query: 177 NHFVPEVKDI 186
              +PEVK++
Sbjct: 60  KREIPEVKEV 69


>gi|257064210|ref|YP_003143882.1| thioredoxin-like protein [Slackia heliotrinireducens DSM 20476]
 gi|256791863|gb|ACV22533.1| thioredoxin-like protein [Slackia heliotrinireducens DSM 20476]
          Length = 76

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +RI+ VL+  +RP++  DGGD+       DG+V + + GAC+GCP +  TL  GV  +L 
Sbjct: 6   ERIERVLE-LIRPSLQADGGDLELVDVGDDGVVTVHLTGACNGCPLSQLTLANGVRRVLK 64

Query: 178 HFVPEVKDIRTV 189
             VP V D+R V
Sbjct: 65  ERVPSVTDVRAV 76


>gi|319650406|ref|ZP_08004549.1| nitrogen-fixing NifU-like protein [Bacillus sp. 2_A_57_CT2]
 gi|317397967|gb|EFV78662.1| nitrogen-fixing NifU-like protein [Bacillus sp. 2_A_57_CT2]
          Length = 79

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           + + ++++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+  
Sbjct: 5   TTMTEQVQEVLD-KLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIER 63

Query: 175 IL 176
            L
Sbjct: 64  AL 65


>gi|77919925|ref|YP_357740.1| NifU-like protein [Pelobacter carbinolicus DSM 2380]
 gi|77546008|gb|ABA89570.1| NifU-like protein [Pelobacter carbinolicus DSM 2380]
          Length = 103

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACS 159
           +LDD G     E       ++ E+LD ++RP++  DGGD+ +     DG+V + ++GAC 
Sbjct: 20  ELDDKGRCQMKE-------QVLEILD-KIRPSLQADGGDVELVDISEDGVVKVRLKGACG 71

Query: 160 GCPSASETLKYGVANILNHFVPEVKDI 186
            CP ++ TLK G+   L   VP VK++
Sbjct: 72  SCPMSTMTLKMGIERTLKAQVPGVKEV 98


>gi|57168801|ref|ZP_00367932.1| nifU protein homolog Cj1639 [Campylobacter coli RM2228]
 gi|305432457|ref|ZP_07401619.1| NifU family protein [Campylobacter coli JV20]
 gi|57019848|gb|EAL56531.1| nifU protein homolog Cj1639 [Campylobacter coli RM2228]
 gi|304444496|gb|EFM37147.1| NifU family protein [Campylobacter coli JV20]
          Length = 90

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  LD  + P + RDGG + F G ++G+V++ + GAC GC S+  TLKYG+
Sbjct: 5   SDEELINPVKASLDKSM-PMLERDGGGLEFLGIKNGVVYVHLIGACKGCASSGTTLKYGL 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|328953813|ref|YP_004371147.1| nitrogen-fixing NifU domain-containing protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454137|gb|AEB09966.1| nitrogen-fixing NifU domain-containing protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 72

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           ++RP + RDGGD+       G+V + + GAC GCP +  TLK G+  +L   VP +  + 
Sbjct: 11  KIRPMLQRDGGDVELVEVEHGVVKVKLTGACKGCPMSQMTLKNGIERLLKQEVPGIVSVE 70

Query: 188 TV 189
           +V
Sbjct: 71  SV 72


>gi|307266231|ref|ZP_07547773.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326390563|ref|ZP_08212119.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           JW 200]
 gi|306918761|gb|EFN48993.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325993388|gb|EGD51824.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 73

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL+  +RP++  DGG++ +     DGIV + + GAC GCP A+ TLK G+   + 
Sbjct: 3   ERVEEVLE-LLRPSLQADGGNVELIDVTEDGIVKVRLTGACGGCPFATLTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEV+++
Sbjct: 62  EEIPEVREV 70


>gi|4558563|gb|AAD22656.1|AC007138_20 putative NifU-like metallocluster assembly factor [Arabidopsis
           thaliana]
 gi|7268578|emb|CAB80687.1| putative NifU-like metallocluster assembly factor [Arabidopsis
           thaliana]
          Length = 174

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q +  VL++ VRP +  DGG++      DG+V L ++GAC+ CPS+S T+  G+  +L  
Sbjct: 87  QNVDLVLED-VRPFLISDGGNVDVVSVEDGVVSLKLQGACTSCPSSSTTMTMGIERVLKE 145

Query: 179 -FVPEVKDIRTV 189
            F   +KDIR V
Sbjct: 146 KFGDALKDIRQV 157


>gi|123434403|ref|XP_001308803.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
 gi|121890501|gb|EAX95873.1| NifU-like domain containing protein [Trichomonas vaginalis G3]
          Length = 114

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 45/71 (63%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + +R+ ++++ +VRP +  +GGDI     ++G + +S+ GAC+ C S + TL  GV   +
Sbjct: 34  LFKRVNKIIEEKVRPFIRSEGGDIELVDIKNGCMIVSLEGACTHCGSKNNTLYNGVLGAV 93

Query: 177 NHFVPEVKDIR 187
              +PE+++IR
Sbjct: 94  QDEIPEIENIR 104


>gi|296272309|ref|YP_003654940.1| nitrogen-fixing NifU domain-containing protein [Arcobacter
           nitrofigilis DSM 7299]
 gi|296096483|gb|ADG92433.1| nitrogen-fixing NifU domain protein [Arcobacter nitrofigilis DSM
           7299]
          Length = 92

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +   +K ++DN++ P +A+DGG +     ++G VF+ + GAC GC ++  TLKY V
Sbjct: 5   SDEDLFPVVKNIIDNKIAPMLAQDGGAMTLLDVKNGKVFVQLNGACVGCSASGSTLKYVV 64


>gi|241890053|ref|ZP_04777351.1| Fe/S biogenesis protein NfuA [Gemella haemolysans ATCC 10379]
 gi|241863675|gb|EER68059.1| Fe/S biogenesis protein NfuA [Gemella haemolysans ATCC 10379]
          Length = 84

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V++IK  L+ ++RP +  DGG+I F  Y+DGI+ +   G C+ C  +  TLKY +   L 
Sbjct: 9   VEKIKFELE-KIRPKLIMDGGNIEFINYKDGILKVRFLGECAHCELSHITLKYAIEKTLI 67

Query: 178 HFVPEVKDIRTV 189
             +PE+K +  V
Sbjct: 68  EKIPEIKKVLQV 79


>gi|167747967|ref|ZP_02420094.1| hypothetical protein ANACAC_02699 [Anaerostipes caccae DSM 14662]
 gi|167652617|gb|EDR96746.1| hypothetical protein ANACAC_02699 [Anaerostipes caccae DSM 14662]
          Length = 116

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (61%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +++ I++VL+  VRP +    G++    Y++GI+ + + G C GCPSA+ T +  +A  +
Sbjct: 18  MLREIEKVLEEDVRPYLLEHEGNVRISEYKEGILKVRLTGQCCGCPSAALTTEELIAEAV 77

Query: 177 NHFVPEVKDIRTV 189
              +PEVKD+  V
Sbjct: 78  KKKIPEVKDVVLV 90


>gi|18411785|ref|NP_567219.1| NFU1; structural molecule [Arabidopsis thaliana]
 gi|75163233|sp|Q93W77|NIFU1_ARATH RecName: Full=NifU-like protein 1, chloroplastic; Short=AtCNfu1;
           Short=AtCnfU-IVb; Flags: Precursor
 gi|14517434|gb|AAK62607.1| AT4g01940/T7B11_20 [Arabidopsis thaliana]
 gi|15215670|gb|AAK91380.1| AT4g01940/T7B11_20 [Arabidopsis thaliana]
 gi|20908090|gb|AAM26728.1| AT4g01940/T7B11_20 [Arabidopsis thaliana]
 gi|28207816|emb|CAD55558.1| NFU1 protein [Arabidopsis thaliana]
 gi|332656703|gb|AEE82103.1| NifU-like protein 1 [Arabidopsis thaliana]
          Length = 231

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q +  VL++ VRP +  DGG++      DG+V L ++GAC+ CPS+S T+  G+  +L  
Sbjct: 88  QNVDLVLED-VRPFLISDGGNVDVVSVEDGVVSLKLQGACTSCPSSSTTMTMGIERVLKE 146

Query: 179 -FVPEVKDIRTV 189
            F   +KDIR V
Sbjct: 147 KFGDALKDIRQV 158


>gi|90416073|ref|ZP_01224006.1| yhgI protein [marine gamma proteobacterium HTCC2207]
 gi|90332447|gb|EAS47644.1| yhgI protein [marine gamma proteobacterium HTCC2207]
          Length = 193

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +  DS +  RI  +L N + P +A  GG +      +G   L   G C GC + S TLK 
Sbjct: 104 VNDDSPIEDRINYLLYNEINPGLASHGGVVSLSEMDEGFAVLEFGGGCQGCSAVSMTLKE 163

Query: 171 GVANILNHFVPEVKDIRTV 189
           GV   L   +PE+K +R V
Sbjct: 164 GVEKTLMEKIPELKGVRDV 182


>gi|313675047|ref|YP_004053043.1| nitrogen-fixing nifu domain protein [Marivirga tractuosa DSM 4126]
 gi|312941745|gb|ADR20935.1| nitrogen-fixing NifU domain protein [Marivirga tractuosa DSM 4126]
          Length = 91

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V+ RI++ LD+ +RP +  DGG++      +G++ L + GAC  CP ++ TLK GV   +
Sbjct: 3   VLDRIEKALDS-IRPYLEADGGNVRILDLNEGVLRLELLGACGNCPMSTMTLKAGVEEAV 61

Query: 177 NHFVPEVKDIRTV 189
              VPEV  +  V
Sbjct: 62  KKSVPEVTSVEAV 74


>gi|297627112|ref|YP_003688875.1| NifU-like protein [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296922877|emb|CBL57457.1| NifU-like protein [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 190

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 81/198 (40%), Gaps = 36/198 (18%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPG--------IA 52
           + +  E T +PATL+++    +L                P A  + S PG        ++
Sbjct: 18  IALHPEATDDPATLRWVVSHHIL----------------PFAGTLASAPGLDDLLADRVS 61

Query: 53  SVYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
            V  G D + V      DW  L P V   +M      D  +   G  D ++        +
Sbjct: 62  RVVVGPDTLLVTLAPGSDWAELGPVVRRALMRALGHTDAWV---GAADARV--------L 110

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
             D A+     E+++  +       GG I   G +DG+V + M GAC GCP+A  T+   
Sbjct: 111 SGDDALGVCADELIEGPIGDIARAHGGHIALAGVQDGVVTVKMSGACRGCPAAVITMHQR 170

Query: 172 VANILNHFVPEVKDIRTV 189
           + + L   VP + D+R++
Sbjct: 171 LEHQLRRRVPGLVDVRSI 188


>gi|331006512|ref|ZP_08329811.1| hypothetical protein IMCC1989_384 [gamma proteobacterium IMCC1989]
 gi|330419680|gb|EGG94047.1| hypothetical protein IMCC1989_384 [gamma proteobacterium IMCC1989]
          Length = 193

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG-YRDGIVFLSMRGACSGCPSASETLK 169
           +  DS V  RI  VL N V P +A  GG +  +    DG   L   G C GC + S TLK
Sbjct: 103 VNDDSPVEDRINYVLYNEVNPGLASHGGQVDLEDVTEDGFAILKFGGGCQGCSAVSLTLK 162

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   VPE+K ++ V
Sbjct: 163 EGVEKTLLEKVPELKGVKDV 182


>gi|288818297|ref|YP_003432645.1| NifU-like protein [Hydrogenobacter thermophilus TK-6]
 gi|288787697|dbj|BAI69444.1| NifU-like protein [Hydrogenobacter thermophilus TK-6]
 gi|308751894|gb|ADO45377.1| nitrogen-fixing NifU domain protein [Hydrogenobacter thermophilus
           TK-6]
          Length = 87

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + I+ VLD  +RPA+  DGGD+ +     DG V + M GACSGC  +  TLK G+   L 
Sbjct: 7   EEIEAVLDE-IRPALRFDGGDVELVDVLEDGTVLVRMMGACSGCGMSVLTLKAGIERALK 65

Query: 178 HFVPEVKDIRTV 189
           +  PE+K+++ +
Sbjct: 66  NKFPEIKEVKDI 77


>gi|309776492|ref|ZP_07671474.1| NifU domain protein [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915720|gb|EFP61478.1| NifU domain protein [Erysipelotrichaceae bacterium 3_1_53]
          Length = 76

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +  IK+ ++ ++RP + RDGGD+ F  + DGIV + + GAC GC S  +T++ G+  IL 
Sbjct: 5   IDEIKQTIE-KIRPYIQRDGGDVEFVSFEDGIVGVRLLGACVGCMSIDDTIQGGIEAILL 63

Query: 178 HFVPEVKDIRTV 189
             V  V  +R V
Sbjct: 64  DEVDGVSGVRLV 75


>gi|220931159|ref|YP_002508067.1| nitrogen-fixing NifU domain protein [Halothermothrix orenii H 168]
 gi|219992469|gb|ACL69072.1| nitrogen-fixing NifU domain protein [Halothermothrix orenii H 168]
          Length = 74

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +++RP++  DGGD+      D  GIV + + GAC GCP ++ T+K G+  +L   VP VK
Sbjct: 10  DKIRPSLQADGGDVKLVDVDDEKGIVKVKLLGACQGCPMSTMTIKNGIERVLKEKVPGVK 69

Query: 185 DIRTV 189
           +++ V
Sbjct: 70  EVKPV 74


>gi|323704659|ref|ZP_08116237.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536121|gb|EGB25894.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 73

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R++EVL   +RP++  DGGD+ +     DG+V + + GAC GCP A  TLK G+   + 
Sbjct: 3   ERVEEVL-KLLRPSLQADGGDVELVDVTDDGVVQVRLTGACGGCPFAVMTLKEGIERAIK 61

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 62  EEIPEVKEV 70


>gi|302335395|ref|YP_003800602.1| nitrogen-fixing NifU domain protein [Olsenella uli DSM 7084]
 gi|301319235|gb|ADK67722.1| nitrogen-fixing NifU domain protein [Olsenella uli DSM 7084]
          Length = 85

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKY 170
           E+ + + + + E   + +R ++  DGGD+   G+ D G+V L M+GAC+GCP +S  +  
Sbjct: 4   ETKTPINRELLEATLDVIRQSLQADGGDVALVGFNDEGVVTLEMQGACAGCPLSSLDMSE 63

Query: 171 GVANILNHFVPEVKDIR 187
           G+  IL   VP V  + 
Sbjct: 64  GIERILKEHVPGVTKVE 80


>gi|57238650|ref|YP_179781.1| NifU family protein [Campylobacter jejuni RM1221]
 gi|121612278|ref|YP_001001282.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|148925779|ref|ZP_01809467.1| nifU protein like protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|153951478|ref|YP_001398916.1| NifU family protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|167006176|ref|ZP_02271934.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|218563228|ref|YP_002345008.1| NifU protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|283957025|ref|ZP_06374497.1| NifU family protein [Campylobacter jejuni subsp. jejuni 1336]
 gi|2960001|emb|CAA76497.1| hypothetical protein [Campylobacter jejuni]
 gi|57167454|gb|AAW36233.1| NifU family protein [Campylobacter jejuni RM1221]
 gi|112360935|emb|CAL35736.1| NifU protein homolog [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|121504156|gb|EAQ72687.2| NifU family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|145845789|gb|EDK22880.1| nifU protein like protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|152938924|gb|ABS43665.1| NifU family protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|283791526|gb|EFC30323.1| NifU family protein [Campylobacter jejuni subsp. jejuni 1336]
 gi|284926833|gb|ADC29185.1| NifU family protein [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315059089|gb|ADT73418.1| NifU-like protein [Campylobacter jejuni subsp. jejuni S3]
 gi|315927611|gb|EFV06942.1| nifU-like domain protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 90

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  L+  + P + RDGG + F G ++GIV++ + GAC GC S+  TLKYG+
Sbjct: 5   SDEELINPVKASLEKSL-PMLERDGGGLEFLGIKNGIVYVHLIGACKGCASSGTTLKYGL 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|255548369|ref|XP_002515241.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223545721|gb|EEF47225.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 210

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-FVPEVKDIR 187
           VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +L   F   VKDIR
Sbjct: 76  VRPYLIADGGNVDVVSVEDGVISLQLQGACGSCPSSTTTMKMGIERVLKEKFGDSVKDIR 135

Query: 188 TV 189
            V
Sbjct: 136 QV 137


>gi|301064688|ref|ZP_07205077.1| NifU-like protein [delta proteobacterium NaphS2]
 gi|300441230|gb|EFK05606.1| NifU-like protein [delta proteobacterium NaphS2]
          Length = 75

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++++ L+ +VRP++  DGGD+       +G+V + + GAC GCP +  TLK G+  +L 
Sbjct: 5   EKVQDALE-KVRPSLQADGGDVQLVDVDANGLVKVKLTGACGGCPMSQMTLKMGIEKVLK 63

Query: 178 HFVPEVKDIRT 188
             VPEV  + +
Sbjct: 64  QNVPEVTSVES 74


>gi|188996345|ref|YP_001930596.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931412|gb|ACD66042.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 79

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           Q+++EVL+ +VRP +  DGGD+       DG V++ + GACSGC  +  TLK GV   L 
Sbjct: 6   QKVEEVLE-QVRPYLRFDGGDVELVDVGEDGTVYVRLMGACSGCHMSLWTLKGGVETRLK 64

Query: 178 HFVPEVKDI 186
             +PEVK++
Sbjct: 65  QAIPEVKEV 73


>gi|116748860|ref|YP_845547.1| NifU domain-containing protein [Syntrophobacter fumaroxidans MPOB]
 gi|116697924|gb|ABK17112.1| nitrogen-fixing NifU domain protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 72

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++++E L  ++RP + RDGG +     +  +V + + GAC GCP +  TLK G+  ++  
Sbjct: 3   KKVEEAL-AKIRPMLERDGGSVELVDVQGTVVKVRLTGACHGCPMSQMTLKAGIERVVKE 61

Query: 179 FVPEVKDIRTV 189
            VPEV ++++V
Sbjct: 62  NVPEVTEVQSV 72


>gi|302848639|ref|XP_002955851.1| hypothetical protein VOLCADRAFT_96828 [Volvox carteri f.
           nagariensis]
 gi|300258819|gb|EFJ43052.1| hypothetical protein VOLCADRAFT_96828 [Volvox carteri f.
           nagariensis]
          Length = 540

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V+ ++  L+  VRP +  DGGD+     +DGIV+L ++GACS CPS S T+K G+  ++
Sbjct: 396 TVEAVQAALEE-VRPYLMADGGDVEVVEVKDGIVYLRLQGACSSCPSQSATMKGGIERVI 454

Query: 177 NH-FVPEVKDI 186
              F  +V DI
Sbjct: 455 RQTFGDQVIDI 465


>gi|86149351|ref|ZP_01067582.1| NifU family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86152315|ref|ZP_01070526.1| NifU family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86152773|ref|ZP_01070978.1| NifU family protein [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88596032|ref|ZP_01099269.1| NifU family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|85840133|gb|EAQ57391.1| NifU family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85840804|gb|EAQ58055.1| NifU family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85843658|gb|EAQ60868.1| NifU family protein [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88190873|gb|EAQ94845.1| NifU family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|315928875|gb|EFV08137.1| nifU-like domain protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 89

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  L+  + P + RDGG + F G ++GIV++ + GAC GC S+  TLKYG+
Sbjct: 4   SDEELINPVKASLEKSL-PMLERDGGGLEFLGIKNGIVYVHLIGACKGCASSGTTLKYGL 62

Query: 173 ANILN 177
              L 
Sbjct: 63  ERQLK 67


>gi|315187331|gb|EFU21087.1| nitrogen-fixing NifU domain protein [Spirochaeta thermophila DSM
           6578]
          Length = 74

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 127 NRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           N +RPA+  DGGDI + +    G+V + + GAC GCP +  TLK GV   L   +PE+  
Sbjct: 11  NEIRPALKADGGDIQLLEVTEQGVVKVRLTGACHGCPMSQITLKQGVEAYLKRKLPEISS 70

Query: 186 IRTV 189
           +  V
Sbjct: 71  VEAV 74


>gi|117924033|ref|YP_864650.1| NifU domain-containing protein [Magnetococcus sp. MC-1]
 gi|117607789|gb|ABK43244.1| nitrogen-fixing NifU domain protein [Magnetococcus sp. MC-1]
          Length = 76

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +RP + RDGGD+ F     D +V + +RGAC  CP A  TLK G+  ++   +PEV  + 
Sbjct: 12  IRPMLQRDGGDVEFVDLTEDNVVQVRLRGACGSCPGAMMTLKGGIERLMKERIPEVHSVE 71

Query: 188 TV 189
            V
Sbjct: 72  NV 73


>gi|328949227|ref|YP_004366564.1| nitrogen-fixing NifU domain-containing protein [Treponema
           succinifaciens DSM 2489]
 gi|328449551|gb|AEB15267.1| nitrogen-fixing NifU domain-containing protein [Treponema
           succinifaciens DSM 2489]
          Length = 78

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGV 172
           D A++ ++KE L+   RP +  DGGD+ F    D   V L + GAC  CP A+ TLK G+
Sbjct: 3   DEALIAKVKETLE-AFRPQLNADGGDMEFINIDDENKVHLKLTGACGSCPMATMTLKMGI 61

Query: 173 ANILNHFVPEVKDI 186
              L    PE+ ++
Sbjct: 62  ERYLKETCPEISEV 75


>gi|152990000|ref|YP_001355722.1| hypothetical protein NIS_0251 [Nitratiruptor sp. SB155-2]
 gi|151421861|dbj|BAF69365.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 100

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +   +++V++ +++P +A DGGDI   G ++G VF+ + GAC GC ++  TLKYGV
Sbjct: 6   SDEDLYPAVEKVIE-KIKPMLALDGGDIKLLGVKNGRVFVQLGGACVGCSASGNTLKYGV 64

Query: 173 ANILN 177
              L 
Sbjct: 65  ERQLK 69


>gi|310643822|ref|YP_003948580.1| nifu-like protein [Paenibacillus polymyxa SC2]
 gi|309248772|gb|ADO58339.1| NifU-like protein [Paenibacillus polymyxa SC2]
          Length = 81

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 113 SDSAVVQRIKEVLD--NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           S++  VQ   EV D  +++RP + RDGGD+      DGIV L + GAC  CPS++ TLK 
Sbjct: 2   SEAQSVQMYDEVADVLDKLRPFLQRDGGDVELVDVEDGIVKLKLVGACGSCPSSTITLKA 61

Query: 171 GVANIL 176
           G+   L
Sbjct: 62  GIERAL 67


>gi|293402218|ref|ZP_06646356.1| NifU domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304325|gb|EFE45576.1| NifU domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 78

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            ++RP + RDGGD+ +  + DGIV + + GAC GC S  +TLK G+  I+   V  V ++
Sbjct: 13  EKIRPYIQRDGGDVEYVSFTDGIVRVRLLGACVGCMSIGDTLKDGIEAIIMDEVAGVSEV 72

Query: 187 R 187
           R
Sbjct: 73  R 73


>gi|225848086|ref|YP_002728249.1| hypothetical protein SULAZ_0254 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643275|gb|ACN98325.1| conserved domain protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 79

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           Q+++EVL+ +VRP +  DGGD+ +     DG V++ + G+CSGC  +  TLK GV   L 
Sbjct: 6   QKVEEVLE-QVRPYLRFDGGDVELVDVSEDGTVYVRLMGSCSGCAMSLWTLKGGVEARLK 64

Query: 178 HFVPEVKDIRTV 189
             +PEVK++  V
Sbjct: 65  QAIPEVKEVVAV 76


>gi|237756555|ref|ZP_04585079.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691283|gb|EEP60367.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 78

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           Q+++EVL+ +VRP +  DGGD+       DG V++ + GACSGC  +  TLK GV   L 
Sbjct: 6   QKVEEVLE-QVRPYLRFDGGDVELVDVGEDGTVYVRLMGACSGCHMSLWTLKGGVEARLK 64

Query: 178 HFVPEVKDIRTV 189
             +PEVK++  V
Sbjct: 65  QAIPEVKEVVAV 76


>gi|2688826|gb|AAB88877.1| putative NifU protein [Prunus armeniaca]
          Length = 76

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-FVPEVKDIR 187
           VRP +  DGGD+      DG+V L ++GAC  CPS++ T+K G+  +L   F   +KDI+
Sbjct: 14  VRPYLIADGGDVDVVSVEDGVVSLKLQGACGSCPSSTTTMKMGIERVLKEKFGDALKDIQ 73

Query: 188 TV 189
            V
Sbjct: 74  QV 75


>gi|148263012|ref|YP_001229718.1| NifU domain-containing protein [Geobacter uraniireducens Rf4]
 gi|146396512|gb|ABQ25145.1| nitrogen-fixing NifU domain protein [Geobacter uraniireducens Rf4]
          Length = 73

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K+VLD  +RP +  DGGD+ + +   DG+V + + GAC  CP ++ TLK G+   
Sbjct: 1   MIEEVKKVLD-LIRPNLQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERT 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP VK++ +V
Sbjct: 60  LKEKVPGVKEVISV 73


>gi|57505611|ref|ZP_00371538.1| NifU domain protein [Campylobacter upsaliensis RM3195]
 gi|57016158|gb|EAL52945.1| NifU domain protein [Campylobacter upsaliensis RM3195]
          Length = 90

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 2/75 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K+ L+  + P + RDGG + F G ++GIV++ + GAC GC S+S TLKY +
Sbjct: 5   SDEELINPVKKSLEKSL-PILERDGGGLEFLGVKNGIVYVHLIGACKGCASSSITLKYSL 63

Query: 173 ANILNHFV-PEVKDI 186
              L   + PE+  I
Sbjct: 64  ERQLKMDIHPEISII 78


>gi|294660416|ref|NP_853167.2| hypothetical protein MGA_0005 [Mycoplasma gallisepticum str.
           R(low)]
 gi|284812075|gb|AAP56735.2| conserved hypothetical protein [Mycoplasma gallisepticum str.
           R(low)]
 gi|284930649|gb|ADC30588.1| conserved hypothetical protein [Mycoplasma gallisepticum str.
           R(high)]
          Length = 99

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%)

Query: 133 VARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           + RDGGD+ F+GY  GIV + + G C GC     T K GV  IL   +PEVK +
Sbjct: 23  IKRDGGDLSFEGYEKGIVTIKLLGNCDGCSLVDMTYKDGVETILKAEIPEVKSV 76


>gi|290967833|ref|ZP_06559386.1| NifU-like protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290782192|gb|EFD94767.1| NifU-like protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 94

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 43/68 (63%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +++ +L  ++RP++   GG++    Y DGI+ + + G CSGCPSA+ T +  +  I+   
Sbjct: 6   QLETLLAEKIRPSLQAHGGNVEIISYTDGILRIRLTGRCSGCPSATLTTEEFINQIVQTA 65

Query: 180 VPEVKDIR 187
            P+V+++R
Sbjct: 66  FPDVREVR 73


>gi|256372488|ref|YP_003110312.1| nitrogen-fixing NifU domain protein [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256009072|gb|ACU54639.1| nitrogen-fixing NifU domain protein [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 204

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S + +R+  +L  +V PA+A  GG     G  D + ++ M G C GC  AS TL  G+A 
Sbjct: 114 SDLARRVDSILQEQVNPAIAAHGGYAELVGVVDEVAYVLMGGGCQGCGLASATLTQGIAV 173

Query: 175 ILNHFVPEVKDI 186
            +   VPE++D+
Sbjct: 174 AIRDAVPEIRDV 185


>gi|157415859|ref|YP_001483115.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386823|gb|ABV53138.1| NifU-like protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748496|gb|ADN91766.1| NifU family protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315931685|gb|EFV10646.1| nifU-like domain protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 90

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  L+  + P + RDGG + F G ++G+V++ + GAC GC S+  TLKYG+
Sbjct: 5   SDEELINPVKASLEKSL-PMLERDGGGLEFLGIKNGVVYVHLIGACKGCASSGTTLKYGL 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|218886099|ref|YP_002435420.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757053|gb|ACL07952.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 77

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           A+ +R++  LD +VRP +  DGGD+ + +   DG+V + + GAC GCP + +TLK GV  
Sbjct: 4   AIHERVQAALD-KVRPYLQGDGGDVELVEITADGVVRVRLTGACKGCPMSQQTLKGGVER 62

Query: 175 ILNHFVPEVKDIRTV 189
           ++   V EVK +  V
Sbjct: 63  MVLKEVAEVKRVEAV 77


>gi|291333447|gb|ADD93149.1| nitrogen fixing NifU-like protein [uncultured archaeon
           MedDCM-OCT-S05-C57]
          Length = 160

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 14/147 (9%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I+ E T +P   +F+    VL    + F    +   +PLA R+ ++P IA V      +T
Sbjct: 8   IRGEPTADPQKCRFVLEAEVLSRSPVSFDRESDTSKAPLAERLLALPYIAGVSISGSAVT 67

Query: 63  VGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +  D  + W  +   + G+I E   +G+P +        ++ D+G  D          ++
Sbjct: 68  LTGDNVESWPAIGKEIGGVIREQIKTGEPAVEE------EVMDIGDADLF-------TQV 114

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDG 148
             ++ N V P++A  GG I      DG
Sbjct: 115 NLLIKNDVNPSIASHGGTITLHSVNDG 141


>gi|205355651|ref|ZP_03222421.1| NifU protein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346428|gb|EDZ33061.1| NifU protein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 90

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  L+  + P + RDGG + F G ++GIV++ + GAC GC S+  TLKYG+
Sbjct: 5   SDEELINPVKASLEKSL-PMLERDGGGLEFLGIKNGIVYVHLIGACKGCVSSGTTLKYGL 63


>gi|224064633|ref|XP_002301529.1| predicted protein [Populus trichocarpa]
 gi|222843255|gb|EEE80802.1| predicted protein [Populus trichocarpa]
          Length = 216

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q +  VL+  VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +L  
Sbjct: 73  QNVDLVLE-EVRPYLIADGGNVDVVSVEDGVISLKLQGACGDCPSSTTTMKMGIERVLKE 131

Query: 179 -FVPEVKDIRTV 189
            F   +KDIR V
Sbjct: 132 KFGDAIKDIRQV 143


>gi|254422508|ref|ZP_05036226.1| hypothetical protein S7335_2660 [Synechococcus sp. PCC 7335]
 gi|196189997|gb|EDX84961.1| hypothetical protein S7335_2660 [Synechococcus sp. PCC 7335]
          Length = 79

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L  F+
Sbjct: 11  VEKVLDE-LRPYLMADGGNVELVELDGPIVKLRLQGACGSCPSSAMTLRMGIERRLREFI 69

Query: 181 PEVKDIRTV 189
           PE+ +I  V
Sbjct: 70  PEIAEIEQV 78


>gi|257459224|ref|ZP_05624343.1| NifU family protein [Campylobacter gracilis RM3268]
 gi|257443609|gb|EEV18733.1| NifU family protein [Campylobacter gracilis RM3268]
          Length = 88

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  ++  +++ L+  +RP +  DGGD+   G ++G+V++ + G C GC ++S+TLKYGV
Sbjct: 5   TDEELLAPVQDSLE-LIRPMLQNDGGDMKLLGIKNGVVYVRLTGHCHGCAASSQTLKYGV 63

Query: 173 ANIL 176
              L
Sbjct: 64  ERQL 67


>gi|206890081|ref|YP_002249266.1| thioredoxin family protein [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742019|gb|ACI21076.1| thioredoxin family protein [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 74

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++++VL  ++R  +  DGG+I     +D IV++ ++GAC  CP A+ TLK  V   L   
Sbjct: 6   KVEQVL-GKIRVGLMADGGNIDLVDIKDNIVYVKLKGACGTCPMATLTLKNWVEKTLKSE 64

Query: 180 VPEVKDIRTV 189
           +PEVK++  V
Sbjct: 65  IPEVKEVVAV 74


>gi|118578775|ref|YP_900025.1| NifU domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118501485|gb|ABK97967.1| nitrogen-fixing NifU domain protein [Pelobacter propionicus DSM
           2379]
          Length = 74

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 128 RVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           +VRPA+  DGGD+ + +   DGIV + ++GAC  CP ++ TLK G+   +   +P VK++
Sbjct: 11  QVRPALQADGGDVELVEVTADGIVKVRLKGACGSCPMSTMTLKMGIERAMKEQIPAVKEV 70

Query: 187 RTV 189
             V
Sbjct: 71  VQV 73


>gi|218438992|ref|YP_002377321.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7424]
 gi|218171720|gb|ACK70453.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7424]
          Length = 81

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+     + +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G
Sbjct: 4   ETLPLTTENVEQVLDE-LRPYLMADGGNVELVEIDGPIVKLRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDI 186
           +   L  ++PE+ ++
Sbjct: 63  IERRLREYIPEIAEV 77


>gi|124009117|ref|ZP_01693800.1| conserved domain protein [Microscilla marina ATCC 23134]
 gi|123985331|gb|EAY25251.1| conserved domain protein [Microscilla marina ATCC 23134]
          Length = 84

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +++R+   LD  +RP +  DGGD+ V +   DG+V L + G+C  CP ++ TLK G+   
Sbjct: 7   MIERVDNALDT-IRPYLKTDGGDVKVLEVSEDGVVKLELMGSCGSCPMSAMTLKAGIEES 65

Query: 176 LNHFVPEVKDIRTV 189
           +   VPE+  +  +
Sbjct: 66  IRKAVPEITAVEAI 79


>gi|89100547|ref|ZP_01173407.1| nitrogen fixation protein (NifU protein) [Bacillus sp. NRRL
           B-14911]
 gi|89084734|gb|EAR63875.1| nitrogen fixation protein (NifU protein) [Bacillus sp. NRRL
           B-14911]
          Length = 77

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++  ++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 5   IISDVQEVLD-KLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIERAL 63


>gi|110738975|dbj|BAF01408.1| nitrogen fixation like protein [Arabidopsis thaliana]
 gi|227206276|dbj|BAH57193.1| AT4G25910 [Arabidopsis thaliana]
          Length = 155

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + L  
Sbjct: 6   ENVERVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRD 64

Query: 179 FVPEVKDI 186
            +PE+  +
Sbjct: 65  KIPEIMSV 72


>gi|303245787|ref|ZP_07332070.1| nitrogen-fixing NifU domain protein [Desulfovibrio fructosovorans
           JJ]
 gi|302493050|gb|EFL52915.1| nitrogen-fixing NifU domain protein [Desulfovibrio fructosovorans
           JJ]
          Length = 73

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 128 RVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           ++RP++  DGGD+      DG IV + + GAC GCP +  TLK G+  IL   VP VK +
Sbjct: 11  KIRPSLQADGGDVELVEVTDGGIVKVRLTGACKGCPMSQMTLKNGIERILMQSVPGVKAV 70

Query: 187 RTV 189
             V
Sbjct: 71  EAV 73


>gi|148907013|gb|ABR16650.1| unknown [Picea sitchensis]
          Length = 465

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-FVPEVKD 185
           N VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +L   F   +K+
Sbjct: 329 NDVRPYLVADGGNVEVASVEDGVISLRLQGACGTCPSSTTTMKMGIERVLKEKFGDVLKE 388

Query: 186 IRTV 189
           IR V
Sbjct: 389 IRQV 392


>gi|157736773|ref|YP_001489456.1| NifU-like protein [Arcobacter butzleri RM4018]
 gi|315635952|ref|ZP_07891213.1| NifU family protein [Arcobacter butzleri JV22]
 gi|157698627|gb|ABV66787.1| conserved hypothetical NifU-like protein [Arcobacter butzleri
           RM4018]
 gi|315479736|gb|EFU70408.1| NifU family protein [Arcobacter butzleri JV22]
          Length = 92

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  +   +  +++N++ P +ARDGG I     ++  +F+ ++GAC GC ++S TLKY V
Sbjct: 5   TDEDLQNPVSSIIENKISPMLARDGGAIKLLAIKNARIFVQLQGACVGCSASSSTLKYIV 64


>gi|224373701|ref|YP_002608073.1| NifU family protein [Nautilia profundicola AmH]
 gi|223588484|gb|ACM92220.1| NifU family protein [Nautilia profundicola AmH]
          Length = 98

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           S+  + + +  VLD  VRP +  DGGD+     R  IVF+ ++G C GC SA  TLKYG+
Sbjct: 7   SNEDLKEAVAGVLD-EVRPMLQMDGGDVTLIDVRKPIVFVQLQGGCVGCASAGATLKYGI 65

Query: 173 ANILNHFV-PEV 183
              L   + PE+
Sbjct: 66  EKALKEKIHPEL 77


>gi|218778425|ref|YP_002429743.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759809|gb|ACL02275.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 74

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++K  +D  +RP + RDGGD+ + +   DG+V + + GAC GCP + +TLK G+   + 
Sbjct: 3   EQVKAAIDE-IRPTLQRDGGDVELVEVGDDGVVKVRLVGACKGCPMSQQTLKNGIEKYMK 61

Query: 178 HFVPEVKDIRTV 189
             +P VK +  V
Sbjct: 62  KNIPGVKSVEGV 73


>gi|253575294|ref|ZP_04852632.1| nitrogen-fixing NifU domain-containing protein [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251845291|gb|EES73301.1| nitrogen-fixing NifU domain-containing protein [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 81

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            + EVLD ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 12  EVLEVLD-KLRPFLQRDGGDVELVDVEDGIVKLKLMGACGSCPSSTITLKAGIERAL 67


>gi|85859635|ref|YP_461837.1| nifU-like domain-containing protein [Syntrophus aciditrophicus SB]
 gi|85722726|gb|ABC77669.1| nifU-like domain protein [Syntrophus aciditrophicus SB]
          Length = 73

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++E +D  VRP +  DGGD+ +     DG+V + + GAC GC  +  TLK G+   L  
Sbjct: 4   KVQEAIDQ-VRPGLQADGGDVELVDVTEDGVVKVRLVGACRGCAMSQMTLKMGIERFLKE 62

Query: 179 FVPEVKDIRTV 189
            +PEVK++  V
Sbjct: 63  RIPEVKEVVAV 73


>gi|269216053|ref|ZP_06159907.1| NifU family protein [Slackia exigua ATCC 700122]
 gi|269130312|gb|EEZ61390.1| NifU family protein [Slackia exigua ATCC 700122]
          Length = 76

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R+  VLD  VRP++  DGGD+ +     DGIV + ++GAC+GC  +S T+  GV  IL 
Sbjct: 6   KRVSRVLD-MVRPSLQADGGDLELVDITDDGIVRVRLQGACNGCALSSLTIANGVERILK 64

Query: 178 HFVPEVKDI 186
             VPEV  +
Sbjct: 65  EHVPEVAKV 73


>gi|18416645|ref|NP_567735.1| NFU3; structural molecule [Arabidopsis thaliana]
 gi|75147908|sp|Q84RQ7|NIFU3_ARATH RecName: Full=NifU-like protein 3, chloroplastic; Short=AtCNfu3;
           Short=AtCnfU-IVa; Flags: Precursor
 gi|28207820|emb|CAD55560.1| NFU3 protein [Arabidopsis thaliana]
 gi|88196759|gb|ABD43022.1| At4g25910 [Arabidopsis thaliana]
 gi|222423670|dbj|BAH19802.1| AT4G25910 [Arabidopsis thaliana]
 gi|332659732|gb|AEE85132.1| NifU-like protein 3 [Arabidopsis thaliana]
          Length = 236

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + L  
Sbjct: 87  ENVERVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRD 145

Query: 179 FVPEVKDI 186
            +PE+  +
Sbjct: 146 KIPEIMSV 153


>gi|322420167|ref|YP_004199390.1| nitrogen-fixing NifU domain-containing protein [Geobacter sp. M18]
 gi|320126554|gb|ADW14114.1| nitrogen-fixing NifU domain protein [Geobacter sp. M18]
          Length = 73

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +K +L+N +RPA+  DGGD+ + +   DG+V + + GAC  CP ++ TLK G+   + 
Sbjct: 3   EEVKAILEN-IRPALQADGGDVELVEVTDDGVVKVRLVGACGHCPMSTMTLKMGIERTIK 61

Query: 178 HFVPEVKDIRTV 189
             +P VK++ +V
Sbjct: 62  EKIPGVKEVVSV 73


>gi|4538920|emb|CAB39656.1| nitrogen fixation like protein [Arabidopsis thaliana]
 gi|7269442|emb|CAB79446.1| nitrogen fixation like protein [Arabidopsis thaliana]
          Length = 224

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + L  
Sbjct: 75  ENVERVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRD 133

Query: 179 FVPEVKDI 186
            +PE+  +
Sbjct: 134 KIPEIMSV 141


>gi|297803520|ref|XP_002869644.1| hypothetical protein ARALYDRAFT_492226 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297315480|gb|EFH45903.1| hypothetical protein ARALYDRAFT_492226 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 238

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + L  
Sbjct: 89  ENVERVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRD 147

Query: 179 FVPEVKDI 186
            +PE+  +
Sbjct: 148 KIPEIMSV 155


>gi|222054851|ref|YP_002537213.1| nitrogen-fixing NifU domain protein [Geobacter sp. FRC-32]
 gi|221564140|gb|ACM20112.1| nitrogen-fixing NifU domain protein [Geobacter sp. FRC-32]
          Length = 73

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K+VLD  +RP +  DGGD+ + +   DG+V + + GAC  CP ++ TLK G+   
Sbjct: 1   MIEDVKKVLDT-IRPNLQADGGDVELVEVGEDGVVKVKLVGACGHCPMSTMTLKMGIERT 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP VK++ +V
Sbjct: 60  LKEKVPGVKEVISV 73


>gi|118475450|ref|YP_891271.1| NifU family protein [Campylobacter fetus subsp. fetus 82-40]
 gi|118414676|gb|ABK83096.1| NifU family protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 88

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +KE L   + P + +DGG +   G ++G+V++ + G C GC ++S+TLKYGV
Sbjct: 5   SDEELLEPVKESL-KVIMPMLEQDGGGMELLGIKNGVVYVRLTGHCHGCAASSQTLKYGV 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|21554503|gb|AAM63593.1| nitrogen fixation like protein [Arabidopsis thaliana]
          Length = 236

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + L  
Sbjct: 87  ENVERVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRD 145

Query: 179 FVPEVKDI 186
            +PE+  +
Sbjct: 146 KIPEIMSV 153


>gi|251798821|ref|YP_003013552.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. JDR-2]
 gi|247546447|gb|ACT03466.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. JDR-2]
          Length = 80

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 123 EVLD--NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           EVLD  +++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 11  EVLDVLDKLRPFLQRDGGDVELVDVEDGIVKLRLMGACGSCPSSTITLKAGIERAL 66


>gi|284929666|ref|YP_003422188.1| thioredoxin-like protein [cyanobacterium UCYN-A]
 gi|284810110|gb|ADB95807.1| thioredoxin-like protein [cyanobacterium UCYN-A]
          Length = 76

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +
Sbjct: 8   VEQVLDE-LRPYLIADGGNVELVEIDGAIVKLRLQGACGSCPSSTMTLKMGIERRLKEMI 66

Query: 181 PEVKDI 186
           PEV ++
Sbjct: 67  PEVSEV 72


>gi|283953743|ref|ZP_06371274.1| NifU family protein [Campylobacter jejuni subsp. jejuni 414]
 gi|283794784|gb|EFC33522.1| NifU family protein [Campylobacter jejuni subsp. jejuni 414]
          Length = 90

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K  L+  + P + RDGG + F G ++G+V++ + GAC GC S+  TLKYG+
Sbjct: 5   SDEELINPVKASLEKSL-PMLERDGGGLEFLGIKNGVVYVHLIGACKGCTSSGITLKYGL 63

Query: 173 ANILN 177
              L 
Sbjct: 64  ERQLK 68


>gi|157693637|ref|YP_001488099.1| iron-sulfur assembly protein [Bacillus pumilus SAFR-032]
 gi|194015287|ref|ZP_03053903.1| conserved domain protein [Bacillus pumilus ATCC 7061]
 gi|157682395|gb|ABV63539.1| possible iron-sulfur assembly protein [Bacillus pumilus SAFR-032]
 gi|194012691|gb|EDW22257.1| conserved domain protein [Bacillus pumilus ATCC 7061]
          Length = 78

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +++EVLD ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 9   QVQEVLD-KLRPFLLRDGGDCELVDIEDGIVKLRLLGACGSCPSSTITLKAGIERAL 64


>gi|308272822|emb|CBX29426.1| hypothetical protein N47_J04070 [uncultured Desulfobacterium sp.]
          Length = 61

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +RP + +DGGD+      +GIV + ++GAC+GCP +  TLK G+  +L   VP VK +  
Sbjct: 1   MRPMLQKDGGDVEIVDVSEGIVKVRLQGACAGCPMSQMTLKNGIEKLLMQDVPGVKSVVA 60

Query: 189 V 189
           V
Sbjct: 61  V 61


>gi|242277615|ref|YP_002989744.1| Fe-S cluster assembly protein NifU [Desulfovibrio salexigens DSM
           2638]
 gi|242120509|gb|ACS78205.1| Fe-S cluster assembly protein NifU [Desulfovibrio salexigens DSM
           2638]
          Length = 279

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q + +V+D  +RPA+ +DGGDI         V +S+RGAC GCPS+  TLK  V   L  
Sbjct: 209 QLVTKVIDEEIRPALNKDGGDIELIDIDGHEVIVSLRGACVGCPSSGRTLKDFVERRLKE 268

Query: 179 FV-PEV 183
            V PE+
Sbjct: 269 TVEPEI 274


>gi|168037489|ref|XP_001771236.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677477|gb|EDQ63947.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 165

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V+ + +VLD  VRP +  DGG++     +DG+V L ++GAC  CPS++ T+K G+  +L
Sbjct: 24  VENVDKVLD-EVRPYLIADGGNVEVVAVKDGVVSLRLQGACGTCPSSTSTMKMGIERVL 81


>gi|255582605|ref|XP_002532084.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223528244|gb|EEF30298.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 220

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP +  DGG++V       +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 72  ENVEKVLDE-VRPGLMADGGNVVLHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETRLRD 130

Query: 179 FVPEVKDIRTV 189
            +PE+  +  +
Sbjct: 131 KIPEIMAVEQI 141


>gi|270308880|ref|YP_003330938.1| NifU domain protein [Dehalococcoides sp. VS]
 gi|270154772|gb|ACZ62610.1| NifU domain protein [Dehalococcoides sp. VS]
          Length = 72

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++++ VLD ++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL
Sbjct: 1   MLEKVEAVLD-KIRPALEADGGNVELVDVVDGVVKVKLVGACAGCPMSTMTLKNGIERIL 59

Query: 177 NHFVPEVKDI 186
              +PEVK++
Sbjct: 60  KREIPEVKEV 69


>gi|329769819|ref|ZP_08261220.1| hypothetical protein HMPREF0433_00984 [Gemella sanguinis M325]
 gi|328838181|gb|EGF87799.1| hypothetical protein HMPREF0433_00984 [Gemella sanguinis M325]
          Length = 84

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            ++RP +  DGGDI F  ++DGI+ L  +G C+ C  +  T+K+ +   +   +PEVK +
Sbjct: 17  EKIRPKLIMDGGDIEFVNFKDGILKLRFKGECAHCELSHITMKFAIEKNILEKIPEVKKV 76

Query: 187 RTV 189
             V
Sbjct: 77  TEV 79


>gi|163781905|ref|ZP_02176905.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883125|gb|EDP76629.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 87

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +++VLD  +RPA+  DGGD+     + DG V + + GACSGC  +  TLK G+   L 
Sbjct: 7   EEVEKVLDE-IRPALRFDGGDVELVDIQEDGTVLVRLVGACSGCGMSVLTLKAGIERALK 65

Query: 178 HFVPEVKDIRTV 189
              PE+K+++ V
Sbjct: 66  QKFPEIKEVKDV 77


>gi|254415273|ref|ZP_05029035.1| hypothetical protein MC7420_2699 [Microcoleus chthonoplastes PCC
           7420]
 gi|196178079|gb|EDX73081.1| hypothetical protein MC7420_2699 [Microcoleus chthonoplastes PCC
           7420]
          Length = 84

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  
Sbjct: 14  ENVEAVLDE-LRPYLMADGGNVDLVEIDGPIVKLRLQGACGSCPSSAMTLKMGIERRLRE 72

Query: 179 FVPEVKDIRTV 189
           F+PE+ ++  V
Sbjct: 73  FIPEIVEVEQV 83


>gi|325954760|ref|YP_004238420.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
 gi|323437378|gb|ADX67842.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
          Length = 93

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           ++ ++  + + LD  +RP +  DGGDI     +D +V + ++GAC+ C     TLK GV 
Sbjct: 2   NTELIDNVHKALD-EIRPFLNSDGGDIELVEVKDNVVKVRLKGACTSCSVNQMTLKAGVE 60

Query: 174 NILNHFVPEV 183
             +  FVPE+
Sbjct: 61  TTVKKFVPEI 70


>gi|309389827|gb|ADO77707.1| nitrogen-fixing NifU domain protein [Halanaerobium praevalens DSM
           2228]
          Length = 73

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 127 NRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           +++RP++  DGGD+ + +    GIV + + GACSGCP ++ T+K G+   L   V  VK+
Sbjct: 10  DKIRPSLQADGGDVELIEVTEAGIVKVKLLGACSGCPMSTLTIKNGIEKTLKQNVEGVKE 69

Query: 186 IRTV 189
           +++V
Sbjct: 70  VQSV 73


>gi|323453984|gb|EGB09855.1| hypothetical protein AURANDRAFT_6483 [Aureococcus anophagefferens]
          Length = 114

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + +RP +  DGG++   G    +V L + GAC  CPS++ T+K G+   L   +PE
Sbjct: 11  ELILDELRPYLMSDGGNVRIAGIEGPVVKLELEGACGTCPSSTMTMKMGLERRLKEAIPE 70

Query: 183 VKDI 186
           + D+
Sbjct: 71  ISDV 74


>gi|187250677|ref|YP_001875159.1| thioredoxin-like protein [Elusimicrobium minutum Pei191]
 gi|186970837|gb|ACC97822.1| Thioredoxin-like protein [Elusimicrobium minutum Pei191]
          Length = 74

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
           +I+EV+  +++P +  DGGD+ F  + +  G V++S++G C GCP+A  TLK  +   + 
Sbjct: 4   KIEEVI-AKIKPVLQADGGDLEFVSFDENTGTVYVSLKGRCGGCPAAQMTLKAVIERKIM 62

Query: 178 HFVPEVKDIRTV 189
             +PEVK +  V
Sbjct: 63  QEIPEVKAVERV 74


>gi|219120702|ref|XP_002181084.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217407800|gb|EEC47736.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 225

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  +RP + +DGG+++       +V L ++GAC  CPS+++T+K G+   L   +
Sbjct: 76  VEAVLDE-MRPYLIQDGGNVIISDIDGPVVKLELQGACGTCPSSTQTMKMGLERGLREKI 134

Query: 181 PEVKDI 186
           PE++++
Sbjct: 135 PEIQEV 140


>gi|124360086|gb|ABN08102.1| Nitrogen-fixing NifU, C-terminal [Medicago truncatula]
          Length = 242

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP +  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 94  ENVEKVLDE-VRPGLMADGGNVALHEIDGLVVILKLQGACGSCPSSTMTLKMGIETRLRD 152

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  +
Sbjct: 153 KIPEILEVEQI 163


>gi|294501686|ref|YP_003565386.1| NifU-like domain-containing protein [Bacillus megaterium QM B1551]
 gi|295707034|ref|YP_003600109.1| NifU-like domain-containing protein [Bacillus megaterium DSM 319]
 gi|294351623|gb|ADE71952.1| NifU-like domain protein [Bacillus megaterium QM B1551]
 gi|294804693|gb|ADF41759.1| NifU-like domain protein [Bacillus megaterium DSM 319]
          Length = 76

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S + ++++EVL+ ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+  
Sbjct: 2   SEMHEQVQEVLE-KLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIER 60

Query: 175 IL 176
            L
Sbjct: 61  AL 62


>gi|255632161|gb|ACU16433.1| unknown [Glycine max]
          Length = 221

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-FVPE 182
           VLD+ VRP +  DGG++      DG+V L + GAC  CPS++ T+  G+  +L   F   
Sbjct: 81  VLDD-VRPYLIADGGNVDVVSVEDGVVSLRLEGACESCPSSTTTMTMGIERVLKEKFGDA 139

Query: 183 VKDIRTV 189
           VKDIR V
Sbjct: 140 VKDIRQV 146


>gi|313902071|ref|ZP_07835484.1| nitrogen-fixing NifU domain protein [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467680|gb|EFR63181.1| nitrogen-fixing NifU domain protein [Thermaerobacter subterraneus
           DSM 13965]
          Length = 73

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++++ L++ +RPA+  DGGDI       +G+V + + GAC GCP +  TLK G+  IL 
Sbjct: 3   EQVEQALES-IRPAIQMDGGDIELVDVDENGVVRVRLIGACVGCPMSIMTLKAGIERILR 61

Query: 178 HFVPEVKDIRTV 189
             VP V D+  V
Sbjct: 62  ERVPGVTDVEAV 73


>gi|255525728|ref|ZP_05392659.1| nitrogen-fixing NifU domain protein [Clostridium carboxidivorans
           P7]
 gi|296188013|ref|ZP_06856405.1| NifU-like domain protein [Clostridium carboxidivorans P7]
 gi|255510551|gb|EET86860.1| nitrogen-fixing NifU domain protein [Clostridium carboxidivorans
           P7]
 gi|296047139|gb|EFG86581.1| NifU-like domain protein [Clostridium carboxidivorans P7]
          Length = 73

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 127 NRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           N++RP + RDGGD+ +     DGIV + M+GAC  CP A  T+K  +   L   VP VK+
Sbjct: 10  NKIRPMLQRDGGDVELVDVSSDGIVSVKMQGACGNCPGAMMTIKGVIEATLKEEVPGVKE 69

Query: 186 I 186
           +
Sbjct: 70  V 70


>gi|172035933|ref|YP_001802434.1| NifU-like protein [Cyanothece sp. ATCC 51142]
 gi|171697387|gb|ACB50368.1| NifU-like protein [Cyanothece sp. ATCC 51142]
          Length = 80

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +
Sbjct: 12  VEQVLDE-MRPYLMADGGNVELVEIEGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMI 70

Query: 181 PEVKDI 186
           PE+ ++
Sbjct: 71  PEIAEV 76


>gi|73749405|ref|YP_308644.1| nifU protein,-like protein [Dehalococcoides sp. CBDB1]
 gi|147670014|ref|YP_001214832.1| NifU domain-containing protein [Dehalococcoides sp. BAV1]
 gi|289433363|ref|YP_003463236.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. GT]
 gi|73661121|emb|CAI83728.1| nifU protein, homolog [Dehalococcoides sp. CBDB1]
 gi|146270962|gb|ABQ17954.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. BAV1]
 gi|288947083|gb|ADC74780.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. GT]
          Length = 72

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++++ VLD ++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL
Sbjct: 1   MLEKVEAVLD-KIRPALEADGGNVELVDVVDGVVKVKLVGACAGCPMSTMTLKNGIERIL 59

Query: 177 NHFVPEVKDI 186
              +PE+K++
Sbjct: 60  KREIPEIKEV 69


>gi|303246717|ref|ZP_07332995.1| Fe-S cluster assembly protein NifU [Desulfovibrio fructosovorans
           JJ]
 gi|302492057|gb|EFL51935.1| Fe-S cluster assembly protein NifU [Desulfovibrio fructosovorans
           JJ]
          Length = 279

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V+R+ +V+D  +RP + +DGGDI         V +++RGAC GCP ++ TL   V   L 
Sbjct: 206 VKRVTQVMDEEIRPNLKKDGGDIELLDIEGKTVLVALRGACQGCPVSNVTLTEFVQKRLR 265

Query: 178 HFV 180
             V
Sbjct: 266 ELV 268


>gi|313897537|ref|ZP_07831079.1| NifU-like protein [Clostridium sp. HGF2]
 gi|312957489|gb|EFR39115.1| NifU-like protein [Clostridium sp. HGF2]
          Length = 76

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +  IK+ ++ ++RP + RDGGD+ F  + DGIV + + GAC GC S  +T++ G+  IL
Sbjct: 5   IDEIKQTIE-KIRPYIQRDGGDVEFVSFEDGIVGVRLLGACVGCMSIDDTIQGGIEAIL 62


>gi|224476033|ref|YP_002633639.1| hypothetical protein Sca_0540 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420640|emb|CAL27454.1| hypothetical protein with NifU domain [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 80

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V+  R+RP + RDGGD       DGIV L + GAC+ CPS++ TLK G+   L
Sbjct: 14  VVIERLRPFLLRDGGDCTLIDVEDGIVKLQLHGACNTCPSSTITLKAGIERAL 66


>gi|2183204|gb|AAC33371.1| NifU [Cyanothece sp. PCC 8801]
          Length = 294

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I+++LD  ++PA+A+DGGD+        +V + ++GAC  C S+++TLK G+ A +    
Sbjct: 226 IQQILDEEIKPALAKDGGDVELFDVEGDLVKVILQGACGSCASSTQTLKMGIEARLRERV 285

Query: 180 VPEV 183
            PE+
Sbjct: 286 SPEL 289


>gi|257059658|ref|YP_003137546.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8802]
 gi|256589824|gb|ACV00711.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8802]
          Length = 294

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I+++LD  ++PA+A+DGGD+        +V + ++GAC  C S+++TLK G+ A +    
Sbjct: 226 IQQILDEEIKPALAKDGGDVELFDVEGDLVKVILQGACGSCASSTQTLKMGIEARLRERV 285

Query: 180 VPEV 183
            PE+
Sbjct: 286 SPEL 289


>gi|225437626|ref|XP_002278510.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297744011|emb|CBI36981.3| unnamed protein product [Vitis vinifera]
          Length = 213

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH-FVPEVKDIR 187
           VRP +  DGG++      DG++ L ++GAC  CPS++ T+  G+  +L   F   VKDIR
Sbjct: 79  VRPYLISDGGNVDVVSVEDGVISLKLQGACGSCPSSTTTMTMGIERVLKEKFGDAVKDIR 138

Query: 188 TV 189
            V
Sbjct: 139 QV 140


>gi|300785684|ref|YP_003765975.1| thioredoxin-like protein [Amycolatopsis mediterranei U32]
 gi|299795198|gb|ADJ45573.1| thioredoxin-like protein [Amycolatopsis mediterranei U32]
          Length = 172

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +R+ E LD +VRP +    GD+ F    DG++ L ++G C GCPS++ T KY +  ++  
Sbjct: 78  ERVTEALD-KVRPYLGSHAGDVEFVEIADGVLRLRLQGTCDGCPSSTVTAKYAIERVVRE 136

Query: 179 FVP 181
             P
Sbjct: 137 AAP 139


>gi|225446006|ref|XP_002268218.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297735420|emb|CBI17860.3| unnamed protein product [Vitis vinifera]
          Length = 237

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP +  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 88  ENVEKVLDE-VRPGLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETRLRD 146

Query: 179 FVPEVKDIRTV 189
            +PE++ +  +
Sbjct: 147 KIPEIEAVEQI 157


>gi|218246615|ref|YP_002371986.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8801]
 gi|218167093|gb|ACK65830.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8801]
          Length = 294

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I+++LD  ++PA+A+DGGD+        +V + ++GAC  C S+++TLK G+ A +    
Sbjct: 226 IQQILDEEIKPALAKDGGDVELFDVEGDLVKVILQGACGSCASSTQTLKMGIEARLRERV 285

Query: 180 VPEV 183
            PE+
Sbjct: 286 SPEL 289


>gi|172058330|ref|YP_001814790.1| NifU domain-containing protein [Exiguobacterium sibiricum 255-15]
 gi|171990851|gb|ACB61773.1| nitrogen-fixing NifU domain protein [Exiguobacterium sibiricum
           255-15]
          Length = 75

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++ EVL+ ++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 6   QVNEVLE-KLRPFLLRDGGDVELVDVEDGIVKLRLMGACGSCPSSTITLKAGIERAL 61


>gi|119511776|ref|ZP_01630878.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
 gi|119463549|gb|EAW44484.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
          Length = 76

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L  
Sbjct: 6   ENVETVLDE-MRPYLMSDGGNVELVELDGPIVKLRLQGACGSCPSSAMTLRMGIERRLKE 64

Query: 179 FVPEVKDIRTV 189
            +PE+ +I  V
Sbjct: 65  MIPEIAEIEQV 75


>gi|312144147|ref|YP_003995593.1| nitrogen-fixing NifU domain protein [Halanaerobium sp.
           'sapolanicus']
 gi|311904798|gb|ADQ15239.1| nitrogen-fixing NifU domain protein [Halanaerobium sp.
           'sapolanicus']
          Length = 73

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +++ LD ++RP++  DGGD+ + +   +GIV + + GACSGCP ++ T+K G+   L 
Sbjct: 3   EEVQKYLD-KIRPSLQADGGDVELVEVTEEGIVKVKLLGACSGCPMSTLTIKNGIERTLK 61

Query: 178 HFVPEVKDIRTV 189
             V  VK+++ V
Sbjct: 62  QNVDGVKEVQPV 73


>gi|302340763|ref|YP_003805969.1| nitrogen-fixing NifU domain protein [Spirochaeta smaragdinae DSM
           11293]
 gi|301637948|gb|ADK83375.1| nitrogen-fixing NifU domain protein [Spirochaeta smaragdinae DSM
           11293]
          Length = 77

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++K+ + + +RP++  DGGDI       +G V + + GAC+GCP A  TLK GV   L  
Sbjct: 8   KVKKAIQD-IRPSLQADGGDIELVTVGENGKVSVRLTGACNGCPMAQITLKQGVERYLKE 66

Query: 179 FVPEVKDIRTV 189
            +PE+K +  V
Sbjct: 67  TIPEIKSVDAV 77


>gi|254786162|ref|YP_003073591.1| gluconate transport associated thioredoxin-like protein YhgI
           [Teredinibacter turnerae T7901]
 gi|259511746|sp|C5BJC0|NFUA_TERTT RecName: Full=Fe/S biogenesis protein nfuA
 gi|237684627|gb|ACR11891.1| putative gluconate transport associated thioredoxin-like protein
           YhgI [Teredinibacter turnerae T7901]
          Length = 194

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           I  DS +  +I  VL N V P +A  GG++  +   D G+  L   G C GC +   TLK
Sbjct: 104 ISDDSPIEDKINYVLYNEVNPGLASHGGNVSLERLTDDGMAILRFGGGCQGCSAVDMTLK 163

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   +PE+  +R V
Sbjct: 164 QGVEKTLMERIPELAGVRDV 183


>gi|159474062|ref|XP_001695148.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158276082|gb|EDP01856.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 154

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP +  DGG++ F      +V L ++GAC  CPS++ T+  G+   L  
Sbjct: 7   ENVEKVLD-EVRPYLMADGGNVEFMEIDGLVVKLKLQGACGSCPSSTTTMTMGIKRRLME 65

Query: 179 FVPEVKDIRTV 189
            +PE+ D+  V
Sbjct: 66  RIPEILDVEQV 76


>gi|110004115|emb|CAK98454.1| hypothetical nitrogen fixation protein [Spiroplasma citri]
          Length = 75

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           K+++DN +RP + +DGGDI F   ++ IV++ + GAC GC     T+K GV  I+   +P
Sbjct: 8   KDIIDN-LRPYINQDGGDIEFVEVKNNIVYVRLAGACVGCGLIDSTIKDGVEQIVKQEMP 66

Query: 182 EV 183
           ++
Sbjct: 67  DI 68


>gi|72383588|ref|YP_292943.1| NifU-like protein [Prochlorococcus marinus str. NATL2A]
 gi|124025184|ref|YP_001014300.1| NifU-like protein [Prochlorococcus marinus str. NATL1A]
 gi|72003438|gb|AAZ59240.1| NifU-like protein [Prochlorococcus marinus str. NATL2A]
 gi|123960252|gb|ABM75035.1| NifU-like protein [Prochlorococcus marinus str. NATL1A]
          Length = 81

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +   + +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETLALTTENVEKVLDE-LRPFLMADGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDI 186
           +   L   +PEV ++
Sbjct: 63  IERKLREMIPEVSEV 77


>gi|302770961|ref|XP_002968899.1| hypothetical protein SELMODRAFT_16556 [Selaginella moellendorffii]
 gi|300163404|gb|EFJ30015.1| hypothetical protein SELMODRAFT_16556 [Selaginella moellendorffii]
          Length = 170

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 106 GSGDF-IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           GSG +  E+     + + +VLD  VRP +  DGG++      DG V L ++GAC  CPS+
Sbjct: 19  GSGLYSTETYDFTAENVDKVLD-EVRPYLVADGGNVAVVSVADGTVSLELQGACGTCPSS 77

Query: 165 SETLKYGVANILNH----FVPEVKDI 186
           + T+K G+  +L       V EV DI
Sbjct: 78  TSTMKMGIERVLREKFGDAVKEVVDI 103


>gi|298492022|ref|YP_003722199.1| nitrogen-fixing NifU domain-containing protein ['Nostoc azollae'
           0708]
 gi|298233940|gb|ADI65076.1| nitrogen-fixing NifU domain protein ['Nostoc azollae' 0708]
          Length = 79

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L 
Sbjct: 8   LENVETVLDE-MRPYLMSDGGNVEVVELDGPIVKLRLQGACGSCPSSAMTLRMGIERRLK 66

Query: 178 HFVPEVKDIRTV 189
             +PE+ +I  V
Sbjct: 67  ELIPEIAEIEQV 78


>gi|332702422|ref|ZP_08422510.1| Fe-S cluster assembly protein NifU [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552571|gb|EGJ49615.1| Fe-S cluster assembly protein NifU [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 285

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPSASETLKYGVANIL 176
           +Q + +V+D  +RP++ +DGGDI      DG+ V +S+RGAC GCPSA  TLK  V   L
Sbjct: 213 MQLVSKVIDEEIRPSLKKDGGDIELIDI-DGLNVVVSLRGACVGCPSAQLTLKQLVERRL 271

Query: 177 NHFV 180
              V
Sbjct: 272 RETV 275


>gi|222823154|ref|YP_002574727.1| NifU family protein [Campylobacter lari RM2100]
 gi|222538375|gb|ACM63476.1| conserved hypothetical protein, NifU family protein [Campylobacter
           lari RM2100]
          Length = 91

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +K  L   +   +  DGG + F G ++G+V++ + GAC GCPS+  TLKYG+
Sbjct: 6   SDEELIEPVKASLAKTMH-ILENDGGGLDFLGVKNGVVYVKLTGACHGCPSSGTTLKYGL 64

Query: 173 ANIL 176
              L
Sbjct: 65  EKQL 68


>gi|302784600|ref|XP_002974072.1| hypothetical protein SELMODRAFT_58377 [Selaginella moellendorffii]
 gi|300158404|gb|EFJ25027.1| hypothetical protein SELMODRAFT_58377 [Selaginella moellendorffii]
          Length = 162

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 106 GSGDF-IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           GSG +  E+     + + +VLD  VRP +  DGG++      DG V L ++GAC  CPS+
Sbjct: 8   GSGLYSAETYDFTAENVDKVLD-EVRPYLVADGGNVAVVSVADGTVSLELQGACGTCPSS 66

Query: 165 SETLKYGVANILNH----FVPEVKDI 186
           + T+K G+  +L       V EV DI
Sbjct: 67  TSTMKMGIERVLREKFGDAVKEVVDI 92


>gi|226503511|ref|NP_001150793.1| NFU3 [Zea mays]
 gi|195641898|gb|ACG40417.1| NFU3 [Zea mays]
          Length = 213

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 65  ENVEKVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETRLRD 123

Query: 179 FVPEVKDIRTV 189
            +P++ ++  +
Sbjct: 124 KIPDILEVEQI 134


>gi|78778799|ref|YP_396911.1| NifU-like protein [Prochlorococcus marinus str. MIT 9312]
 gi|123968006|ref|YP_001008864.1| NifU-like protein [Prochlorococcus marinus str. AS9601]
 gi|126695776|ref|YP_001090662.1| NifU-like protein [Prochlorococcus marinus str. MIT 9301]
 gi|157412831|ref|YP_001483697.1| NifU-like protein [Prochlorococcus marinus str. MIT 9215]
 gi|254525524|ref|ZP_05137576.1| NifU domain protein [Prochlorococcus marinus str. MIT 9202]
 gi|78712298|gb|ABB49475.1| NifU-like protein [Prochlorococcus marinus str. MIT 9312]
 gi|91070321|gb|ABE11238.1| NifU-like protein [uncultured Prochlorococcus marinus clone
           HF10-88F10]
 gi|123198116|gb|ABM69757.1| NifU-like protein [Prochlorococcus marinus str. AS9601]
 gi|126542819|gb|ABO17061.1| NifU-like protein [Prochlorococcus marinus str. MIT 9301]
 gi|157387406|gb|ABV50111.1| NifU-like protein [Prochlorococcus marinus str. MIT 9215]
 gi|221536948|gb|EEE39401.1| NifU domain protein [Prochlorococcus marinus str. MIT 9202]
          Length = 81

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ S   + +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETLSLTNENVEKVLD-ELRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +PE+ ++  V
Sbjct: 63  IERKLKEMIPEISEVVQV 80


>gi|218282608|ref|ZP_03488846.1| hypothetical protein EUBIFOR_01432 [Eubacterium biforme DSM 3989]
 gi|218216479|gb|EEC90017.1| hypothetical protein EUBIFOR_01432 [Eubacterium biforme DSM 3989]
          Length = 79

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           + + + LD ++RP +  DGGDI   G  +  +V++S +GAC GC  ASE    G+  +L 
Sbjct: 8   KAVNDCLD-KIRPYIQHDGGDIELLGVDEFNVVYVSFKGACQGCMMASEDFSSGIKELLL 66

Query: 178 HFVPEVKDIRTV 189
             VP ++D+  V
Sbjct: 67  EEVPNIRDVVLV 78


>gi|22298836|ref|NP_682083.1| NifU protein [Thermosynechococcus elongatus BP-1]
 gi|22295017|dbj|BAC08845.1| tsl1293 [Thermosynechococcus elongatus BP-1]
          Length = 89

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L  
Sbjct: 19  ENVEKVLDE-LRPYLMADGGNVELVEIEGPVVRLRLQGACGACPSSTMTLRMGIERKLKE 77

Query: 179 FVPEVKDIRTV 189
            +PE+ +++ V
Sbjct: 78  SIPEIAEVQQV 88


>gi|317121652|ref|YP_004101655.1| nitrogen-fixing NifU domain protein [Thermaerobacter marianensis
           DSM 12885]
 gi|315591632|gb|ADU50928.1| nitrogen-fixing NifU domain protein [Thermaerobacter marianensis
           DSM 12885]
          Length = 73

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +RPA+  DGGDI       +G+V + + GAC GCP +  TLK G+  IL   VP V D+ 
Sbjct: 12  IRPAIQMDGGDIELVDVDENGVVRVRLIGACVGCPMSIMTLKAGIERILRERVPGVTDVE 71

Query: 188 TV 189
            V
Sbjct: 72  AV 73


>gi|226493520|ref|NP_001152596.1| LOC100286236 [Zea mays]
 gi|195657915|gb|ACG48425.1| NFU3 [Zea mays]
          Length = 221

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +  VLD+ VRP +  DGG++      DG++ L + GAC  CPS++ T+  G+  +L  
Sbjct: 76  ENVDRVLDD-VRPYLISDGGNVTVVAVEDGVISLKLEGACGSCPSSTTTMNMGIERVLKE 134

Query: 179 -FVPEVKDIRTV 189
            F    K+IR V
Sbjct: 135 KFGDAFKEIRQV 146


>gi|300867628|ref|ZP_07112276.1| nitrogen-fixing NifU-like [Oscillatoria sp. PCC 6506]
 gi|300334389|emb|CBN57446.1| nitrogen-fixing NifU-like [Oscillatoria sp. PCC 6506]
          Length = 79

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L  
Sbjct: 9   ENVEQVLDE-LRPYLMSDGGNVELVEIEGPVVQLRLQGACGSCPSSAMTLRMGIERRLRE 67

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 68  TIPEIAEVEQV 78


>gi|242094042|ref|XP_002437511.1| hypothetical protein SORBIDRAFT_10g028390 [Sorghum bicolor]
 gi|241915734|gb|EER88878.1| hypothetical protein SORBIDRAFT_10g028390 [Sorghum bicolor]
          Length = 240

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 92  ENVEKVLDE-VRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETRLRD 150

Query: 179 FVPEVKDIRTV 189
            +P++ ++  +
Sbjct: 151 KIPDILEVEQI 161


>gi|223993177|ref|XP_002286272.1| nifU like protein [Thalassiosira pseudonana CCMP1335]
 gi|220977587|gb|EED95913.1| nifU like protein [Thalassiosira pseudonana CCMP1335]
          Length = 237

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 71/140 (50%), Gaps = 8/140 (5%)

Query: 52  ASVYFGY----DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNG-GLGDMKLDDMG 106
           A++ FG+    + I++   ++     RP +   I+  F + +    +G G+       +G
Sbjct: 17  AAMAFGHHGARNHISLSTRRHSPFSTRPQLRMTIVSPFDNTEDSDESGEGVATATYTSLG 76

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           S D  E      + +  VL+  +RP + +DGG++        IV L ++GAC  CPS+++
Sbjct: 77  SDD--EPLDLTWENVDMVLE-EMRPFLLQDGGNVAISEIDGPIVKLELQGACGTCPSSTQ 133

Query: 167 TLKYGVANILNHFVPEVKDI 186
           T+K G+   L   +PE++++
Sbjct: 134 TMKMGLERKLRERIPEIQEV 153


>gi|299139675|ref|ZP_07032848.1| nitrogen-fixing NifU domain protein [Acidobacterium sp. MP5ACTX8]
 gi|298598299|gb|EFI54464.1| nitrogen-fixing NifU domain protein [Acidobacterium sp. MP5ACTX8]
          Length = 197

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           VRP +   GGD    G  +GIV L + G C  CPS+S TLK  V   L    P++K+I
Sbjct: 122 VRPYLQEHGGDCELAGLDNGIVRLRLHGNCGSCPSSSLTLKNAVEEALFQAAPDIKEI 179


>gi|257456257|ref|ZP_05621454.1| NifU-like domain protein [Treponema vincentii ATCC 35580]
 gi|257446343|gb|EEV21389.1| NifU-like domain protein [Treponema vincentii ATCC 35580]
          Length = 75

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANIL 176
           V  +K+ LD  VRP +  DGGD+ F    D G+V + ++GAC  CP A  TLK G+   L
Sbjct: 4   VDEVKQALDV-VRPHLQADGGDVEFVSLSDDGVVSVRLKGACGSCPVALMTLKSGIEAQL 62

Query: 177 NHFVPEVKDIRTV 189
               P++K + ++
Sbjct: 63  KESYPDIKKVVSI 75


>gi|332707425|ref|ZP_08427474.1| thioredoxin-like protein [Lyngbya majuscula 3L]
 gi|332353776|gb|EGJ33267.1| thioredoxin-like protein [Lyngbya majuscula 3L]
          Length = 80

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +   + ++ VLD  +RP +  DGG++         V L ++GAC  CPS++ TL+ G
Sbjct: 3   ETMALTPENVETVLDE-MRPYLMADGGNVELVELDGPTVKLRLQGACGSCPSSTMTLRMG 61

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L  F+PE+ ++  V
Sbjct: 62  IERRLKEFIPEILEVEQV 79


>gi|115469688|ref|NP_001058443.1| Os06g0694500 [Oryza sativa Japonica Group]
 gi|53791826|dbj|BAD53892.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica
           Group]
 gi|53792847|dbj|BAD53880.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica
           Group]
 gi|113596483|dbj|BAF20357.1| Os06g0694500 [Oryza sativa Japonica Group]
 gi|215678926|dbj|BAG96356.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215695250|dbj|BAG90441.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218198813|gb|EEC81240.1| hypothetical protein OsI_24300 [Oryza sativa Indica Group]
 gi|222636145|gb|EEE66277.1| hypothetical protein OsJ_22478 [Oryza sativa Japonica Group]
          Length = 219

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD +VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 71  ENVEMVLD-QVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETRLRD 129

Query: 179 FVPEV 183
            +PE+
Sbjct: 130 KIPEI 134


>gi|223948699|gb|ACN28433.1| unknown [Zea mays]
          Length = 221

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +  VLD+ VRP +  DGG++      DG++ L + GAC  CPS++ T+  G+  +L  
Sbjct: 76  ENVDRVLDD-VRPYLISDGGNVTVVAVEDGVISLKLEGACGSCPSSTTTMNMGIERVLKE 134

Query: 179 -FVPEVKDIRTV 189
            F    K+IR V
Sbjct: 135 KFGDAFKEIRQV 146


>gi|242041121|ref|XP_002467955.1| hypothetical protein SORBIDRAFT_01g037130 [Sorghum bicolor]
 gi|241921809|gb|EER94953.1| hypothetical protein SORBIDRAFT_01g037130 [Sorghum bicolor]
          Length = 222

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +  VLD+ VRP +  DGG++      DG++ L + GAC  CPS++ T+  G+  +L  
Sbjct: 77  ENVDRVLDD-VRPYLISDGGNVTVVAVEDGVISLKLEGACGSCPSSTTTMNMGIERVLKE 135

Query: 179 -FVPEVKDIRTV 189
            F    K+IR V
Sbjct: 136 KFGDAFKEIRQV 147


>gi|226363961|ref|YP_002781743.1| hypothetical protein ROP_45510 [Rhodococcus opacus B4]
 gi|226242450|dbj|BAH52798.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 278

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V  R+   LD+ VRP +   GGD+   G  DG+V L + G+C  CPS++ TL+  V + +
Sbjct: 59  VETRVATALDS-VRPYLGSHGGDVELLGVVDGVVRLRLTGSCKSCPSSAVTLELAVKDAV 117

Query: 177 NHFVPEVKDIRTV 189
               PE  DI  V
Sbjct: 118 LAAAPETVDIEVV 130


>gi|221311164|ref|ZP_03593011.1| hypothetical protein Bsubs1_17486 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315491|ref|ZP_03597296.1| hypothetical protein BsubsN3_17402 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320406|ref|ZP_03601700.1| hypothetical protein BsubsJ_17365 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324690|ref|ZP_03605984.1| hypothetical protein BsubsS_17516 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296331794|ref|ZP_06874261.1| putative iron-sulfur scaffold protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675816|ref|YP_003867488.1| putative iron-sulfur scaffold protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|311069717|ref|YP_003974640.1| putative iron-sulfur scaffold protein [Bacillus atrophaeus 1942]
 gi|321312766|ref|YP_004205053.1| putative iron-sulfur scaffold protein [Bacillus subtilis BSn5]
 gi|291485686|dbj|BAI86761.1| hypothetical protein BSNT_04769 [Bacillus subtilis subsp. natto
           BEST195]
 gi|296151119|gb|EFG92001.1| putative iron-sulfur scaffold protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414060|gb|ADM39179.1| putative iron-sulfur scaffold protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|310870234|gb|ADP33709.1| putative iron-sulfur scaffold protein [Bacillus atrophaeus 1942]
 gi|320019040|gb|ADV94026.1| putative iron-sulfur scaffold protein [Bacillus subtilis BSn5]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++EVLD ++RP + RDGGD       +GIV L + GAC  CPS++ TLK G+   L
Sbjct: 8   EQVQEVLD-KLRPFLLRDGGDCELVDVDEGIVKLRLLGACGSCPSSTITLKAGIERAL 64


>gi|308174916|ref|YP_003921621.1| iron-sulfur scaffold protein [Bacillus amyloliquefaciens DSM 7]
 gi|307607780|emb|CBI44151.1| putative iron-sulfur scaffold protein [Bacillus amyloliquefaciens
           DSM 7]
 gi|328554923|gb|AEB25415.1| iron-sulfur scaffold protein [Bacillus amyloliquefaciens TA208]
 gi|328913234|gb|AEB64830.1| Putative nitrogen fixation protein yutI [Bacillus amyloliquefaciens
           LL3]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++EVLD ++RP + RDGGD       +GIV L + GAC  CPS++ TLK G+   L
Sbjct: 8   EQVQEVLD-KLRPFLLRDGGDCELVDIDEGIVKLRLLGACGSCPSSTITLKAGIERAL 64


>gi|307153189|ref|YP_003888573.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           7822]
 gi|306983417|gb|ADN15298.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7822]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  ++
Sbjct: 10  VETVLDE-MRPYLMADGGNVELVEIDGPIVKLRLQGACGSCPSSTMTLKMGIERRLREYI 68

Query: 181 PEVKDIRTV 189
           PE+ ++  V
Sbjct: 69  PEIVEVEQV 77


>gi|315639115|ref|ZP_07894282.1| NifU family protein [Campylobacter upsaliensis JV21]
 gi|315480819|gb|EFU71456.1| NifU family protein [Campylobacter upsaliensis JV21]
          Length = 90

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  ++  +K+ L+  + P + RDGG + F G ++G+V++ + GAC GC S+  TLKY +
Sbjct: 5   SDEELINPVKKSLEKSL-PILERDGGGLEFLGVKNGVVYVHLIGACKGCASSGITLKYSL 63

Query: 173 ANILNHFV-PEVKDI 186
              L   + PE+  I
Sbjct: 64  ERQLKMDIHPEISII 78


>gi|220907447|ref|YP_002482758.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           7425]
 gi|219864058|gb|ACL44397.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7425]
          Length = 76

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L   +
Sbjct: 8   VEKVLDE-LRPYLMADGGNVELVELEGPIVRLRLQGACGSCPSSTMTLRMGIERKLRESI 66

Query: 181 PEVKDIRTV 189
           PE+ ++  V
Sbjct: 67  PEIAEVEQV 75


>gi|154687334|ref|YP_001422495.1| YutI [Bacillus amyloliquefaciens FZB42]
 gi|154353185|gb|ABS75264.1| YutI [Bacillus amyloliquefaciens FZB42]
          Length = 86

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
            G  + ++  + ++++EVLD ++RP + RDGGD       +GIV L + GAC  CPS++ 
Sbjct: 4   KGANLMTEVEMKEQVQEVLD-KLRPFLLRDGGDCELVDVDEGIVKLRLLGACGSCPSSTI 62

Query: 167 TLKYGVANIL 176
           TLK G+   L
Sbjct: 63  TLKAGIERAL 72


>gi|126660171|ref|ZP_01731289.1| putative NifU-like protein [Cyanothece sp. CCY0110]
 gi|126618536|gb|EAZ89287.1| putative NifU-like protein [Cyanothece sp. CCY0110]
          Length = 80

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +
Sbjct: 12  VETVLDE-MRPYLMADGGNVELVEIEGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMI 70

Query: 181 PEVKDI 186
           PE+ ++
Sbjct: 71  PEIAEV 76


>gi|119503957|ref|ZP_01626038.1| hypothetical protein MGP2080_09413 [marine gamma proteobacterium
           HTCC2080]
 gi|119459960|gb|EAW41054.1| hypothetical protein MGP2080_09413 [marine gamma proteobacterium
           HTCC2080]
          Length = 191

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           ++ DS +  RI  VL N V P++A  GG++ + +   D +  L   G C GC + S TLK
Sbjct: 101 VDVDSPIEDRINYVLYNEVNPSLAAHGGEVSLVEITDDALAILRFGGGCQGCSAVSMTLK 160

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   VPE+  +R V
Sbjct: 161 DGVEKTLLEQVPELSGVRDV 180


>gi|284053033|ref|ZP_06383243.1| nitrogen-fixing NifU domain protein [Arthrospira platensis str.
           Paraca]
 gi|291566311|dbj|BAI88583.1| iron-sulfur cluster assembly factor [Arthrospira platensis NIES-39]
          Length = 79

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  
Sbjct: 9   ENVETVLDE-LRPYLMADGGNVEIVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLRE 67

Query: 179 FVPEVKDIRTV 189
            +PE+ ++ +V
Sbjct: 68  KIPEIAEVESV 78


>gi|256827631|ref|YP_003151590.1| thioredoxin-like protein [Cryptobacterium curtum DSM 15641]
 gi|256583774|gb|ACU94908.1| thioredoxin-like protein [Cryptobacterium curtum DSM 15641]
          Length = 75

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 129 VRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           VRP++  DGGD+ +     DG V + ++GAC GCP +  TL +G+  IL   VP V+ +
Sbjct: 14  VRPSLQADGGDVRLVDVMEDGTVTVELQGACQGCPMSQMTLAHGIERILKDRVPGVQQV 72


>gi|197119169|ref|YP_002139596.1| thioredoxin/NifU-like domain-containing protein [Geobacter
           bemidjiensis Bem]
 gi|197088529|gb|ACH39800.1| thioredoxin/NifU-like domain protein [Geobacter bemidjiensis Bem]
          Length = 73

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +K +L+ ++RPA+  DGGD+ + +   DGIV + + GAC  CP ++ TLK G+   + 
Sbjct: 3   EEVKAILE-QIRPALQADGGDVELVEVTDDGIVKVRLVGACGHCPMSTMTLKMGIERTIK 61

Query: 178 HFVPEVKDIRTV 189
             VP +K++  V
Sbjct: 62  EKVPGIKEVVAV 73


>gi|16080275|ref|NP_391102.1| iron-sulfur scaffold protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|81342154|sp|O32119|YUTI_BACSU RecName: Full=Putative nitrogen fixation protein yutI
 gi|2635719|emb|CAB15212.1| putative iron-sulfur scaffold protein [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 111

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
            G  + ++  + ++++EVLD ++RP + RDGGD       +GIV L + GAC  CPS++ 
Sbjct: 29  KGANVMTEVEMKEQVQEVLD-KLRPFLLRDGGDCELVDVDEGIVKLRLLGACGSCPSSTI 87

Query: 167 TLKYGVANIL 176
           TLK G+   L
Sbjct: 88  TLKAGIERAL 97


>gi|239906346|ref|YP_002953087.1| nitrogen fixation protein NifU [Desulfovibrio magneticus RS-1]
 gi|239796212|dbj|BAH75201.1| nitrogen fixation protein NifU [Desulfovibrio magneticus RS-1]
          Length = 281

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           + +V++  +RP + +DGGDI         VF+S+RGAC GCPS++ TL   V   L   V
Sbjct: 212 VTKVMEEEIRPNLKKDGGDIELVDIDGQTVFVSLRGACKGCPSSNVTLTEFVQKRLQELV 271


>gi|268317872|ref|YP_003291591.1| nitrogen-fixing NifU domain-containing protein [Rhodothermus
           marinus DSM 4252]
 gi|262335406|gb|ACY49203.1| nitrogen-fixing NifU domain protein [Rhodothermus marinus DSM 4252]
          Length = 96

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSAS 165
           +G     D  + +RI+E LD  +RP +  DGG + +     D +V L + GAC  CP + 
Sbjct: 10  TGPLAPDDPELHRRIEEALDM-IRPYLMTDGGSVRLLNVTEDYVVELELLGACGTCPMSL 68

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ G+  +L   VPE+  +  V
Sbjct: 69  MTLRAGIEQVLKRAVPEITRVEAV 92


>gi|123965714|ref|YP_001010795.1| NifU-like protein [Prochlorococcus marinus str. MIT 9515]
 gi|123200080|gb|ABM71688.1| NifU-like protein [Prochlorococcus marinus str. MIT 9515]
          Length = 81

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L  
Sbjct: 11  ENVEKVLD-ELRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLKE 69

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 70  MIPEISEVVQV 80


>gi|295107477|emb|CBL05020.1| Thioredoxin-like proteins and domains [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 78

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +RP++  DGGD+ F     DG+V + ++GAC GCP +  TL  GV  IL   VP V  + 
Sbjct: 14  IRPSLQADGGDVRFVDVDEDGVVSVELQGACKGCPMSEMTLANGVERILKERVPGVTKVV 73

Query: 188 TV 189
            V
Sbjct: 74  AV 75


>gi|209523451|ref|ZP_03272006.1| nitrogen-fixing NifU domain protein [Arthrospira maxima CS-328]
 gi|209496193|gb|EDZ96493.1| nitrogen-fixing NifU domain protein [Arthrospira maxima CS-328]
          Length = 79

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  
Sbjct: 9   ENVETVLDE-LRPYLMADGGNVEVVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLRE 67

Query: 179 FVPEVKDIRTV 189
            +PE+ ++ +V
Sbjct: 68  RIPEIAEVESV 78


>gi|186681985|ref|YP_001865181.1| NifU domain-containing protein [Nostoc punctiforme PCC 73102]
 gi|186464437|gb|ACC80238.1| nitrogen-fixing NifU domain protein [Nostoc punctiforme PCC 73102]
          Length = 76

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +  ++ VLD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L 
Sbjct: 5   IDNVETVLDE-MRPYLMSDGGNVELVELDGPVVKLRLQGACGSCPSSAMTLRMGIERRLK 63

Query: 178 HFVPEVKDIRTV 189
             +PE+ +I  V
Sbjct: 64  EMIPEIAEIEQV 75


>gi|158334696|ref|YP_001515868.1| NifU domain-containing protein [Acaryochloris marina MBIC11017]
 gi|158304937|gb|ABW26554.1| NifU domain protein [Acaryochloris marina MBIC11017]
          Length = 80

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 10  ENVETVLDE-LRPYLMADGGNVELVEVEGPVVKLRLQGACGSCPSSAMTLKMGIERKLRD 68

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 69  TIPEIAEVEQV 79


>gi|289548959|ref|YP_003473947.1| nitrogen-fixing NifU domain protein [Thermocrinis albus DSM 14484]
 gi|289182576|gb|ADC89820.1| nitrogen-fixing NifU domain protein [Thermocrinis albus DSM 14484]
          Length = 85

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + I+ VLD  +RPA+  DGGD+ +     DG V + M GAC+GC  +  TLK G+   L 
Sbjct: 5   EEIEAVLDE-IRPALRFDGGDVELVDVLEDGTVLVRMIGACAGCGMSVLTLKAGIERALK 63

Query: 178 HFVPEVKDIRTV 189
              P++K+++ V
Sbjct: 64  SRFPDIKEVKDV 75


>gi|225850623|ref|YP_002730857.1| hypothetical protein PERMA_1071 [Persephonella marina EX-H1]
 gi|225646187|gb|ACO04373.1| conserved domain protein [Persephonella marina EX-H1]
          Length = 89

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q ++EVL N++RPA+A D G+I      +  V+L + GACS CP    T+   +   + H
Sbjct: 10  QEVEEVL-NKIRPALALDQGNIKLIKVENNDVYLELLGACSTCPVPDITMNDVIITTIKH 68

Query: 179 FVPEVKDIR 187
            +P V+ + 
Sbjct: 69  LLPWVETVH 77


>gi|304408198|ref|ZP_07389847.1| nitrogen-fixing NifU domain protein [Paenibacillus curdlanolyticus
           YK9]
 gi|304342886|gb|EFM08731.1| nitrogen-fixing NifU domain protein [Paenibacillus curdlanolyticus
           YK9]
          Length = 81

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 123 EVLD--NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           EVLD  +++RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   L
Sbjct: 12  EVLDVLDKLRPFLQRDGGDVELVDVEEGIVKLRLVGACGSCPSSTITLKAGIERAL 67


>gi|317494418|ref|ZP_07952832.1| IscR-regulated protein YhgI [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917668|gb|EFV39013.1| IscR-regulated protein YhgI [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 191

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           ++ D+ +++R++ VL +++ P +A  GG + + +   DGI  L   G C+GC     TLK
Sbjct: 101 VDDDAPLIERVEYVLQSQINPQLAGHGGKVTLMEITEDGIAILQFGGGCNGCSMVDYTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L    PE+K +R
Sbjct: 161 EGIEKELLQKFPELKGVR 178


>gi|294625346|ref|ZP_06703982.1| thioredoxin-like protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294664692|ref|ZP_06730025.1| thioredoxin-like protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292600364|gb|EFF44465.1| thioredoxin-like protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292605545|gb|EFF48863.1| thioredoxin-like protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 199

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N V P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEVNPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVTAVR 180


>gi|261886108|ref|ZP_06010147.1| NifU family protein [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 88

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +KE L   + P + +DGG +   G ++G+V++ + G C GC ++S+TLKYG 
Sbjct: 5   SDEELLEPVKESL-KVIMPMLEQDGGGMELLGIKNGVVYVRLTGHCHGCAASSQTLKYGA 63

Query: 173 ANILN 177
              L+
Sbjct: 64  ERQLS 68


>gi|17228804|ref|NP_485352.1| hypothetical protein asr1309 [Nostoc sp. PCC 7120]
 gi|75909243|ref|YP_323539.1| nitrogen-fixing NifU-like protein [Anabaena variabilis ATCC 29413]
 gi|17130656|dbj|BAB73266.1| asr1309 [Nostoc sp. PCC 7120]
 gi|75702968|gb|ABA22644.1| Nitrogen-fixing NifU-like protein [Anabaena variabilis ATCC 29413]
          Length = 76

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +  ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L 
Sbjct: 5   IDNVETVLDE-MRPYLISDGGNVELVELDGPIVKLRLQGACGSCPSSTMTLRMGIERRLR 63

Query: 178 HFVPEVKDIRTV 189
             +PE+ ++  V
Sbjct: 64  EMIPEIAEVEQV 75


>gi|284162204|ref|YP_003400827.1| nitrogen-fixing NifU domain protein [Archaeoglobus profundus DSM
           5631]
 gi|284012201|gb|ADB58154.1| nitrogen-fixing NifU domain protein [Archaeoglobus profundus DSM
           5631]
          Length = 77

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++EV++  +RP +  DGG+I       ++GIV + + GAC GCP A  TL   V   L
Sbjct: 5   EKVEEVVNKEIRPYLMADGGNIAVVDVDEKEGIVKVKLMGACYGCPMAQITLTAFVEQHL 64

Query: 177 NHFVPEVKDI 186
              +PEVK +
Sbjct: 65  KSRIPEVKKV 74


>gi|225010130|ref|ZP_03700602.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
 gi|225005609|gb|EEG43559.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
          Length = 79

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++Q++++ LD  +RP +  DGGDI  +G     V + + GAC GC     TLK GV   +
Sbjct: 6   LLQQVEKALD-EIRPFLQSDGGDIALEGIEGNTVKVRLMGACVGCSVNQMTLKSGVELTI 64

Query: 177 NHFVPEVKDI 186
             + P+++ +
Sbjct: 65  KKYAPQIEQV 74


>gi|116781227|gb|ABK22014.1| unknown [Picea sitchensis]
          Length = 238

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V+ I+ +LD  VRP +  DGG++        +V L ++GAC  CPS+  T+K G+   L
Sbjct: 89  TVENIEMILD-EVRPYLMADGGNVELHEIDGNVVTLKLQGACGSCPSSMTTMKTGIEGRL 147

Query: 177 NHFVPEVKDIRTV 189
              +PE+  ++ V
Sbjct: 148 MEKIPEIIAVKQV 160


>gi|237751304|ref|ZP_04581784.1| NifU family protein [Helicobacter bilis ATCC 43879]
 gi|229372670|gb|EEO23061.1| NifU family protein [Helicobacter bilis ATCC 43879]
          Length = 95

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD+ ++  +++ + N VRP + +DGGDI     ++  VF+   GACSGCPS + TL   +
Sbjct: 20  SDTELLAPVRQSI-NSVRPILLKDGGDIEIVEIKNACVFVRFHGACSGCPSKNATLHNAI 78

Query: 173 ANILNHFV-PEVK 184
              L   + P++K
Sbjct: 79  LATLQRDIHPDIK 91


>gi|258404239|ref|YP_003196981.1| Fe-S cluster assembly protein NifU [Desulfohalobium retbaense DSM
           5692]
 gi|257796466|gb|ACV67403.1| Fe-S cluster assembly protein NifU [Desulfohalobium retbaense DSM
           5692]
          Length = 283

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +Q + +V++  +RP++ +DGGDI         V +++RG CSGCPS+  TLK  V   L 
Sbjct: 210 MQLVNDVIEKEIRPSLQKDGGDIELIDIEGREVQVALRGMCSGCPSSQLTLKNVVERRLQ 269

Query: 178 HFV-PEV 183
             V PE+
Sbjct: 270 ERVEPEI 276


>gi|282898150|ref|ZP_06306143.1| Nitrogen-fixing NifU-like protein [Raphidiopsis brookii D9]
 gi|281196974|gb|EFA71877.1| Nitrogen-fixing NifU-like protein [Raphidiopsis brookii D9]
          Length = 76

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L 
Sbjct: 5   LENVETVLDE-MRPYLMSDGGNVEVVELDGPIVKLRLQGACGSCPSSTMTLRMGIERRLK 63

Query: 178 HFVPEVKDIRTV 189
             +PE+ ++  V
Sbjct: 64  EMIPEIGEVEQV 75


>gi|33860975|ref|NP_892536.1| NifU-like protein [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|33639707|emb|CAE18877.1| NifU-like protein [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
          Length = 81

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L  
Sbjct: 11  ENVETVLD-ELRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLKE 69

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 70  MIPEISEVVQV 80


>gi|126656503|ref|ZP_01727764.1| Fe-S cluster assembly protein NifU [Cyanothece sp. CCY0110]
 gi|126622189|gb|EAZ92896.1| Fe-S cluster assembly protein NifU [Cyanothece sp. CCY0110]
          Length = 293

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I++VL+  VRPA+A+DGGD+        +V + ++GAC  CPS++ TLK  + A + +  
Sbjct: 225 IQQVLEEEVRPALAQDGGDVDLFDVDGDLVKVILKGACDSCPSSTATLKMAIEARLRDRV 284

Query: 180 VPEV 183
            P++
Sbjct: 285 SPDL 288


>gi|282900620|ref|ZP_06308562.1| Nitrogen-fixing NifU-like protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194420|gb|EFA69375.1| Nitrogen-fixing NifU-like protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 76

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L 
Sbjct: 5   LENVETVLDE-MRPYLISDGGNVEVVELDGPIVKLRLQGACGSCPSSTMTLRMGIERRLK 63

Query: 178 HFVPEVKDIRTV 189
             +PE+ ++  V
Sbjct: 64  EMIPEIGEVEQV 75


>gi|218245975|ref|YP_002371346.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           8801]
 gi|257059024|ref|YP_003136912.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8802]
 gi|218166453|gb|ACK65190.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8801]
 gi|256589190|gb|ACV00077.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8802]
          Length = 79

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +
Sbjct: 11  VETVLDE-MRPYLMADGGNVELVELDGPVVKLRLQGACGSCPSSTMTLRMGIERRLREMI 69

Query: 181 PEVKDIRTV 189
           PE+ ++  V
Sbjct: 70  PEIAEVEQV 78


>gi|91201114|emb|CAJ74173.1| strongly similar to iron sulfur [Fe-S] cofactor protein NifU
           [Candidatus Kuenenia stuttgartiensis]
          Length = 284

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++E ++  +RPA+  DGGDI         V +S RG+CS CPS+  TLK  V   L  FV
Sbjct: 214 VQETIEREIRPALLADGGDIELIDIDGDRVMVSFRGSCSACPSSGVTLKSTVEAKLREFV 273

Query: 181 PEV 183
            + 
Sbjct: 274 TDT 276


>gi|78047985|ref|YP_364160.1| thioredoxin-like protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325927803|ref|ZP_08189028.1| thioredoxin-like protein [Xanthomonas perforans 91-118]
 gi|123584909|sp|Q3BSV3|NFUA_XANC5 RecName: Full=Fe/S biogenesis protein nfuA
 gi|78036415|emb|CAJ24106.1| thioredoxin-like protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325541793|gb|EGD13310.1| thioredoxin-like protein [Xanthomonas perforans 91-118]
          Length = 199

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVTAVR 180


>gi|166364297|ref|YP_001656570.1| NifU-like protein [Microcystis aeruginosa NIES-843]
 gi|166086670|dbj|BAG01378.1| NifU-like protein [Microcystis aeruginosa NIES-843]
          Length = 78

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   L   +
Sbjct: 10  VEQVLDE-MRPYLMADGGNVELVEIDGPVVKLRLQGACGSCPSSTMTLKMGIERRLREVI 68

Query: 181 PEVKDI 186
           PE+ ++
Sbjct: 69  PEIAEV 74


>gi|67921653|ref|ZP_00515171.1| Nitrogen-fixing NifU, C-terminal [Crocosphaera watsonii WH 8501]
 gi|67856765|gb|EAM52006.1| Nitrogen-fixing NifU, C-terminal [Crocosphaera watsonii WH 8501]
          Length = 80

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +
Sbjct: 12  VETVLDE-MRPYLMADGGNVELVDIEGPVVKLRLQGACGSCPSSTMTLRMGIERRLREMI 70

Query: 181 PEVKDIRTV 189
           PE+ ++  V
Sbjct: 71  PEIGEVEQV 79


>gi|163848313|ref|YP_001636357.1| Rieske (2Fe-2S) domain-containing protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|163669602|gb|ABY35968.1| Rieske (2Fe-2S) domain protein [Chloroflexus aurantiacus J-10-fl]
          Length = 293

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + R + VLD+  RP +   GGD      RDG+ +L + G+C+GC  ++ TL+  V  +L 
Sbjct: 100 ITRARRVLDS-ARPYMQSHGGDAELIDVRDGVAYLRLHGSCNGCSLSAFTLRKHVEEVLL 158

Query: 178 HFVPEVKDIRTV 189
             VPE+  +  V
Sbjct: 159 REVPEITRLEVV 170


>gi|317495423|ref|ZP_07953792.1| NifU domain-containing protein [Gemella moribillum M424]
 gi|316914482|gb|EFV35959.1| NifU domain-containing protein [Gemella moribillum M424]
          Length = 84

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +IK  L+ ++RP +  DGG+I F  Y+DGI+ +   G C+ C  +  TLK+ +   +
Sbjct: 8   IVDKIKLELE-KIRPKLIADGGNIEFINYKDGILKIRFLGECAHCELSHITLKFAIEKNI 66

Query: 177 NHFVPEVKDIRTV 189
              +PEV  +  V
Sbjct: 67  KEKIPEVNKVIEV 79


>gi|86134908|ref|ZP_01053490.1| NifU-like protein [Polaribacter sp. MED152]
 gi|85821771|gb|EAQ42918.1| NifU-like protein [Polaribacter sp. MED152]
          Length = 78

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +++ LD  +RP +  DGG+I      D IV + ++GAC+GC     TLK GV   +  +
Sbjct: 9   NVEKALD-EIRPFLMSDGGNIKLLSIEDAIVKVQLQGACTGCSVNQMTLKNGVEATIKKY 67

Query: 180 VPEVKDIRTV 189
            P+++ +  V
Sbjct: 68  APQIEQVINV 77


>gi|253700042|ref|YP_003021231.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21]
 gi|251774892|gb|ACT17473.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21]
          Length = 73

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +K +L+ ++RPA+  DGGD+ + +   DGIV + + GAC  CP ++ TLK G+   + 
Sbjct: 3   EEVKAILE-QIRPALQADGGDVELVEVTDDGIVKVRLVGACGHCPMSTMTLKMGIERTIK 61

Query: 178 HFVPEVKDIRTV 189
             +P +K++  V
Sbjct: 62  DKIPGIKEVVAV 73


>gi|319891909|ref|YP_004148784.1| Nitrogen-fixing NifU domain protein [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161605|gb|ADV05148.1| Nitrogen-fixing NifU domain protein [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465000|gb|ADX77153.1| nitrogen fixation protein NifU [Staphylococcus pseudintermedius
           ED99]
          Length = 80

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            ++ +  ++ EV++ ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENATMYDQVAEVIE-KLRPFLLRDGGDCELVDVEDGIVKLQLLGACGTCPSSTITLKAGI 62

Query: 173 ANIL 176
              L
Sbjct: 63  ERAL 66


>gi|323343211|ref|ZP_08083442.1| Fe/S-biogenesis protein NfuA [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322463275|gb|EFY08470.1| Fe/S-biogenesis protein NfuA [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 79

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +RI E LD ++RP + RDGGD+ F     +G+V + + GAC GC     TLK GV  +L 
Sbjct: 5   ERIIESLD-KIRPYIQRDGGDMEFVSVDENGVVTVKLLGACIGCGLIDYTLKGGVEALLM 63

Query: 178 HFVPEV 183
             +PEV
Sbjct: 64  DEIPEV 69


>gi|111021577|ref|YP_704549.1| nitrogen fixation protein [Rhodococcus jostii RHA1]
 gi|110821107|gb|ABG96391.1| possible nitrogen fixation protein [Rhodococcus jostii RHA1]
          Length = 318

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V  R+   LD+ VRP +   GGD+   G  +G+V L + G+C  CPS++ TL+  V + +
Sbjct: 99  VETRVATALDS-VRPYLGSHGGDVELLGVVEGVVRLRLTGSCQSCPSSAVTLELAVKDAV 157

Query: 177 NHFVPEVKDIRTV 189
               PE  DI  V
Sbjct: 158 LAAAPETVDIEVV 170


>gi|222526228|ref|YP_002570699.1| Rieske (2Fe-2S) domain-containing protein [Chloroflexus sp.
           Y-400-fl]
 gi|222450107|gb|ACM54373.1| Rieske (2Fe-2S) domain protein [Chloroflexus sp. Y-400-fl]
          Length = 285

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + R + VLD+  RP +   GGD      RDG+ +L + G+C+GC  ++ TL+  V  +L 
Sbjct: 92  ITRARRVLDS-ARPYMQSHGGDAELIDVRDGVAYLRLHGSCNGCSLSAFTLRKHVEEVLL 150

Query: 178 HFVPEVKDIRTV 189
             VPE+  +  V
Sbjct: 151 REVPEITRLEVV 162


>gi|158520102|ref|YP_001527972.1| NifU domain-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158508928|gb|ABW65895.1| nitrogen-fixing NifU domain protein [Desulfococcus oleovorans Hxd3]
          Length = 72

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +++K  LD ++RP +  DGGD+      +G V + ++GAC+GCP +  TLK  +   L  
Sbjct: 3   EQVKAALD-KIRPQLQADGGDVELVDVENGNVSVRLKGACAGCPMSQITLKQRIEAYLKK 61

Query: 179 FVPEVKDIRTV 189
            VP V ++  V
Sbjct: 62  TVPGVINVEKV 72


>gi|116072270|ref|ZP_01469537.1| NifU-like protein [Synechococcus sp. BL107]
 gi|116064792|gb|EAU70551.1| NifU-like protein [Synechococcus sp. BL107]
          Length = 81

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +  ++ ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETKALTLENVETVLDE-LRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDI 186
           +   +   +PEV ++
Sbjct: 63  IERKMRESIPEVSEV 77


>gi|82548259|gb|ABB82950.1| uncharacterized protein with NifU-like and HesB-like domains
           [uncultured organism HF70_19B12]
          Length = 187

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 25  EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEH 84
           E  +H+S+  E E   LA RI  I G     F YD   +       + +   V G  +  
Sbjct: 10  EMLLHYSSQAE-EGDSLALRI-EIVGRGPKGFQYDLQFIDISDASADDVAQEVRGFQVRI 67

Query: 85  FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV-----VQRIKEVLDNRVRPAVARDGGD 139
            +     +    L D K   MG G   E+ + +      QR+ EV+D  V PAVA  GG 
Sbjct: 68  AMRSAKYLEGATL-DFKETLMGGGFSFENPNPLWIDDLSQRVAEVIDKNVNPAVASHGGH 126

Query: 140 IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           +   G       ++  G C GC  A  TLK GV  ++   VPE+ ++
Sbjct: 127 VDLVGVDANKAIIAFGGGCQGCGMADVTLKQGVEVMIMDNVPEIIEV 173


>gi|33866219|ref|NP_897778.1| NifU-like protein [Synechococcus sp. WH 8102]
 gi|78212340|ref|YP_381119.1| NifU-like protein [Synechococcus sp. CC9605]
 gi|33639194|emb|CAE08202.1| NifU-like protein [Synechococcus sp. WH 8102]
 gi|78196799|gb|ABB34564.1| NifU-like protein [Synechococcus sp. CC9605]
          Length = 81

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +  ++ +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETMALTLENVEKVLDE-LRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDIRTV 189
           +   +   +PEV ++  V
Sbjct: 63  IERKMRESIPEVSEVVQV 80


>gi|269928406|ref|YP_003320727.1| nitrogen-fixing NifU domain-containing protein [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787763|gb|ACZ39905.1| nitrogen-fixing NifU domain protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 290

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V +R+ + LD RVRP +   GGD+      DG+  + +RG C GCP+++ TL+  +   +
Sbjct: 88  VEERVGQALD-RVRPYLHSHGGDVDLLEIVDGVARVRLRGTCRGCPASAVTLRLAIERAV 146

Query: 177 NHFVPEVKDIRTV 189
           +   P++  I  V
Sbjct: 147 HELAPDLDGIEAV 159


>gi|254524604|ref|ZP_05136659.1| protein GntY [Stenotrophomonas sp. SKA14]
 gi|219722195|gb|EED40720.1| protein GntY [Stenotrophomonas sp. SKA14]
          Length = 199

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           +++V+R+  V++N + P +A  GG +  +    DG+V L   G C GC  A  TLK G+ 
Sbjct: 107 ASLVERVHWVVENEINPQLASHGGKVAVQEVSADGVVLLRFGGGCQGCGMADVTLKQGIE 166

Query: 174 NILNHFVPEVKDIR 187
             L   VP V  +R
Sbjct: 167 KTLMGRVPGVTAVR 180


>gi|88801953|ref|ZP_01117481.1| NifU-like protein [Polaribacter irgensii 23-P]
 gi|88782611|gb|EAR13788.1| NifU-like protein [Polaribacter irgensii 23-P]
          Length = 78

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 122 KEVLDN------RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           +E L+N       +RP +  DGG+I      DG+V + + GAC+GC     TLK GV   
Sbjct: 4   EETLENVEKALEEIRPFLMSDGGNIKLLSIEDGVVKVQLEGACTGCSVNQMTLKNGVEAT 63

Query: 176 LNHFVPEVKDIRTV 189
           +  + P++ ++  V
Sbjct: 64  IKKYAPQIVEVINV 77


>gi|159902957|ref|YP_001550301.1| NifU-like protein [Prochlorococcus marinus str. MIT 9211]
 gi|159888133|gb|ABX08347.1| NifU-like protein [Prochlorococcus marinus str. MIT 9211]
          Length = 81

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +
Sbjct: 13  VEKVLDE-LRPFLMADGGNVEIVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREMI 71

Query: 181 PEVKDI 186
           PEV ++
Sbjct: 72  PEVSEV 77


>gi|268325898|emb|CBH39486.1| conserved hypothetical protein, containing NifU-like domain
           [uncultured archaeon]
          Length = 116

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++KEV++  ++P  A DGG I      D    L + GAC+GCP +  TL   V   L   
Sbjct: 4   KVKEVIEKELKPLFAVDGGGIELVSVDDSEAKLKLSGACAGCPMSQYTLANIVEVTLKEK 63

Query: 180 VPEVKDI 186
           VPE+K++
Sbjct: 64  VPELKEV 70


>gi|325972864|ref|YP_004249055.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta sp.
           Buddy]
 gi|324028102|gb|ADY14861.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta sp.
           Buddy]
          Length = 75

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++K  +++ +RP++  DGGDI F       V + ++GAC+GCP +  TLK GV   L +F
Sbjct: 4   KVKRAIED-IRPSLQNDGGDIEFVSLVGSDVTVRLKGACAGCPMSQMTLKSGVERYLRNF 62

Query: 180 V 180
           V
Sbjct: 63  V 63


>gi|16332125|ref|NP_442853.1| NifU protein [Synechocystis sp. PCC 6803]
 gi|1653754|dbj|BAA18665.1| NifU protein [Synechocystis sp. PCC 6803]
          Length = 76

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +  ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L 
Sbjct: 5   LNNVETVLDE-LRPYLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKLR 63

Query: 178 HFVPEVKDIRTV 189
             +PE+ ++  V
Sbjct: 64  EMIPEIAEVEQV 75


>gi|78189610|ref|YP_379948.1| NifU protein, putative [Chlorobium chlorochromatii CaD3]
 gi|78171809|gb|ABB28905.1| NifU protein, putative [Chlorobium chlorochromatii CaD3]
          Length = 84

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
           S D++ S  ++  R+   L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 2   SKDYLPSSDSLYDRVIAALET-VRPYLQADGGDCQLVGISKDMVVDVKLLGACGSCPMST 60

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   +PE+  + +V
Sbjct: 61  LTLRAGVEQAIKKAIPEIVRVESV 84


>gi|95929342|ref|ZP_01312085.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684]
 gi|95134458|gb|EAT16114.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684]
          Length = 74

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++I+  LD  VRP +  DGG++      D G+V + + GAC  CP ++ TLK G+  IL 
Sbjct: 3   EQIEAALDE-VRPTLLADGGNVELVDVSDDGVVSVKLVGACGSCPMSTVTLKMGIERILL 61

Query: 178 HFVPEVKDIRTV 189
             VP VK++  V
Sbjct: 62  EKVPGVKEVVQV 73


>gi|283851976|ref|ZP_06369252.1| Fe-S cluster assembly protein NifU [Desulfovibrio sp. FW1012B]
 gi|283572700|gb|EFC20684.1| Fe-S cluster assembly protein NifU [Desulfovibrio sp. FW1012B]
          Length = 283

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           + +V++  +RP + +DGGDI         V +S+RGAC GCP ++ TL   V N L   V
Sbjct: 213 VTKVMEEEIRPNLKKDGGDIELVDIDGHTVVVSLRGACKGCPKSNLTLTEFVQNRLRELV 272

Query: 181 -PEV 183
            PE+
Sbjct: 273 EPEI 276


>gi|192359576|ref|YP_001983001.1| yhgI protein [Cellvibrio japonicus Ueda107]
 gi|190685741|gb|ACE83419.1| yhgI protein [Cellvibrio japonicus Ueda107]
          Length = 197

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  DS +  RI  VL N V P++A  GG++ + +   D I  L   G C GC S + TLK
Sbjct: 107 VTDDSPLEDRINYVLYNDVNPSLAAHGGNVSLVEVTEDMIAILKFGGGCQGCGSVALTLK 166

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+   L   +PE+K IR V
Sbjct: 167 QGIEVQLMDKLPELKGIRDV 186


>gi|56751077|ref|YP_171778.1| putative NifU-like protein [Synechococcus elongatus PCC 6301]
 gi|81299261|ref|YP_399469.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
 gi|24414813|emb|CAD55626.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
 gi|56686036|dbj|BAD79258.1| putative NifU-like protein [Synechococcus elongatus PCC 6301]
 gi|81168142|gb|ABB56482.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
          Length = 81

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L + GAC  CPS++ TL+ G+   L  
Sbjct: 11  ENVETVLDE-LRPYLIADGGNVELVELDGPIVKLRLNGACGSCPSSTMTLRMGIERKLRE 69

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 70  SIPEISEVEQV 80


>gi|315225280|ref|ZP_07867097.1| nitrogen fixation protein NifU [Capnocytophaga ochracea F0287]
 gi|314944963|gb|EFS96995.1| nitrogen fixation protein NifU [Capnocytophaga ochracea F0287]
          Length = 79

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILN 177
           Q++ + LD ++RP +  DGGDI      DG IV + + G C+ C     TLK GV   + 
Sbjct: 8   QKVIKALD-KIRPYLQNDGGDISLVDIEDGKIVKVRLEGTCTNCSVNQLTLKSGVEMTIK 66

Query: 178 HFVPEVKDIRTV 189
            FVP+++ + +V
Sbjct: 67  EFVPQIEKVISV 78


>gi|87125583|ref|ZP_01081428.1| NifU-like protein [Synechococcus sp. RS9917]
 gi|86166883|gb|EAQ68145.1| NifU-like protein [Synechococcus sp. RS9917]
          Length = 81

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKLRE 69

Query: 179 FVPEVKDIRTV 189
            +PEV ++  V
Sbjct: 70  MIPEVSEVVQV 80


>gi|257790861|ref|YP_003181467.1| nitrogen-fixing NifU domain-containing protein [Eggerthella lenta
           DSM 2243]
 gi|317488428|ref|ZP_07946981.1| NifU-like domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|325831888|ref|ZP_08164985.1| NifU-like protein [Eggerthella sp. HGA1]
 gi|257474758|gb|ACV55078.1| nitrogen-fixing NifU domain protein [Eggerthella lenta DSM 2243]
 gi|316912472|gb|EFV34028.1| NifU-like domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|325486209|gb|EGC88661.1| NifU-like protein [Eggerthella sp. HGA1]
          Length = 77

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 129 VRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           +RP++  DGGD+ +     DG+V + ++GAC GCP +  TL  GV  IL   VP V  +
Sbjct: 14  IRPSLQADGGDVRLVDVNEDGVVSVELQGACKGCPMSQMTLANGVERILKERVPGVTKV 72


>gi|255069975|ref|XP_002507069.1| iron-sulfur cluster scaffold protein, plastid precursor [Micromonas
           sp. RCC299]
 gi|226522344|gb|ACO68327.1| iron-sulfur cluster scaffold protein, plastid precursor [Micromonas
           sp. RCC299]
          Length = 393

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           N VRP +A DGGD+   G  DGIV + M GAC  C S++ TLK G+   L
Sbjct: 250 NEVRPFLAADGGDVEVVGIEDGIVAVRMFGACGTCSSSTATLKGGIEATL 299


>gi|297792273|ref|XP_002864021.1| hypothetical protein ARALYDRAFT_331396 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297309856|gb|EFH40280.1| hypothetical protein ARALYDRAFT_331396 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 707

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   L  
Sbjct: 87  ENVESVLDE-IRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERRLME 145

Query: 179 FVPEVKDIRTV 189
            +PE+  +  V
Sbjct: 146 KIPEIVAVEAV 156


>gi|189345962|ref|YP_001942491.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245]
 gi|189340109|gb|ACD89512.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245]
          Length = 86

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG-YRDGIVFLSMRGACSGCPSAS 165
           S D++ +  A+  R+   L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 4   SKDYLPNSDALYDRVIAALET-VRPYLQVDGGDCQLVGITKDMVVDVKLLGACGSCPMST 62

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   +PE+  + +V
Sbjct: 63  ITLRAGVEQAIKKAIPEIARVESV 86


>gi|119493943|ref|ZP_01624504.1| putative NifU-like protein [Lyngbya sp. PCC 8106]
 gi|119452300|gb|EAW33495.1| putative NifU-like protein [Lyngbya sp. PCC 8106]
          Length = 79

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  
Sbjct: 9   ENVETVLDE-LRPYLMADGGNVEIVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLRE 67

Query: 179 FVPEVKDIRTV 189
            +PE+ ++  V
Sbjct: 68  KIPEIAEVVAV 78


>gi|330720100|gb|EGG98512.1| hypothetical protein imdm_2277 [gamma proteobacterium IMCC2047]
          Length = 195

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIV-FLSMRGACSGCPSASETLK 169
           +  +S + +R+  VL   V P +A  GG++      D  V  L   G C GC S   TLK
Sbjct: 105 VNENSTLEERVNYVLWTEVNPMLASHGGEVSLMEIADETVAVLKFGGGCQGCSSVDVTLK 164

Query: 170 YGVANILNHFVPEVKDIR 187
            GV   L   +PE+ +IR
Sbjct: 165 EGVEKTLREHIPELTEIR 182


>gi|149195166|ref|ZP_01872257.1| Nitrogen-fixing NifU-like protein [Caminibacter mediatlanticus
           TB-2]
 gi|149134718|gb|EDM23203.1| Nitrogen-fixing NifU-like protein [Caminibacter mediatlanticus
           TB-2]
          Length = 98

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             +RP +  DGGD+     +  IVF+ ++G C GC SA  TLKYG+   L  
Sbjct: 20  EEIRPMLQMDGGDVKLIDVKKPIVFVQLQGGCVGCASAGATLKYGIEKALKE 71


>gi|257457207|ref|ZP_05622382.1| nitrogen-fixing NifU domain protein [Treponema vincentii ATCC
           35580]
 gi|257445358|gb|EEV20426.1| nitrogen-fixing NifU domain protein [Treponema vincentii ATCC
           35580]
          Length = 94

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++ LD  VRP +   GGD+    + DG+V   + G C+GCP+A  T +  +   L  
Sbjct: 3   EELEKTLDTYVRPLLRTHGGDMQVVDFTDGVVKFKLHGHCAGCPAADFTTENLIQTELMA 62

Query: 179 FVPEVK 184
            +PEVK
Sbjct: 63  HLPEVK 68


>gi|121534267|ref|ZP_01666091.1| nitrogen-fixing NifU domain protein [Thermosinus carboxydivorans
           Nor1]
 gi|121307037|gb|EAX47955.1| nitrogen-fixing NifU domain protein [Thermosinus carboxydivorans
           Nor1]
          Length = 98

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           I++VLD +VRP++   GGDI  +   D G + + + GACS CP A +TL   V   L   
Sbjct: 8   IQQVLDEKVRPSLLSHGGDISLQEITDDGYIKVRLTGACSTCPGAQQTLAEVVEAALRDA 67

Query: 180 VPEVK 184
            P+++
Sbjct: 68  CPDLQ 72


>gi|332292115|ref|YP_004430724.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332170201|gb|AEE19456.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 80

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           + + Q++++ L+  +RP +  DGGDI   G   D IV + ++GAC GC     TLK GV 
Sbjct: 4   AELTQKVEDALE-EIRPFLQSDGGDITLLGIENDTIVRVQLQGACVGCSVNQMTLKSGVE 62

Query: 174 NILNHFVPEVKDIRTV 189
             +    P+++++  V
Sbjct: 63  MTIKKHAPQIEEVINV 78


>gi|296171555|ref|ZP_06852819.1| Rieske family iron-sulfur cluster-binding protein [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295894117|gb|EFG73878.1| Rieske family iron-sulfur cluster-binding protein [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 305

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +R+ + LD RVRP +   GGD+ + +   DG+V L+  G+C  CPS++ TL+  V + + 
Sbjct: 104 RRVSDALD-RVRPYLGSHGGDVDLLEITDDGVVRLAFAGSCKSCPSSAVTLELAVQDAVC 162

Query: 178 HFVPEVKDIRTV 189
              PEV  I  V
Sbjct: 163 AAAPEVSSIEAV 174


>gi|58582689|ref|YP_201705.1| hypothetical protein XOO3066 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58427283|gb|AAW76320.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 211

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 112 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 171

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 172 TLKQGIEKTLMGRVPGVIAVR 192


>gi|84624576|ref|YP_451948.1| hypothetical protein XOO_2919 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166712246|ref|ZP_02243453.1| hypothetical protein Xoryp_12525 [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|123521499|sp|Q2P1A3|NFUA_XANOM RecName: Full=Fe/S biogenesis protein nfuA
 gi|84368516|dbj|BAE69674.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVIAVR 180


>gi|289665916|ref|ZP_06487497.1| hypothetical protein XcampvN_23290 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVIAVR 180


>gi|37522446|ref|NP_925823.1| hypothetical protein gsl2877 [Gloeobacter violaceus PCC 7421]
 gi|35213447|dbj|BAC90818.1| gsl2877 [Gloeobacter violaceus PCC 7421]
          Length = 85

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   +   +P 
Sbjct: 18  ELVLDELRPYLMSDGGNVELVEIEGPIVKLRLQGACGSCPSSTYTLKLGIERRMRELIPA 77

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 78  VAEVEQV 84


>gi|78186286|ref|YP_374329.1| NifU protein, putative [Chlorobium luteolum DSM 273]
 gi|78166188|gb|ABB23286.1| NifU protein, putative [Chlorobium luteolum DSM 273]
          Length = 89

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
           S D++ +  A+  R+   L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 7   SKDYLPNSDALYDRVIAALET-VRPYLQVDGGDCQLVGITKDMVVDVKLLGACGSCPMST 65

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   +PE+  + +V
Sbjct: 66  LTLRAGVEQAIKKAIPEIVRVESV 89


>gi|51246082|ref|YP_065966.1| nitrogen fixation protein (NifU) [Desulfotalea psychrophila LSv54]
 gi|50877119|emb|CAG36959.1| probable nitrogen fixation protein (NifU) [Desulfotalea
           psychrophila LSv54]
          Length = 277

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++I+EVLD  +RP + +D GDI         V +S+RGAC  C ++  T+K  V   L 
Sbjct: 206 IKKIEEVLDKVIRPVLKKDDGDIELVDVDGDFVTVSLRGACKSCSNSQTTIKEYVEKKLR 265

Query: 178 HFVPE 182
             V E
Sbjct: 266 ELVLE 270


>gi|255526287|ref|ZP_05393203.1| nitrogen-fixing NifU domain protein [Clostridium carboxidivorans
           P7]
 gi|296185211|ref|ZP_06853621.1| NifU-like domain protein [Clostridium carboxidivorans P7]
 gi|255510000|gb|EET86324.1| nitrogen-fixing NifU domain protein [Clostridium carboxidivorans
           P7]
 gi|296050045|gb|EFG89469.1| NifU-like domain protein [Clostridium carboxidivorans P7]
          Length = 96

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I++V++ +V+P +    GDI F    +GIV + + G CSGC SA  T++  V   +  
Sbjct: 4   EKIQKVIEEKVKPYLREHNGDIKFLEIENGIVKVKLLGQCSGCVSAKYTVENIVEAAMKE 63

Query: 179 FVPEVKDIRTV 189
            +PEV+ +  +
Sbjct: 64  EIPEVERVELI 74


>gi|255994758|ref|ZP_05427893.1| NifU family protein [Eubacterium saphenum ATCC 49989]
 gi|255993471|gb|EEU03560.1| NifU family protein [Eubacterium saphenum ATCC 49989]
          Length = 74

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           + IK  L+ +VRPA+  DGGD+ F  + D  +V + ++G C GCP +  T+K  +   L 
Sbjct: 3   EEIKAALE-KVRPALQMDGGDVEFVDFTDDKVVKVKLQGHCCGCPMSQMTVKGFIEKALR 61

Query: 178 HFVPEVKDIRTV 189
              P++K + TV
Sbjct: 62  ESFPDIKGVETV 73


>gi|194476553|ref|YP_002048732.1| NifU-like protein [Paulinella chromatophora]
 gi|171191560|gb|ACB42522.1| NifU-like protein [Paulinella chromatophora]
          Length = 81

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +  ++ ++ VL N +RP +  DGG++        +V + ++GAC  CPS++ TLK G
Sbjct: 4   ENLALTLENVETVL-NELRPFLIADGGNVEVAEIDGPVVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDI 186
           +   L   +PEV ++
Sbjct: 63  IERKLREAIPEVSEV 77


>gi|159028416|emb|CAO89859.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 78

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L   +
Sbjct: 10  VEKVLDE-MRPYLMSDGGNVELVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERRLREMI 68

Query: 181 PEVKDI 186
           PE+ ++
Sbjct: 69  PEIAEV 74


>gi|298527898|ref|ZP_07015302.1| Fe-S cluster assembly protein NifU [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511550|gb|EFI35452.1| Fe-S cluster assembly protein NifU [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 281

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +Q +  V+D  +RP++ +DGGDI         V +S RGAC+GCPS+  T K  V   L 
Sbjct: 208 MQLVTRVVDEEIRPSLHKDGGDIELVDIEGPKVMVSFRGACAGCPSSHLTAKEVVEKKLK 267

Query: 178 HFVP---EVKDIR 187
             V    +V+++R
Sbjct: 268 ERVDSQIQVEEVR 280


>gi|219847420|ref|YP_002461853.1| nitrogen-fixing NifU domain-containing protein [Chloroflexus
           aggregans DSM 9485]
 gi|219541679|gb|ACL23417.1| nitrogen-fixing NifU domain protein [Chloroflexus aggregans DSM
           9485]
          Length = 286

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V R + VLDN  RP +   GGD      RDG+ ++ + G+C+GC  ++ TL+  V   L 
Sbjct: 93  VTRARRVLDN-ARPYMQSHGGDAELVDVRDGVAYVRLHGSCNGCSLSAFTLRKHVEEALL 151

Query: 178 HFVPEVKDIRTV 189
             VPE+  +  V
Sbjct: 152 REVPEMTRLEVV 163


>gi|33862527|ref|NP_894087.1| NifU-like protein [Prochlorococcus marinus str. MIT 9313]
 gi|124023791|ref|YP_001018098.1| NifU-like protein [Prochlorococcus marinus str. MIT 9303]
 gi|33640640|emb|CAE20429.1| NifU-like protein [Prochlorococcus marinus str. MIT 9313]
 gi|123964077|gb|ABM78833.1| NifU-like protein [Prochlorococcus marinus str. MIT 9303]
          Length = 81

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L  
Sbjct: 11  ENVETVLDE-LRPFLMADGGNVEIVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKLRE 69

Query: 179 FVPEVKDIRTV 189
            +PEV ++  V
Sbjct: 70  MIPEVSEVVQV 80


>gi|188577468|ref|YP_001914397.1| protein GntY [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|254767336|sp|B2STN5|NFUA_XANOP RecName: Full=Fe/S biogenesis protein nfuA
 gi|188521920|gb|ACD59865.1| protein GntY [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVIAVR 180


>gi|46579079|ref|YP_009887.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603338|ref|YP_967738.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris DP4]
 gi|46448492|gb|AAS95146.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563567|gb|ABM29311.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris DP4]
 gi|311232925|gb|ADP85779.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris RCH1]
          Length = 281

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +Q + +VLD  +RP + +DGGDI         V +++RG C+ CPS+  TLK  V   L 
Sbjct: 208 MQLVMKVLDGEIRPRLQQDGGDIELVDMNGTEVMVALRGMCTSCPSSQLTLKEFVERTLR 267

Query: 178 HFVPEVKDIRTV 189
             V +   +R V
Sbjct: 268 DHVDQEIVVREV 279


>gi|150015239|ref|YP_001307493.1| NifU domain-containing protein [Clostridium beijerinckii NCIMB
           8052]
 gi|149901704|gb|ABR32537.1| nitrogen-fixing NifU domain protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 73

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 127 NRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           +++RP + RDGGD+ +     DG+V + M+GAC  CP A  T+K  +   L   VP V +
Sbjct: 10  DKIRPMLQRDGGDVELVDVSNDGVVSVKMQGACGNCPGAMMTIKMIIEQKLKEEVPGVTE 69

Query: 186 I 186
           +
Sbjct: 70  V 70


>gi|145219268|ref|YP_001129977.1| NifU domain-containing protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205432|gb|ABP36475.1| nitrogen-fixing NifU domain protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 86

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
           S D++ +  A+  R+   L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 4   SKDYLPNSDALYDRVIAALET-VRPYLQVDGGDCQLVGISKDMVVDVKLLGACGSCPMST 62

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   +PE+  + +V
Sbjct: 63  LTLRAGVEQAIKKAIPEIVRVESV 86


>gi|110637337|ref|YP_677544.1| hypothetical protein CHU_0925 [Cytophaga hutchinsonii ATCC 33406]
 gi|110280018|gb|ABG58204.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 86

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           ++ ++ R+++ L++ +RP +  DGG++ + +   D IV L + GAC  CP ++ TLK GV
Sbjct: 7   NTELLDRVEQALES-IRPYLITDGGNVRLVEITEDMIVKLELLGACGTCPMSAMTLKAGV 65

Query: 173 ANILNHFVPEVKDI 186
              +   VPE+K +
Sbjct: 66  EESIRKAVPEIKGV 79


>gi|42525980|ref|NP_971078.1| NifU domain-containing protein [Treponema denticola ATCC 35405]
 gi|41816030|gb|AAS10959.1| NifU domain protein [Treponema denticola ATCC 35405]
          Length = 75

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP +  DGGDI      + G V++ ++GAC  CP A  TLK GV   L    PEV ++ 
Sbjct: 14  VRPYLQADGGDIELDSVDEAGKVYVKLKGACGSCPMAIYTLKMGVEEQLKDMFPEVTEVV 73

Query: 188 TV 189
            V
Sbjct: 74  AV 75


>gi|310643918|ref|YP_003948676.1| nifu-like protein [Paenibacillus polymyxa SC2]
 gi|309248868|gb|ADO58435.1| NifU-like protein [Paenibacillus polymyxa SC2]
          Length = 79

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           ++ +  +   + EVL  ++RP + RDGGD       +GI  L   GAC+GCPSA+ TLK 
Sbjct: 1   MDENGVLFDEVSEVL-LKLRPFLLRDGGDAELVEVENGIAKLRFLGACNGCPSATITLKV 59

Query: 171 GVANILNHFVPEVKDIRTV 189
            +   +   + ++K++  V
Sbjct: 60  AIERAILEEIDDIKEVVQV 78


>gi|120554445|ref|YP_958796.1| HesB/YadR/YfhF-family protein [Marinobacter aquaeolei VT8]
 gi|120324294|gb|ABM18609.1| HesB/YadR/YfhF-family protein [Marinobacter aquaeolei VT8]
          Length = 195

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           +  D+ + +R+  VL + + P +A  GGD+      D  +  L   G C GC + S TLK
Sbjct: 104 VADDAPLPERVNYVLASEINPNLAAHGGDVSLVEIVDESVAVLRFGGGCQGCSAVSLTLK 163

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   VPE+  +R V
Sbjct: 164 QGVEKTLKERVPEISAVRDV 183


>gi|225849734|ref|YP_002729968.1| hypothetical protein PERMA_0171 [Persephonella marina EX-H1]
 gi|225645990|gb|ACO04176.1| conserved domain protein [Persephonella marina EX-H1]
          Length = 91

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
            G+ +  D A   +++EVL+ ++RP +  DGGD+       DG V++ + G+C GC  + 
Sbjct: 5   QGNKVNIDRA---KVEEVLE-QIRPMLRFDGGDVELVDIGEDGTVYVRLMGSCHGCAMSL 60

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TLK G+   L   +PEVK++  V
Sbjct: 61  VTLKGGIEMKLKEAIPEVKEVVAV 84


>gi|86608468|ref|YP_477230.1| NifU domain-containing protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557010|gb|ABD01967.1| NifU domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 80

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VL N +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 10  ENVEKVL-NELRPYLMADGGNVELVEIDGPVVKLRLQGACGACPSSTMTLKMGIERKLRE 68

Query: 179 FVPEVKDIRTV 189
            +P++ ++  V
Sbjct: 69  SIPDILEVEQV 79


>gi|325921235|ref|ZP_08183096.1| thioredoxin-like protein [Xanthomonas gardneri ATCC 19865]
 gi|325548298|gb|EGD19291.1| thioredoxin-like protein [Xanthomonas gardneri ATCC 19865]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 113 SDSA-VVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKY 170
           +DSA +V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  TLK 
Sbjct: 104 ADSASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADVTLKQ 163

Query: 171 GVANILNHFVPEVKDIR 187
           G+   L   VP V  +R
Sbjct: 164 GIEKTLMGRVPGVIAVR 180


>gi|325918641|ref|ZP_08180745.1| thioredoxin-like protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325535148|gb|EGD07040.1| thioredoxin-like protein [Xanthomonas vesicatoria ATCC 35937]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 113 SDSA-VVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKY 170
           +DSA +V+R++ V++N + P +A  GG +  +    DG+V L   G C GC  A  TLK 
Sbjct: 104 ADSASMVERVRWVVENEINPQLASHGGRVAVQEVSADGVVLLRFGGGCHGCGMADVTLKQ 163

Query: 171 GVANILNHFVPEVKDIR 187
           G+   L   VP V  +R
Sbjct: 164 GIEKTLMGRVPGVIAVR 180


>gi|312132200|ref|YP_003999540.1| nitrogeN-fixing nifu domain protein [Leadbetterella byssophila DSM
           17132]
 gi|311908746|gb|ADQ19187.1| nitrogen-fixing NifU domain protein [Leadbetterella byssophila DSM
           17132]
          Length = 83

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++++ LDN +RP +  DGG++ V +   D +V L   G+C  CP +S T K G+   +  
Sbjct: 7   KVEQALDN-IRPYLIADGGNVKVLEITEDKVVKLEFTGSCGSCPMSSMTFKAGLEEAILK 65

Query: 179 FVPEVKDIRTV 189
            VPE+K +  V
Sbjct: 66  NVPEIKSVEAV 76


>gi|87303149|ref|ZP_01085947.1| NifU-like protein [Synechococcus sp. WH 5701]
 gi|87282316|gb|EAQ74276.1| NifU-like protein [Synechococcus sp. WH 5701]
          Length = 97

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V+ ++ VLD  +RP +  DGG++         V + ++GAC  CPS++ TLK G+   L 
Sbjct: 26  VENVERVLDE-LRPYLMADGGNVEIVEIDGPTVKVRLQGACGSCPSSTMTLKMGIERKLR 84

Query: 178 HFVPEVKDI 186
             +PEV ++
Sbjct: 85  EAIPEVNEV 93


>gi|86605616|ref|YP_474379.1| NifU domain-containing protein [Synechococcus sp. JA-3-3Ab]
 gi|86554158|gb|ABC99116.1| NifU domain protein [Synechococcus sp. JA-3-3Ab]
          Length = 80

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VL N +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   L  
Sbjct: 10  ENVEKVL-NELRPYLQADGGNVELVEIDGPVVKLRLQGACGACPSSTLTLKMGIERKLRE 68

Query: 179 FVPEVKDIRTV 189
            +P++ ++  V
Sbjct: 69  SIPDILEVEQV 79


>gi|308234420|ref|ZP_07665157.1| nitrogen-fixing NifU domain protein [Atopobium vaginae DSM 15829]
 gi|328944265|ref|ZP_08241729.1| YhgI protein [Atopobium vaginae DSM 15829]
 gi|327491184|gb|EGF22959.1| YhgI protein [Atopobium vaginae DSM 15829]
          Length = 189

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           + I E   + +R ++  DGGDIV     D G+V L M GAC+GCP ++  +  GV  IL 
Sbjct: 115 REILEATLDVIRESLQADGGDIVLVNVSDDGVVTLDMVGACAGCPMSAYDMSEGVERILK 174

Query: 178 HFVP 181
             VP
Sbjct: 175 EHVP 178


>gi|33239869|ref|NP_874811.1| NifU-like protein [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237395|gb|AAP99463.1| Thioredoxin family protein [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 81

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +
Sbjct: 13  VEKVLD-ELRPFLMADGGNVEIVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLCEMI 71

Query: 181 PEVKDI 186
           PEV ++
Sbjct: 72  PEVSEV 77


>gi|218186519|gb|EEC68946.1| hypothetical protein OsI_37662 [Oryza sativa Indica Group]
          Length = 221

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD +VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +
Sbjct: 75  VESVLD-QVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKI 133

Query: 181 PEVKDIRTV 189
           P+V  +  V
Sbjct: 134 PDVAAVEPV 142


>gi|172035474|ref|YP_001801975.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142]
 gi|171696928|gb|ACB49909.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142]
          Length = 293

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I++VL+  +RP +A+DGGD+        +V ++++GAC  C S++ TLK G+ A +    
Sbjct: 225 IQQVLEEEIRPFLAKDGGDLELIDIEGDLVKVTLQGACGSCASSTATLKGGIEARLKERV 284

Query: 180 VPEV 183
            PE+
Sbjct: 285 SPEL 288


>gi|115487614|ref|NP_001066294.1| Os12g0176200 [Oryza sativa Japonica Group]
 gi|75147032|sp|Q84LK7|NIFU1_ORYSJ RecName: Full=NifU-like protein 1, chloroplastic; AltName:
           Full=OsNifu1; Flags: Precursor
 gi|30698492|dbj|BAC76603.1| NifU1 [Oryza sativa Japonica Group]
 gi|77553807|gb|ABA96603.1| nitrogen fixation protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113648801|dbj|BAF29313.1| Os12g0176200 [Oryza sativa Japonica Group]
          Length = 226

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD +VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +
Sbjct: 80  VESVLD-QVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKI 138

Query: 181 PEVKDIRTV 189
           P+V  +  V
Sbjct: 139 PDVAAVEPV 147


>gi|8777425|dbj|BAA97015.1| unnamed protein product [Arabidopsis thaliana]
          Length = 684

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   L  
Sbjct: 88  ENVESVLDE-IRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERRLME 146

Query: 179 FVPEV 183
            +PE+
Sbjct: 147 KIPEI 151


>gi|239624672|ref|ZP_04667703.1| predicted protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521058|gb|EEQ60924.1| predicted protein [Clostridiales bacterium 1_7_47FAA]
          Length = 96

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           I+ VL+  VRP ++  GG + V     +GI+++ M+G C+GCPSA ET+K  V   L   
Sbjct: 9   IEAVLNLFVRPQLSSHGGGLEVVDLDENGILWIEMQGGCAGCPSADETVKNLVQKELVTR 68

Query: 180 VPEVKDIR 187
           +P++K + 
Sbjct: 69  IPQIKGVE 76


>gi|329767228|ref|ZP_08258755.1| hypothetical protein HMPREF0428_00452 [Gemella haemolysans M341]
 gi|328836895|gb|EGF86542.1| hypothetical protein HMPREF0428_00452 [Gemella haemolysans M341]
          Length = 84

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IK  L+ ++RP + +DGG+I F  +++GI+ +   G C+ C  +  TLKY +   + 
Sbjct: 9   VDKIKFELE-KIRPKLIKDGGNIEFINFKNGILKIRFLGECAHCELSHITLKYAIEKTIV 67

Query: 178 HFVPEVKDI 186
             +PEV  +
Sbjct: 68  EKIPEVNKV 76


>gi|256819880|ref|YP_003141159.1| nitrogen-fixing NifU domain-containing protein [Capnocytophaga
           ochracea DSM 7271]
 gi|256581463|gb|ACU92598.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea DSM
           7271]
          Length = 79

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILN 177
           Q + + LD ++RP +  DGGDI      DG IV + + G C+ C     TLK GV   + 
Sbjct: 8   QEVIKALD-KIRPYLQNDGGDISLVDIEDGKIVKVRLEGTCTNCSVNQLTLKSGVEMTIK 66

Query: 178 HFVPEVKDIRTV 189
            FVP+++ + +V
Sbjct: 67  EFVPQIEKVISV 78


>gi|222616724|gb|EEE52856.1| hypothetical protein OsJ_35404 [Oryza sativa Japonica Group]
          Length = 219

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD +VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +
Sbjct: 73  VESVLD-QVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKI 131

Query: 181 PEVKDIRTV 189
           P+V  +  V
Sbjct: 132 PDVAAVEPV 140


>gi|57864812|gb|AAW56987.1| nitrogen fixation protein U [Cyanothece sp. ATCC 51142]
          Length = 285

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I++VL+  +RP +A+DGGD+        +V ++++GAC  C S++ TLK G+ A +    
Sbjct: 217 IQQVLEEEIRPFLAKDGGDLELIDIEGDLVKVTLQGACGSCASSTATLKGGIEARLKERV 276

Query: 180 VPEV 183
            PE+
Sbjct: 277 SPEL 280


>gi|21242852|ref|NP_642434.1| hypothetical protein XAC2117 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|51702177|sp|Q8PKQ2|NFUA_XANAC RecName: Full=Fe/S biogenesis protein nfuA
 gi|21108342|gb|AAM36970.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 199

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    +G+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSAEGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   VP V  +R
Sbjct: 160 TLKQGIEKTLMGRVPGVTAVR 180


>gi|319787304|ref|YP_004146779.1| HesB/YadR/YfhF-family protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465816|gb|ADV27548.1| HesB/YadR/YfhF-family protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 198

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           +++V+R++ V++N + P +A  GG    +    DG V+L   G C GC  A  TLK G+ 
Sbjct: 106 ASIVERVRWVMENEINPQLASHGGRATVEEVSADGTVWLRFGGGCHGCGMADVTLKQGIE 165

Query: 174 NILNHFVPEVKDIR 187
             L   VP V  +R
Sbjct: 166 KTLIARVPGVTAVR 179


>gi|67922888|ref|ZP_00516385.1| Aminotransferase, class V:Nitrogen-fixing NifU, C-terminal
           [Crocosphaera watsonii WH 8501]
 gi|67855238|gb|EAM50500.1| Aminotransferase, class V:Nitrogen-fixing NifU, C-terminal
           [Crocosphaera watsonii WH 8501]
          Length = 469

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I+++L+  V+P +A+DGGDI        +V + ++GAC  CPS++ TLK  + A + +  
Sbjct: 401 IQQILEEEVKPFLAQDGGDIDLYDIEGDLVKVVLKGACDACPSSTATLKLAIEARLKDRV 460

Query: 180 VPEVKDI 186
            PE+  I
Sbjct: 461 DPELTVI 467


>gi|302784594|ref|XP_002974069.1| hypothetical protein SELMODRAFT_16558 [Selaginella moellendorffii]
 gi|300158401|gb|EFJ25024.1| hypothetical protein SELMODRAFT_16558 [Selaginella moellendorffii]
          Length = 170

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 106 GSGDF-IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           GSG +  E+     + + +VLD  VRP +  DGG++      DG V L ++ AC  CPS+
Sbjct: 19  GSGLYSAETYDFTAENVDKVLD-EVRPYLVADGGNVAVVSVADGTVSLELQRACGTCPSS 77

Query: 165 SETLKYGVANILNH----FVPEVKDI 186
           + T+K G+  +L       V EV DI
Sbjct: 78  TSTMKMGIERVLREKFGDAVKEVVDI 103


>gi|224130940|ref|XP_002320962.1| predicted protein [Populus trichocarpa]
 gi|222861735|gb|EEE99277.1| predicted protein [Populus trichocarpa]
          Length = 220

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q +  VL+  VRP +  DGG++      DG++ L ++GAC  C S+  T+K G+  +L  
Sbjct: 77  QNVDLVLE-EVRPYLISDGGNVDVVSVEDGVITLKLQGACGNCASSETTMKMGIERVLKE 135

Query: 179 -FVPEVKDIRTV 189
            F   V+DIR +
Sbjct: 136 KFGDAVQDIRQL 147


>gi|77917669|ref|YP_355484.1| Fe-S cluster assembly protein NifU [Pelobacter carbinolicus DSM
           2380]
 gi|77543752|gb|ABA87314.1| Fe-S cluster assembly protein NifU [Pelobacter carbinolicus DSM
           2380]
          Length = 281

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           S+   ++ I+E+L+  + P +  DGGD+         V +++RG CS CP +S TLK+ V
Sbjct: 203 SNLQKIRLIEEILEREILPPIRSDGGDLELIDIDGSKVLVALRGTCSFCPQSSFTLKHFV 262

Query: 173 ANILNHFV-PEVK 184
              L  FV PE++
Sbjct: 263 EAKLREFVSPEIE 275


>gi|18423084|ref|NP_568715.1| NFU2 (NIFU-LIKE PROTEIN 2); structural molecule [Arabidopsis
           thaliana]
 gi|75163219|sp|Q93W20|NIFU2_ARATH RecName: Full=NifU-like protein 2, chloroplastic; Short=AtCNfu2;
           Short=AtCnfU-V; Flags: Precursor
 gi|13878181|gb|AAK44168.1|AF370353_1 unknown protein [Arabidopsis thaliana]
 gi|16226434|gb|AAL16167.1|AF428399_1 AT5g49940/K9P8_8 [Arabidopsis thaliana]
 gi|17104539|gb|AAL34158.1| unknown protein [Arabidopsis thaliana]
 gi|26452324|dbj|BAC43248.1| unknown protein [Arabidopsis thaliana]
 gi|28207818|emb|CAD55559.1| NFU2 protein [Arabidopsis thaliana]
 gi|332008490|gb|AED95873.1| NifU-like protein 2 [Arabidopsis thaliana]
          Length = 235

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   L  
Sbjct: 88  ENVESVLDE-IRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERRLME 146

Query: 179 FVPEV 183
            +PE+
Sbjct: 147 KIPEI 151


>gi|325475673|gb|EGC78849.1| NifU domain-containing protein [Treponema denticola F0402]
          Length = 75

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +RP +  DGGDI      + G V++ ++GAC  CP A  TLK GV   L    PEV ++ 
Sbjct: 14  IRPYLQADGGDIELDSVDEAGKVYVKLKGACGSCPMAIYTLKMGVEEQLKDMFPEVTEVV 73

Query: 188 TV 189
            V
Sbjct: 74  AV 75


>gi|163310812|pdb|2JNV|A Chain A, Solution Structure Of C-Terminal Domain Of Nifu-Like
           Protein From Oryza Sativa
          Length = 91

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD +VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +
Sbjct: 10  VESVLD-QVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKI 68

Query: 181 PEVKDIRTV 189
           P+V  +  V
Sbjct: 69  PDVAAVEPV 77


>gi|90655381|gb|ABD96222.1| NifU-like protein [uncultured marine type-A Synechococcus GOM 3M9]
          Length = 81

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKMRE 69

Query: 179 FVPEVKDIRTV 189
            +PEV ++  V
Sbjct: 70  AIPEVSEVVQV 80


>gi|149374734|ref|ZP_01892507.1| Thioredoxin-like protein [Marinobacter algicola DG893]
 gi|149360623|gb|EDM49074.1| Thioredoxin-like protein [Marinobacter algicola DG893]
          Length = 195

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           ++ ++ +  RI+ +L + + P +A  GG++ + +   + I  L   G C GC + S TLK
Sbjct: 104 VDENAPLPDRIQYILASEINPNLAAHGGEVSLVEVAEESIAVLRFGGGCQGCSAVSLTLK 163

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV + L   VPE+  +R V
Sbjct: 164 QGVESTLKERVPEITAVRDV 183


>gi|260436644|ref|ZP_05790614.1| NifU domain protein [Synechococcus sp. WH 8109]
 gi|260414518|gb|EEX07814.1| NifU domain protein [Synechococcus sp. WH 8109]
          Length = 76

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   + 
Sbjct: 5   LENVEKVLDE-LRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKMR 63

Query: 178 HFVPEVKDIRTV 189
             +PEV ++  V
Sbjct: 64  ESIPEVSEVVQV 75


>gi|190575128|ref|YP_001972973.1| putative iron-sulphur cluster/NifU like protein [Stenotrophomonas
           maltophilia K279a]
 gi|254767331|sp|B2FM87|NFUA_STRMK RecName: Full=Fe/S biogenesis protein nfuA
 gi|190013050|emb|CAQ46682.1| putative iron-sulphur cluster/NifU like protein [Stenotrophomonas
           maltophilia K279a]
          Length = 199

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           +++V+R+  V++N + P +A  GG +  +    +G+V L   G C GC  A  TLK G+ 
Sbjct: 107 ASLVERVHWVVENEINPQLASHGGKVAVQEVSAEGVVLLRFGGGCQGCGMADVTLKQGIE 166

Query: 174 NILNHFVPEVKDIR 187
             L   VP V  +R
Sbjct: 167 KTLMGRVPGVTAVR 180


>gi|326526691|dbj|BAK00734.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 225

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++V       +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 80  ELVLDEVRPYLMADGGNVVLHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 139

Query: 183 V 183
           +
Sbjct: 140 I 140


>gi|194319991|pdb|2Z51|A Chain A, Crystal Structure Of Arabidopsis Cnfu Involved In Iron-
           Sulfur Cluster Biosynthesis
          Length = 154

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        +V + ++GAC  CPS++ T+K G+   L  
Sbjct: 7   ENVESVLDE-IRPYLMSDGGNVALHEIDGNVVRVKLQGACGSCPSSTMTMKMGIERRLME 65

Query: 179 FVPEV 183
            +PE+
Sbjct: 66  KIPEI 70


>gi|332878832|ref|ZP_08446547.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332683183|gb|EGJ56065.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 78

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILN 177
           + +K  LD ++RP +  DGGDI      D  IV + + G C+ C     TLK GV   + 
Sbjct: 8   EEVKNALD-KIRPYLQNDGGDITLVDIEDDKIVKVRLEGTCTNCAVNQMTLKSGVEMTIK 66

Query: 178 HFVPEVKDI 186
            FVP+++ +
Sbjct: 67  EFVPQIEQV 75


>gi|78185152|ref|YP_377587.1| NifU-like protein [Synechococcus sp. CC9902]
 gi|78169446|gb|ABB26543.1| NifU-like protein [Synechococcus sp. CC9902]
          Length = 81

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ +  +  +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETMALTLDNVEKVLDE-LRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDIRTV 189
           +   +   +PEV ++  V
Sbjct: 63  IERKMRESIPEVSEVVQV 80


>gi|34558002|ref|NP_907817.1| hypothetical protein WS1690 [Wolinella succinogenes DSM 1740]
 gi|34483720|emb|CAE10717.1| conserved hypothetical protein-Thioredoxin-like proteins and
           domains [Wolinella succinogenes]
          Length = 91

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ ++ VL+ +VRP +A DGGD+   G     V++ + GAC GC S++ TLK G+
Sbjct: 5   SDDDLLKPVERVLE-KVRPTLALDGGDVSLIGVAAPKVYVRLEGACKGCASSALTLKNGI 63


>gi|326530153|dbj|BAK08356.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 227

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++V       +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 82  ELVLDEVRPYLMADGGNVVLHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 141

Query: 183 V 183
           +
Sbjct: 142 I 142


>gi|15597044|ref|NP_250538.1| hypothetical protein PA1847 [Pseudomonas aeruginosa PAO1]
 gi|107101280|ref|ZP_01365198.1| hypothetical protein PaerPA_01002314 [Pseudomonas aeruginosa PACS2]
 gi|116049799|ref|YP_791394.1| hypothetical protein PA14_40630 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152984911|ref|YP_001348805.1| hypothetical protein PSPA7_3445 [Pseudomonas aeruginosa PA7]
 gi|218892197|ref|YP_002441064.1| hypothetical protein PLES_34781 [Pseudomonas aeruginosa LESB58]
 gi|254234942|ref|ZP_04928265.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254240240|ref|ZP_04933562.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296389760|ref|ZP_06879235.1| hypothetical protein PaerPAb_16491 [Pseudomonas aeruginosa PAb1]
 gi|313110548|ref|ZP_07796433.1| hypothetical protein PA39016_002410135 [Pseudomonas aeruginosa
           39016]
 gi|51702153|sp|Q9I2P8|NFUA_PSEAE RecName: Full=Fe/S biogenesis protein nfuA
 gi|122258910|sp|Q02KZ2|NFUA_PSEAB RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767309|sp|A6V6X0|NFUA_PSEA7 RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767310|sp|B7VB28|NFUA_PSEA8 RecName: Full=Fe/S biogenesis protein nfuA
 gi|9947835|gb|AAG05236.1|AE004611_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115585020|gb|ABJ11035.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166873|gb|EAZ52384.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126193618|gb|EAZ57681.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|150960069|gb|ABR82094.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
 gi|218772423|emb|CAW28205.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310882935|gb|EFQ41529.1| hypothetical protein PA39016_002410135 [Pseudomonas aeruginosa
           39016]
          Length = 194

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETL 168
            +  DS + +RI   L   + P +A  GG + +     D I  L   G C GC     TL
Sbjct: 103 MVNEDSPITERINYYLQTEINPGLASHGGQVSLVDVVEDNIAVLRFGGGCQGCGMVDMTL 162

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K GV   L   +PE+K +R V
Sbjct: 163 KDGVEKTLIERIPELKGVRDV 183


>gi|302792717|ref|XP_002978124.1| hypothetical protein SELMODRAFT_108525 [Selaginella moellendorffii]
 gi|300154145|gb|EFJ20781.1| hypothetical protein SELMODRAFT_108525 [Selaginella moellendorffii]
          Length = 185

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP +  DGG++  +     +V L ++GAC  CPS+  T+K G+   L  
Sbjct: 38  ENVEMVLDE-VRPYLMSDGGNVALEEIDGLVVKLKLQGACGSCPSSLMTMKMGIEARLKE 96

Query: 179 FVPEVKDIRTV 189
            +PE+  +  V
Sbjct: 97  KIPEIIGVEQV 107


>gi|268323348|emb|CBH36936.1| conserved hypothetical protein, NifU-like domain family [uncultured
           archaeon]
          Length = 87

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K V++  +RP +  +GG I  KG  D G+V + + GAC+GCP +  TL   V   
Sbjct: 1   MLEEVKGVIEKDIRPLLEMEGGSIELKGVDDDGVVRVQLTGACAGCPMSQYTLVNFVEAT 60

Query: 176 LNHFVPEVKDI 186
           L   VP VK +
Sbjct: 61  LKDKVPGVKQV 71


>gi|49082646|gb|AAT50723.1| PA1847 [synthetic construct]
          Length = 195

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETL 168
            +  DS + +RI   L   + P +A  GG + +     D I  L   G C GC     TL
Sbjct: 103 MVNEDSPITERINYYLQTEINPGLASHGGQVSLVDVVEDNIAVLRFGGGCQGCGMVDMTL 162

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K GV   L   +PE+K +R V
Sbjct: 163 KDGVEKTLIERIPELKGVRDV 183


>gi|194366446|ref|YP_002029056.1| HesB/YadR/YfhF-family protein [Stenotrophomonas maltophilia R551-3]
 gi|254767330|sp|B4SPV3|NFUA_STRM5 RecName: Full=Fe/S biogenesis protein nfuA
 gi|194349250|gb|ACF52373.1| HesB/YadR/YfhF-family protein [Stenotrophomonas maltophilia R551-3]
          Length = 199

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           +++V+R+  V++N + P +A  GG +  +    +G+V L   G C GC  A  TLK G+ 
Sbjct: 107 ASLVERVHWVVENEINPQLASHGGKVAVQEVSAEGVVLLRFGGGCQGCGMADVTLKQGIE 166

Query: 174 NILNHFVPEVKDIR 187
             L   VP V  +R
Sbjct: 167 KTLMGRVPGVTAVR 180


>gi|254430627|ref|ZP_05044330.1| NifU domain protein [Cyanobium sp. PCC 7001]
 gi|197625080|gb|EDY37639.1| NifU domain protein [Cyanobium sp. PCC 7001]
          Length = 88

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++  LD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L 
Sbjct: 17  IENVERTLDE-LRPYLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLR 75

Query: 178 HFVPEVKDI 186
             +PEV ++
Sbjct: 76  EAIPEVSEV 84


>gi|145334787|ref|NP_001078739.1| NFU2 (NIFU-LIKE PROTEIN 2); structural molecule [Arabidopsis
           thaliana]
 gi|222422967|dbj|BAH19468.1| AT5G49940 [Arabidopsis thaliana]
 gi|332008491|gb|AED95874.1| NifU-like protein 2 [Arabidopsis thaliana]
          Length = 185

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   L  
Sbjct: 88  ENVESVLDE-IRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERRLME 146

Query: 179 FVPEV 183
            +PE+
Sbjct: 147 KIPEI 151


>gi|317967928|ref|ZP_07969318.1| NifU-like protein [Synechococcus sp. CB0205]
          Length = 92

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++  LD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L 
Sbjct: 21  IENVERTLDE-LRPYLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLR 79

Query: 178 HFVPEVKDI 186
             +PEV ++
Sbjct: 80  EAIPEVSEV 88


>gi|255083372|ref|XP_002504672.1| predicted protein [Micromonas sp. RCC299]
 gi|226519940|gb|ACO65930.1| predicted protein [Micromonas sp. RCC299]
          Length = 192

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 106 GSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSAS 165
           G     E        +++VLD  VRP +  DGGD+        +V L + GAC  CPS++
Sbjct: 31  GESSISEKLELTADNVEKVLDE-VRPYLIADGGDVELVEIDGLVVRLKLNGACGSCPSST 89

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            T++ G+   L   +PE+ ++  +
Sbjct: 90  VTMRMGIEKRLMEKIPEIMEVEQI 113


>gi|193215039|ref|YP_001996238.1| nitrogen-fixing NifU domain-containing protein [Chloroherpeton
           thalassium ATCC 35110]
 gi|193088516|gb|ACF13791.1| nitrogen-fixing NifU domain protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 95

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETL 168
           ++  +  +  R+ E L N +RP +  DGGD    G  D  +V L + GAC  CP ++ TL
Sbjct: 15  YLPGNDPIYARVTEAL-NSIRPYLQADGGDCELVGITDEQVVDLRLVGACGSCPMSAMTL 73

Query: 169 KYGVANILNHFVPEV 183
           + GV   +   VPE+
Sbjct: 74  RAGVEQAIKRAVPEI 88


>gi|226225813|ref|YP_002759919.1| hypothetical protein GAU_0407 [Gemmatimonas aurantiaca T-27]
 gi|226089004|dbj|BAH37449.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 296

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           R+  V++N +RP     GGD+         VF+ + G+C+GC  +S TL+ G+   L   
Sbjct: 105 RVARVVEN-LRPYTQSHGGDVTLVDVTSDTVFVKLSGSCNGCSMSSVTLRNGIEEALKEQ 163

Query: 180 VPEVKDIRTV 189
           VPE+  I  V
Sbjct: 164 VPEITRIEVV 173


>gi|153833894|ref|ZP_01986561.1| thioredoxin [Vibrio harveyi HY01]
 gi|156972936|ref|YP_001443843.1| putative DNA uptake protein [Vibrio harveyi ATCC BAA-1116]
 gi|166990532|sp|A7MST1|NFUA_VIBHB RecName: Full=Fe/S biogenesis protein nfuA
 gi|148869732|gb|EDL68709.1| thioredoxin [Vibrio harveyi HY01]
 gi|156524530|gb|ABU69616.1| hypothetical protein VIBHAR_00614 [Vibrio harveyi ATCC BAA-1116]
          Length = 194

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ V+  +V P +A  GG + + +   DGI  ++  G C+GC     TLK
Sbjct: 103 VSDDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITDDGIAIVAFGGGCNGCSMVDVTLK 162

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN FV E+  +R
Sbjct: 163 EGIEKELLNQFVGELTAVR 181


>gi|254228559|ref|ZP_04921984.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262392653|ref|YP_003284507.1| NfuA Fe-S protein maturation [Vibrio sp. Ex25]
 gi|151938941|gb|EDN57774.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262336247|gb|ACY50042.1| NfuA Fe-S protein maturation [Vibrio sp. Ex25]
          Length = 194

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ V+  +V P +A  GG + + +   DGI  ++  G C+GC     TLK
Sbjct: 103 VADDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITEDGIAIVAFGGGCNGCSMVDVTLK 162

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F+ E+  +R
Sbjct: 163 EGIEKELLNQFIGELTAVR 181


>gi|320354901|ref|YP_004196240.1| Fe-S cluster assembly protein NifU [Desulfobulbus propionicus DSM
           2032]
 gi|320123403|gb|ADW18949.1| Fe-S cluster assembly protein NifU [Desulfobulbus propionicus DSM
           2032]
          Length = 278

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +++I+EV++  ++P + +DGGDI         V +S+RG+C+ C S+  TLK  V   L 
Sbjct: 206 IKKIEEVIEREIKPTLKKDGGDIQLIDVDGDFVTVSLRGSCANCYSSRTTLKEYVEKKLR 265

Query: 178 HFVPE 182
             V E
Sbjct: 266 EQVLE 270


>gi|284931439|gb|ADC31377.1| conserved hypothetical protein [Mycoplasma gallisepticum str. F]
          Length = 99

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%)

Query: 137 GGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           GGD+ F+GY  GIV + + G C GC     T K GV  IL   +PEVK +
Sbjct: 27  GGDLSFEGYEKGIVTIRLLGNCDGCSLVDMTYKDGVETILKAEIPEVKSV 76


>gi|46580957|ref|YP_011765.1| NifU family protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46450377|gb|AAS97025.1| NifU family protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 81

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP + +DGGD+       +G+V + + G C GCP + +TLK  V  ++  FVP V+ + 
Sbjct: 18  VRPLLQQDGGDVELVDITPEGVVRVRLTGRCKGCPMSQKTLKNSVEKMVLKFVPAVQRVE 77

Query: 188 TV 189
            V
Sbjct: 78  AV 79


>gi|302342126|ref|YP_003806655.1| Fe-S cluster assembly protein NifU [Desulfarculus baarsii DSM 2075]
 gi|301638739|gb|ADK84061.1| Fe-S cluster assembly protein NifU [Desulfarculus baarsii DSM 2075]
          Length = 285

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++E L+  VRPA+ +DGGDI         V +S+RG CS C ++  TL   V   L  FV
Sbjct: 215 VEETLEREVRPALKQDGGDIELIDIDGDKVLVSLRGMCSSCAASQATLSQFVQAKLREFV 274

Query: 181 PE 182
            +
Sbjct: 275 TD 276


>gi|237756604|ref|ZP_04585121.1| conserved domain protein [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691235|gb|EEP60326.1| conserved domain protein [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 73

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q ++E+LD +VRPA+  D G+I      +  VFL + G C  CP A  T+K  V   +  
Sbjct: 8   QEVREILD-KVRPALLADAGNIELVKVENDEVFLKLYGTCQTCPVADMTMKDLVIYTIKE 66

Query: 179 FVPEVK 184
            +P VK
Sbjct: 67  SLPWVK 72


>gi|148252075|ref|YP_001236660.1| putative nitrogen-fixing NifU, Rieske (2Fe-2S) region
           [Bradyrhizobium sp. BTAi1]
 gi|146404248|gb|ABQ32754.1| putative nitrogen-fixing NifU , Rieske (2Fe-2S) region
           [Bradyrhizobium sp. BTAi1]
          Length = 289

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +R++  LD+ VRP +A  GGD+     R   + +   GAC GCP+++ T   GV   +  
Sbjct: 96  ERLETALDS-VRPILASHGGDVELIAVRPPAIEVRFTGACDGCPASALTFHAGVKKAVEE 154

Query: 179 FVPEVKDIRTV 189
             PE+ DI  V
Sbjct: 155 ACPEITDILQV 165


>gi|255637868|gb|ACU19253.1| unknown [Glycine max]
          Length = 219

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  +RP +  DGG++        +V L ++GAC  CPS+  T+K G+   L  
Sbjct: 72  ENVESVLDE-IRPYLIADGGNVALHQIDGNVVRLKLQGACGSCPSSVTTMKMGIERRLME 130

Query: 179 FVPEV 183
            +PE+
Sbjct: 131 KIPEI 135


>gi|318040472|ref|ZP_07972428.1| NifU-like protein [Synechococcus sp. CB0101]
          Length = 96

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++  LD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L 
Sbjct: 25  IENVERTLDE-LRPYLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLR 83

Query: 178 HFVPEVKDI 186
             +PEV ++
Sbjct: 84  EAIPEVSEV 92


>gi|295098862|emb|CBK87951.1| Thioredoxin-like proteins and domains [Eubacterium cylindroides
           T2-87]
          Length = 83

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E   +++RP +  DGGDI   G  +   V+++ RGAC+GC  A+E    G+  +L   VP
Sbjct: 15  EACLDKIRPYIQHDGGDIELLGIDEHAYVYVAFRGACAGCMMATEDFSSGIKLLLMDEVP 74

Query: 182 EVKDIRTV 189
            ++D+  V
Sbjct: 75  GIRDVILV 82


>gi|188997215|ref|YP_001931466.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932282|gb|ACD66912.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 84

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q ++E+LD +VRPA+  D G+I      +  VFL + G C  CP A  T+K  V   +  
Sbjct: 8   QEVREILD-KVRPALLADAGNIELVKVENDEVFLKLYGTCQTCPVADMTMKDLVIYTIKE 66

Query: 179 FVPEVKDI 186
            +P VK +
Sbjct: 67  SLPWVKAV 74


>gi|307105277|gb|EFN53527.1| hypothetical protein CHLNCDRAFT_58507 [Chlorella variabilis]
          Length = 496

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V+ +   LD+ VRP +  DGG++      DG VFL ++GAC  CPS++ T+K G+   L
Sbjct: 340 TVEAVDAALDD-VRPYLIADGGNVDVVAVEDGRVFLQLQGACGTCPSSTATMKMGIERSL 398

Query: 177 N 177
            
Sbjct: 399 K 399


>gi|269959406|ref|ZP_06173789.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835843|gb|EEZ89919.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 194

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ V+  +V P +A  GG + + +   DGI  ++  G C+GC     TLK
Sbjct: 103 VADDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITDDGIAIVAFGGGCNGCSMVDVTLK 162

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN FV E+  +R
Sbjct: 163 EGIEKELLNQFVGELTAVR 181


>gi|75910444|ref|YP_324740.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
 gi|1236928|gb|AAA93019.1| NifU2 [Anabaena variabilis ATCC 29413]
 gi|75704169|gb|ABA23845.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
          Length = 309

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VLD  VRP +  DGGDI     +   V + ++GAC  CPS++ TLK  V   L   V
Sbjct: 231 IQKVLDEEVRPLLIADGGDIELYDVQGDNVQVVLQGACGSCPSSTATLKVAVEAKLQERV 290

Query: 181 PEVKDIRTV 189
            +   +  V
Sbjct: 291 SQSLRVEAV 299


>gi|242082972|ref|XP_002441911.1| hypothetical protein SORBIDRAFT_08g004740 [Sorghum bicolor]
 gi|241942604|gb|EES15749.1| hypothetical protein SORBIDRAFT_08g004740 [Sorghum bicolor]
          Length = 227

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           ++ VLD  VRP +  DGGD+        +V L ++GAC  CPS+  T+K  +   L   +
Sbjct: 81  VESVLDE-VRPYLIADGGDVALHEINGNVVRLKLQGACGSCPSSVTTMKMRIQRRLMENI 139

Query: 181 PEVKDIRTV 189
           PE+  +  V
Sbjct: 140 PEISAVERV 148


>gi|108805648|ref|YP_645585.1| nitrogen-fixing NifU-like protein [Rubrobacter xylanophilus DSM
           9941]
 gi|108766891|gb|ABG05773.1| nitrogen-fixing NifU-like protein [Rubrobacter xylanophilus DSM
           9941]
          Length = 80

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGD--IVFKGYRDGIVFLSMRGACSGCPSASETL 168
           +E+   +  R++  L  +VRPA+  DGGD  +V      G V + M GACSGCP +    
Sbjct: 1   MEAKPDMRSRVEAAL-GKVRPAMQADGGDARVVDCDEETGSVKIQMLGACSGCPLSQLDF 59

Query: 169 KYGVANILNHFVPEVKDIRTV 189
            Y + +++   VPEV++I  V
Sbjct: 60  VYAIESLIRREVPEVREILAV 80


>gi|120601745|ref|YP_966145.1| NifU domain-containing protein [Desulfovibrio vulgaris DP4]
 gi|120561974|gb|ABM27718.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris DP4]
 gi|311234644|gb|ADP87498.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris RCH1]
          Length = 75

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP + +DGGD+       +G+V + + G C GCP + +TLK  V  ++  FVP V+ + 
Sbjct: 12  VRPLLQQDGGDVELVDITPEGVVRVRLTGRCKGCPMSQKTLKNSVEKMVLKFVPAVQRVE 71

Query: 188 TV 189
            V
Sbjct: 72  AV 73


>gi|225448154|ref|XP_002264418.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297739542|emb|CBI29724.3| unnamed protein product [Vitis vinifera]
          Length = 227

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 114 DSAV-----VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
           DSAV      + ++ VLD  +RP +  DGG++        +V L ++GAC  CPS+  T+
Sbjct: 70  DSAVELPLTAENVESVLDE-IRPYLISDGGNVALHEIDGNVVRLKLQGACGSCPSSVMTM 128

Query: 169 KYGVANILNHFVPEV 183
           K G+   L   +PE+
Sbjct: 129 KMGIERRLMEKIPEI 143


>gi|303290897|ref|XP_003064735.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226453761|gb|EEH51069.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 153

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  VRP +  DGGD+        +V L + GAC  CPS++ T++ G+   L  
Sbjct: 6   ENVEKVLDE-VRPYLIADGGDVELVEIDGLVVRLKLNGACGSCPSSTVTMRMGIERRLLE 64

Query: 179 FVPEV 183
            +PE+
Sbjct: 65  VIPEI 69


>gi|88809237|ref|ZP_01124746.1| NifU-like protein [Synechococcus sp. WH 7805]
 gi|88787179|gb|EAR18337.1| NifU-like protein [Synechococcus sp. WH 7805]
          Length = 81

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRE 69

Query: 179 FVPEVKDI 186
            +PEV ++
Sbjct: 70  TIPEVSEV 77


>gi|417363|sp|P33179|NIFU_ANASL RecName: Full=Nitrogen fixation protein nifU
 gi|2126543|pir||I39609 nifU protein - Anabaena sp. (fragment)
 gi|142056|gb|AAA22013.1| NifU [Anabaena sp. L-31]
          Length = 112

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           I++VLD  VRP +  DGGD+        IV + ++GAC  CPS++ TLK  + + L
Sbjct: 44  IQKVLDEEVRPVLIADGGDVELYDVDGDIVKVVLQGACGSCPSSTATLKIAIESRL 99


>gi|148238937|ref|YP_001224324.1| NifU-like protein [Synechococcus sp. WH 7803]
 gi|147847476|emb|CAK23027.1| NifU-like protein [Synechococcus sp. WH 7803]
          Length = 81

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRE 69

Query: 179 FVPEVKDIRTV 189
            +PEV ++  V
Sbjct: 70  AIPEVSEVVQV 80


>gi|311694682|gb|ADP97555.1| yhgI protein [marine bacterium HP15]
          Length = 195

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           I+ D+ +  R+  +L + + P +A  GG++      D  +  L   G C GC + S TLK
Sbjct: 104 IDDDAPLPDRVNYILASEINPNLAAHGGEVSLVEIVDESVAVLRFGGGCQGCSAVSLTLK 163

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV + L   VPE+  +R V
Sbjct: 164 QGVESTLKERVPEITAVRDV 183


>gi|116073290|ref|ZP_01470552.1| NifU-like protein [Synechococcus sp. RS9916]
 gi|116068595|gb|EAU74347.1| NifU-like protein [Synechococcus sp. RS9916]
          Length = 81

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRE 69

Query: 179 FVPEVKDI 186
            +PEV ++
Sbjct: 70  AIPEVSEV 77


>gi|83815451|ref|YP_444955.1| hypothetical protein SRU_0820 [Salinibacter ruber DSM 13855]
 gi|294506813|ref|YP_003570871.1| hypothetical protein SRM_00998 [Salinibacter ruber M8]
 gi|83756845|gb|ABC44958.1| conserved domain protein [Salinibacter ruber DSM 13855]
 gi|294343141|emb|CBH23919.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 101

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           D  +   I+E LD  +RP +  DGG + +     D +V L + GAC  CP ++ TL+ G+
Sbjct: 20  DPELRDNIEEALDT-IRPYLMADGGSVRLLNVTADYVVELELLGACGSCPMSTMTLRAGI 78

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP+VK +  V
Sbjct: 79  EQALKRSVPKVKRVEAV 95


>gi|125995235|dbj|BAF47150.1| NifU [Gloeothece sp. KO68DGA]
          Length = 293

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHF 179
           I++VL+  V+PA+A+DGGD         +V + ++GAC  C S+++TLK  + A + +  
Sbjct: 225 IQQVLEEEVKPALAQDGGDCDLFDVDGDLVKVVLKGACGSCASSTQTLKIAIEARLRDRI 284

Query: 180 VPEV 183
            PE+
Sbjct: 285 SPEL 288


>gi|303233008|ref|ZP_07319687.1| NifU-like protein [Atopobium vaginae PB189-T1-4]
 gi|302480879|gb|EFL43960.1| NifU-like protein [Atopobium vaginae PB189-T1-4]
          Length = 178

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANI 175
           + + I E   + +R ++  DGGD+V     D G+V L M GAC+GCP +   +  G+  I
Sbjct: 102 INREILEATIDVIRESLQADGGDVVLVNVSDDGVVTLEMTGACAGCPLSEYDMTEGIERI 161

Query: 176 LNHFVPEVKDIR 187
           L   VP V  + 
Sbjct: 162 LKEHVPGVTKVE 173


>gi|255576215|ref|XP_002529001.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223531541|gb|EEF33371.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 226

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP +  DGG++        +V L ++GAC  CPS+  T+K G+   L  
Sbjct: 79  ENVESVLDE-VRPYLIADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLME 137

Query: 179 FVPEV 183
            +PE+
Sbjct: 138 KIPEI 142


>gi|323483740|ref|ZP_08089120.1| nitrogen-fixing NifU domain-containing protein [Clostridium
           symbiosum WAL-14163]
 gi|323692707|ref|ZP_08106936.1| nitrogen-fixing NifU domain-containing protein [Clostridium
           symbiosum WAL-14673]
 gi|323402931|gb|EGA95249.1| nitrogen-fixing NifU domain-containing protein [Clostridium
           symbiosum WAL-14163]
 gi|323503261|gb|EGB19094.1| nitrogen-fixing NifU domain-containing protein [Clostridium
           symbiosum WAL-14673]
          Length = 118

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMR--GACSGCPSASETLKYGV 172
           + +++RI++VL+  VRP++    G++    Y +    L +R  G CSGCPSA  T +  +
Sbjct: 2   AEMIERIEKVLEQDVRPSLLSHEGNVQIVSYEEKSKILRVRLTGQCSGCPSAQLTTEEVI 61

Query: 173 ANILNHFVPEVKDI 186
              +   +PEV+ +
Sbjct: 62  EKAVKEKIPEVEQV 75


>gi|302766397|ref|XP_002966619.1| hypothetical protein SELMODRAFT_230831 [Selaginella moellendorffii]
 gi|300166039|gb|EFJ32646.1| hypothetical protein SELMODRAFT_230831 [Selaginella moellendorffii]
          Length = 144

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           VLD  VRP +  DGG++  +     +V L ++GAC  CPS+  T+K G+   L   +PE+
Sbjct: 2   VLDE-VRPYLMSDGGNVALEEIDGLVVKLKLQGACGSCPSSLMTMKMGIEARLKEKIPEI 60

Query: 184 KDIRTV 189
             +  V
Sbjct: 61  IGVEQV 66


>gi|92114011|ref|YP_573939.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
 gi|91797101|gb|ABE59240.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
          Length = 196

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + +DS +  R+  VL + + P +A  GG+I + +   + +  L   G C GC +   TLK
Sbjct: 105 VNADSPLEDRVNYVLYSEINPGLAAHGGEIRLMQLTEENVAVLQFGGGCQGCAAVDLTLK 164

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   VPE+  IR V
Sbjct: 165 EGVEKTLIERVPELAGIRDV 184


>gi|148241647|ref|YP_001226804.1| NifU-like protein [Synechococcus sp. RCC307]
 gi|147849957|emb|CAK27451.1| NifU-like protein [Synechococcus sp. RCC307]
          Length = 88

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ ++  LD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L 
Sbjct: 17  LENVERTLDE-LRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLR 75

Query: 178 HFVPEVKDI 186
             +PEV ++
Sbjct: 76  EAIPEVSEV 84


>gi|91224982|ref|ZP_01260241.1| hypothetical protein V12G01_11188 [Vibrio alginolyticus 12G01]
 gi|269965876|ref|ZP_06179969.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91190228|gb|EAS76498.1| hypothetical protein V12G01_11188 [Vibrio alginolyticus 12G01]
 gi|269829429|gb|EEZ83670.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 194

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ V+  +V P +A  GG + + +   DG+  ++  G C+GC     TLK
Sbjct: 103 VADDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITEDGVAIVAFGGGCNGCSMVDVTLK 162

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F+ E+  +R
Sbjct: 163 EGIEKELLNQFIGELTAVR 181


>gi|212711654|ref|ZP_03319782.1| hypothetical protein PROVALCAL_02729 [Providencia alcalifaciens DSM
           30120]
 gi|212685756|gb|EEB45284.1| hypothetical protein PROVALCAL_02729 [Providencia alcalifaciens DSM
           30120]
          Length = 192

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 79/172 (45%), Gaps = 16/172 (9%)

Query: 29  HFSNAKEAEISPLASRIFSI-PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFIS 87
           HF+   E++ S    R+F I PG  +   G  +   G  +   + L+   L   ++   +
Sbjct: 11  HFAKLLESQESGTQIRVFVINPGTPTAECGVSYCPPGAVEATDKELKFEKLSAYVDEISA 70

Query: 88  GDPIIHNGGLGDMKLDDMGSGDFIES----------DSAVVQRIKEVLDNRVRPAVARDG 137
             P + +  + D   D +GS   +++          D+ +++R++ VL +++ P +A  G
Sbjct: 71  --PFLEDAEI-DFVTDQLGSQLTLKAPNAKMRKVSDDAPLIERVEYVLQSQINPQLASHG 127

Query: 138 GDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGV-ANILNHFVPEVKDIR 187
           G + + +   +G   L   G C+GC     TLK G+   +L  F  E+K ++
Sbjct: 128 GRVSLMEITEEGFAILQFGGGCNGCSMVDVTLKEGIEKELLKMFEGELKGVK 179


>gi|113954347|ref|YP_729865.1| NifU domain-containing protein [Synechococcus sp. CC9311]
 gi|113881698|gb|ABI46656.1| NifU domain protein [Synechococcus sp. CC9311]
          Length = 81

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + +++VLD  +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +  
Sbjct: 11  ENVEKVLDE-LRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRE 69

Query: 179 FVPEVKDI 186
            +PEV ++
Sbjct: 70  SIPEVSEV 77


>gi|37524219|ref|NP_927563.1| putative DNA uptake protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|51701988|sp|Q7N9W2|NFUA_PHOLL RecName: Full=Fe/S biogenesis protein nfuA
 gi|36783642|emb|CAE12493.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 191

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  DS + +R++ VL +++ P +A  GG + + +   DG   L   G C+GC     TLK
Sbjct: 101 VSDDSPLAERVEYVLQSQINPQLAGHGGRVSLMEITDDGFAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L +  PE+K ++
Sbjct: 161 EGIEKELLNMFPELKGVK 178


>gi|116750110|ref|YP_846797.1| Fe-S cluster assembly protein NifU [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699174|gb|ABK18362.1| Fe-S cluster assembly protein NifU [Syntrophobacter fumaroxidans
           MPOB]
          Length = 276

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++ I+E +D  +RP++ +DGGDI         V ++ RGAC+ C +A+ TLK  V   L 
Sbjct: 203 IRLIEETIDQEIRPSLKQDGGDIELVDVVGNRVLVATRGACASCQAANRTLKNFVEVKLR 262

Query: 178 HFV-PEV 183
             V PE+
Sbjct: 263 ELVLPEL 269


>gi|163802249|ref|ZP_02196144.1| hypothetical protein 1103602000603_AND4_17694 [Vibrio sp. AND4]
 gi|159174054|gb|EDP58864.1| hypothetical protein AND4_17694 [Vibrio sp. AND4]
          Length = 194

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ V+  +V P +A  GG + + +   DGI  ++  G C+GC     TLK
Sbjct: 103 VADDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITDDGIAIVAFGGGCNGCSMVDVTLK 162

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F+ E+  +R
Sbjct: 163 EGIEKELLNQFIGELTAVR 181


>gi|195941174|ref|ZP_03086556.1| putative DNA uptake protein [Escherichia coli O157:H7 str. EC4024]
          Length = 152

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +++R++ +L +++ P +A  GG + + +   DG+  L   G C+GC     TLK
Sbjct: 62  VSDDAPLMERVEYLLQSQINPQLAGHGGRVSLMEITEDGLAILQFGGGCNGCSMVDVTLK 121

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F PE+K +R
Sbjct: 122 EGIEKQMLNEF-PELKGVR 139


>gi|226942441|ref|YP_002797514.1| NifU C-terminal domain-containing protein VnfU [Azotobacter
           vinelandii DJ]
 gi|732317|sp|P40432|YVN2_AZOVI RecName: Full=Uncharacterized 10.3 kDa protein in vnfA 5'region
 gi|1088269|gb|AAA82515.1| unknown protein [Azotobacter vinelandii]
 gi|226717368|gb|ACO76539.1| NifU C-terminal domain-containing protein, VnfU [Azotobacter
           vinelandii DJ]
          Length = 96

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
           ++E ++ R+RP V RDGGD+     +D IV L ++GAC GC  +++TL
Sbjct: 28  VRETVE-RLRPGVQRDGGDLELVAVQDNIVRLRLKGACVGCAMSAQTL 74


>gi|293393405|ref|ZP_06637716.1| Fe/S-biogenesis protein NfuA [Serratia odorifera DSM 4582]
 gi|291424006|gb|EFE97224.1| Fe/S-biogenesis protein NfuA [Serratia odorifera DSM 4582]
          Length = 191

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           ++ ++ +++R++ VL +++ P +A  GG + + +   DG+  L   G C+GC     TLK
Sbjct: 101 VDENAPLMERVEYVLQSQINPQLAGHGGRVTLMEITEDGLAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L    PE+K +R
Sbjct: 161 EGIEKELLQKFPELKGVR 178


>gi|149371976|ref|ZP_01891295.1| nifU-like domain protein [unidentified eubacterium SCB49]
 gi|149355116|gb|EDM43677.1| nifU-like domain protein [unidentified eubacterium SCB49]
          Length = 80

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E+  + +RP +  DGGDI+  G  DG  V + ++GAC GC     TLK GV   +    P
Sbjct: 11  EIALDEIRPFLQTDGGDILLLGIEDGTTVKVQLQGACVGCSVNQMTLKSGVEMTIKKHAP 70

Query: 182 EVKDIRTV 189
           +++ +  V
Sbjct: 71  QIERVINV 78


>gi|295097023|emb|CBK86113.1| IscR-regulated protein YhgI [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 191

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +++R++ +L +++ P +A  GG + + +   DG+  L   G C+GC     TLK
Sbjct: 101 VSDDAPLMERVEYLLQSQINPQLAGHGGRVSLMEITEDGLAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F PE+K +R
Sbjct: 161 EGIEKQLLNEF-PELKGVR 178


>gi|91794875|ref|YP_564526.1| putative DNA uptake protein [Shewanella denitrificans OS217]
 gi|119370613|sp|Q12IC3|NFUA_SHEDO RecName: Full=Fe/S biogenesis protein nfuA
 gi|91716877|gb|ABE56803.1| HesB/YadR/YfhF [Shewanella denitrificans OS217]
          Length = 192

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVF-KGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+RI+ V+ + + P +A  GG+I+  +   DG+  L   G C+GC     TLK
Sbjct: 101 VSGDAPLVERIEYVIQSEINPQLASHGGNIMLVEVTDDGVAVLQFGGGCNGCSQVDITLK 160

Query: 170 YGV-ANILNHFVPEVKDIRTV 189
            G+   +L+ F  E+  +R V
Sbjct: 161 DGIEKQLLDLFTGELTGVRDV 181


>gi|253746010|gb|EET01549.1| Hypothetical protein GL50581_1173 [Giardia intestinalis ATCC 50581]
          Length = 197

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNG 95
           E S L   +  + G+  +      +TV  + Q  W  +R  +   I   F    P  H  
Sbjct: 41  EASSLQCDLLKVKGVKKLSITPTGVTVTVRSQGLWPSIRSEIENKIYSAFDPDTP--HTP 98

Query: 96  GLGDMKLDD-MGSGDFIESDSAVVQRIKEVL-DNRVRPAVARDGGDIVFKGYRDG----I 149
               + + D + +G    S+   +++  E+L    + P +ARDGG   +K Y       I
Sbjct: 99  DELRLAIQDILSTGSLSPSN---IRKASELLIRAAINPFLARDGGSCSYKRYESTDEGLI 155

Query: 150 VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           V++ + G CSGC  ++ T+   V      ++P V  ++ +
Sbjct: 156 VYIELHGNCSGCSKSANTMNNFVIGEFKKYIPNVSTVKCI 195


>gi|218185367|gb|EEC67794.1| hypothetical protein OsI_35353 [Oryza sativa Indica Group]
          Length = 228

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 83  EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 142

Query: 183 V 183
           +
Sbjct: 143 I 143


>gi|115484477|ref|NP_001065900.1| Os11g0181500 [Oryza sativa Japonica Group]
 gi|108864066|gb|ABG22389.1| nitrogen fixation protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113644604|dbj|BAF27745.1| Os11g0181500 [Oryza sativa Japonica Group]
 gi|215695304|dbj|BAG90495.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765607|dbj|BAG87304.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222615626|gb|EEE51758.1| hypothetical protein OsJ_33192 [Oryza sativa Japonica Group]
          Length = 228

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 83  EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 142

Query: 183 V 183
           +
Sbjct: 143 I 143


>gi|290473229|ref|YP_003466094.1| Fe/S biogenesis protein [Xenorhabdus bovienii SS-2004]
 gi|289172527|emb|CBJ79294.1| Fe/S biogenesis protein [Xenorhabdus bovienii SS-2004]
          Length = 191

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           +  D+ +++R++ VL +++ P +A  GG +      D G   L   G C+GC     TLK
Sbjct: 101 VTDDAPLIERVEYVLQSQINPQLAGHGGRVSLMEITDAGYAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L +  PE+K +R
Sbjct: 161 EGIEKELLNMFPELKGVR 178


>gi|170078022|ref|YP_001734660.1| NifU like protein [Synechococcus sp. PCC 7002]
 gi|169885691|gb|ACA99404.1| NifU like protein [Synechococcus sp. PCC 7002]
          Length = 78

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
             + ++  LD  +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L
Sbjct: 6   TTENVEATLDE-LRPYLKADGGNVELVEIDGPVVKLRLQGACGSCPSSTMTLRMGIERRL 64

Query: 177 NHFVPEVKDIRTV 189
              +PE+ ++  V
Sbjct: 65  RENIPEIAEVEQV 77


>gi|261341914|ref|ZP_05969772.1| IscR-regulated protein YhgI [Enterobacter cancerogenus ATCC 35316]
 gi|288315816|gb|EFC54754.1| IscR-regulated protein YhgI [Enterobacter cancerogenus ATCC 35316]
          Length = 191

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +++R++ +L +++ P +A  GG + + +   DG+  L   G C+GC     TLK
Sbjct: 101 VSDDAPLMERVEYMLQSQINPQLAGHGGRVTLMEITEDGLAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F PE+K +R
Sbjct: 161 EGIEKQLLNEF-PELKGVR 178


>gi|110596893|ref|ZP_01385183.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031]
 gi|110341580|gb|EAT60040.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031]
          Length = 86

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
           S D++ +  A+  R+   L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 4   SKDYLPNSDAIYDRVIAALET-VRPYLQVDGGDCQLVGISKDMVVDVKLLGACGSCPMST 62

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +    PE+  + +V
Sbjct: 63  LTLRAGVEQAIKKANPEIVRVESV 86


>gi|189500939|ref|YP_001960409.1| nitrogen-fixing NifU domain-containing protein [Chlorobium
           phaeobacteroides BS1]
 gi|189496380|gb|ACE04928.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides
           BS1]
          Length = 86

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG-YRDGIVFLSMRGACSGCPSAS 165
           + D++     +  R+ + L+  VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 4   TKDYLPDTDPLYDRVIKALEE-VRPYLQADGGDCQLVGITKDMLVDVKLLGACGSCPMST 62

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   VPE+  +  V
Sbjct: 63  LTLRAGVEQAIKKAVPEIARVEAV 86


>gi|225849266|ref|YP_002729430.1| hypothetical protein SULAZ_1463 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643887|gb|ACN98937.1| conserved domain protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 84

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q +KEVL+ ++RPA+  D G I      +  VFL + G C  CP A  T+K  V   +  
Sbjct: 8   QEVKEVLE-KIRPALMADAGKIDLVKIENDEVFLKLYGTCQTCPVADMTMKDLVVYTIKE 66

Query: 179 FVPEVK 184
            +P VK
Sbjct: 67  SLPWVK 72


>gi|83645334|ref|YP_433769.1| thioredoxin-like protein [Hahella chejuensis KCTC 2396]
 gi|83633377|gb|ABC29344.1| Thioredoxin-like protein [Hahella chejuensis KCTC 2396]
          Length = 192

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           ++  S +  RI  +L   + P +A  GG++      D +  L   G C GC +   TLK 
Sbjct: 102 VDESSPLPDRINYILYTEINPGLASHGGEVSLVEVVDDVAVLKFGGGCQGCSAVDFTLKQ 161

Query: 171 GVANILNHFVPEVKDIR 187
           GV   L   +PE+K +R
Sbjct: 162 GVEKTLLSKIPELKGVR 178


>gi|254480747|ref|ZP_05093994.1| IscR-regulated protein YhgI [marine gamma proteobacterium HTCC2148]
 gi|214039330|gb|EEB79990.1| IscR-regulated protein YhgI [marine gamma proteobacterium HTCC2148]
          Length = 191

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           ++ +S +  RI  VL N V PA+A  GG++ + +   D    L   G C GC +  +TLK
Sbjct: 101 VDENSPMEDRINYVLYNEVNPALAAHGGEVSLVEITEDNFAVLRFGGGCQGCSAVDQTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            GV   L   +P++  +R
Sbjct: 161 GGVEKTLLEQLPQLAGVR 178


>gi|285018390|ref|YP_003376101.1| protein gnty [Xanthomonas albilineans GPE PC73]
 gi|283473608|emb|CBA16111.1| probable protein gnty [Xanthomonas albilineans]
          Length = 198

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVA 173
           +++V+R++ V++N V P +A  GG +  +    DG+V L   G C GC  A  TLK G+ 
Sbjct: 106 ASLVERVRWVVENEVNPQLAEHGGRVAVQEVSADGVVVLRFGGGCHGCGMADVTLKQGIE 165

Query: 174 NILNHFVPEVKDIR 187
             L   V  V  +R
Sbjct: 166 KTLMGRVSGVTAVR 179


>gi|146313459|ref|YP_001178533.1| putative DNA uptake protein [Enterobacter sp. 638]
 gi|166990523|sp|A4WFK2|NFUA_ENT38 RecName: Full=Fe/S biogenesis protein nfuA
 gi|145320335|gb|ABP62482.1| HesB/YadR/YfhF-family protein [Enterobacter sp. 638]
          Length = 191

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  D+ +++R++ +L +++ P +A  GG + + +   DG+  L   G C+GC     TLK
Sbjct: 101 VSDDAPLMERVEYLLQSQINPQLAGHGGRVTLMEITEDGLAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F PE+K +R
Sbjct: 161 EGIEKQMLNEF-PELKGVR 178


>gi|194337374|ref|YP_002019168.1| nitrogen-fixing NifU domain protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194309851|gb|ACF44551.1| nitrogen-fixing NifU domain protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 86

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG-YRDGIVFLSMRGACSGCPSAS 165
           + D++ +  A+  R+   L+  VRP +  DGGD    G  +D  V + + GAC  CP ++
Sbjct: 4   TKDYLPNSDALYDRVIAALET-VRPYLQVDGGDCQIVGITKDMTVDVKLLGACGSCPMST 62

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   VPE+  + +V
Sbjct: 63  LTLRAGVEQAIKKAVPEIVRVESV 86


>gi|320354022|ref|YP_004195361.1| nitrogen-fixing NifU domain-containing protein [Desulfobulbus
           propionicus DSM 2032]
 gi|320122524|gb|ADW18070.1| nitrogen-fixing NifU domain protein [Desulfobulbus propionicus DSM
           2032]
          Length = 77

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 128 RVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
           ++RP + RDGGD+ F     D I+ + + GAC GCP +  TLK G+   +   +P ++ +
Sbjct: 14  QIRPTLQRDGGDVEFVELGPDQILKVRLTGACQGCPMSRITLKEGIEKFVKGELPTIRAV 73

Query: 187 RTV 189
             V
Sbjct: 74  EAV 76


>gi|253987620|ref|YP_003038976.1| DNA uptake protein [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253779070|emb|CAQ82230.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 191

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           +  D+ +V+R++ VL +++ P +A  GG +      D G   L   G C+GC     TLK
Sbjct: 101 VSDDAPLVERVEYVLQSQINPQLAGHGGRVSLMEITDEGFAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L +  PE+K ++
Sbjct: 161 EGIEKELLNMFPELKGVK 178


>gi|68349029|gb|AAY96420.1| YhgI [Halomonas elongata]
          Length = 196

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + +DS +  R+  VL + + P +A  GG+I + +   + +  L+  G C GC +   TLK
Sbjct: 105 VNADSPLEDRVNYVLYSEINPGLAAHGGEIKLVQLTEEQVAVLAFGGGCQGCAAVDLTLK 164

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   L   +PE+  IR V
Sbjct: 165 EGVERTLMERIPELSGIRDV 184


>gi|225012595|ref|ZP_03703030.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
 gi|225003128|gb|EEG41103.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
          Length = 84

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPSASETLKYGVANILNH 178
           +I+E L+  +RP +  DGGDI      DG  V + + GAC GC     TLK GV   +  
Sbjct: 9   KIREALE-EIRPFLKSDGGDISLVSVEDGKHVKVQLHGACVGCSVNQMTLKSGVELTIKK 67

Query: 179 FVPEVKDIRTV 189
           ++P+++ + ++
Sbjct: 68  YLPQIETVTSI 78


>gi|226495405|ref|NP_001148901.1| NFU3 [Zea mays]
 gi|195623070|gb|ACG33365.1| NFU3 [Zea mays]
          Length = 226

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           + ++ VLD  VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L  
Sbjct: 78  ENVEMVLDE-VRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLME 136

Query: 179 FVPEV 183
            +PE+
Sbjct: 137 KIPEI 141


>gi|62734078|gb|AAX96187.1| Similar to seven transmembrane protein Mlo4 [Oryza sativa Japonica
           Group]
          Length = 980

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 576 EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 635

Query: 183 V 183
           +
Sbjct: 636 I 636


>gi|88703284|ref|ZP_01101000.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
 gi|88701998|gb|EAQ99101.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
          Length = 191

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +  DS +  RI  VL N V P++A  GG++ + +   D    L   G C GC +   TLK
Sbjct: 101 VSDDSPIEDRINYVLYNEVNPSLAAHGGEVSLVEVTDDAFAVLRFGGGCQGCSAVDMTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            GV   L   +P++K +R
Sbjct: 161 DGVEKTLLDQLPQLKGVR 178


>gi|156743727|ref|YP_001433856.1| NifU domain-containing protein [Roseiflexus castenholzii DSM 13941]
 gi|156235055|gb|ABU59838.1| nitrogen-fixing NifU domain protein [Roseiflexus castenholzii DSM
           13941]
          Length = 291

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V R+  VLD   RP +   GGD+     R+ +V++ + G+C+GC  ++ TL+  +   L
Sbjct: 95  IVARVSRVLDA-ARPYIRSHGGDVELVEVRENVVYVRLHGSCNGCSLSAVTLRNEIEAAL 153

Query: 177 NHFVPEVKDIRTV 189
              VPE+  ++ V
Sbjct: 154 RANVPEIVGVQVV 166


>gi|195361607|ref|XP_002045503.1| GM19271 [Drosophila sechellia]
 gi|194128907|gb|EDW50950.1| GM19271 [Drosophila sechellia]
          Length = 110

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIH-FSNAKEAEISPLA 42
           MFIQT+DTPNP +LKF+PG  VL +G  + F N   A  SPL 
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHSSPLG 109


>gi|255321743|ref|ZP_05362898.1| NifU family protein [Campylobacter showae RM3277]
 gi|255301223|gb|EET80485.1| NifU family protein [Campylobacter showae RM3277]
          Length = 89

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  +++ +K  L  +V P +  DGG +   G ++G +++ + G C GC ++S TLKYG+
Sbjct: 5   TDEELLKPVKASL-QKVLPMLENDGGGMELLGIKNGKIYVRLTGHCHGCAASSTTLKYGI 63

Query: 173 ANIL 176
              L
Sbjct: 64  ERQL 67


>gi|240171478|ref|ZP_04750137.1| hypothetical protein MkanA1_19346 [Mycobacterium kansasii ATCC
           12478]
          Length = 301

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           V +R+ + L+ RVRP +   GGD+      D +V L+  G+C  CPS++ TL+  V + +
Sbjct: 94  VHRRVSDALE-RVRPYLGSHGGDVDLLEVTDTVVRLAFTGSCKSCPSSAVTLELAVQDAI 152

Query: 177 NHFVPEVKDIRTV 189
               PE+  I  V
Sbjct: 153 RAAAPEICAIELV 165


>gi|86607917|ref|YP_476679.1| Fe-S cluster assembly protein NifU [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556459|gb|ABD01416.1| Fe-S cluster assembly protein NifU [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 312

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + RI+ VL+  VRP +  DGGD+         V++ ++G+C+ CPS   TL+  +   L 
Sbjct: 241 IARIQAVLEEEVRPLLLADGGDVELYDLEGDQVWVRLKGSCTTCPSQQNTLRLLIETRLQ 300

Query: 178 HFV 180
             V
Sbjct: 301 EQV 303


>gi|86606476|ref|YP_475239.1| Fe-S cluster assembly protein NifU [Synechococcus sp. JA-3-3Ab]
 gi|86555018|gb|ABC99976.1| Fe-S cluster assembly protein NifU [Synechococcus sp. JA-3-3Ab]
          Length = 312

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           + RI+ VL+  VRP +  DGGD+         V++ ++G+C+ CPS   TL+  +   L 
Sbjct: 241 IARIQAVLEEEVRPLLLADGGDVELYDLEGDQVWVRLKGSCTTCPSQQNTLRLLIETRLQ 300

Query: 178 HFV 180
             V
Sbjct: 301 EQV 303


>gi|21231527|ref|NP_637444.1| hypothetical protein XCC2079 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768417|ref|YP_243179.1| hypothetical protein XC_2103 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|51702176|sp|Q8P8Z9|NFUA_XANCP RecName: Full=Fe/S biogenesis protein nfuA
 gi|81305609|sp|Q4UUW4|NFUA_XANC8 RecName: Full=Fe/S biogenesis protein nfuA
 gi|21113208|gb|AAM41368.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573749|gb|AAY49159.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 199

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASE 166
           G+     +++V+R++ V++N + P +A  GG +  +    +G+V L   G C GC  A  
Sbjct: 100 GEAPAESASMVERVRWVVENEINPQLASHGGRVAVQEVSAEGVVLLRFGGGCHGCGMADV 159

Query: 167 TLKYGVANILNHFVPEVKDIR 187
           TLK G+   L   +P V  +R
Sbjct: 160 TLKQGIEKTLMGRLPGVIAVR 180


>gi|226327547|ref|ZP_03803065.1| hypothetical protein PROPEN_01418 [Proteus penneri ATCC 35198]
 gi|225204073|gb|EEG86427.1| hypothetical protein PROPEN_01418 [Proteus penneri ATCC 35198]
          Length = 192

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169
           +++D+ +++R++ VL +++ P +A  GG + + +   DG   L   G C+GC     TLK
Sbjct: 101 VDADAPLIERVEYVLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMIDVTLK 160

Query: 170 YGV-ANILNHFVPEVKDIR 187
            G+   +LN F  E+K ++
Sbjct: 161 DGIEKELLNQFPNELKGVK 179


>gi|218887746|ref|YP_002437067.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758700|gb|ACL09599.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 281

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 118 VQRIK---EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           VQR++   +VL+  +RP + +DGGDI         V++++RG C+ CPS+  TL+  V  
Sbjct: 205 VQRMQLVLKVLEGEIRPRLQQDGGDIELVDMDGTTVYVALRGMCTSCPSSRLTLEGFVEK 264

Query: 175 ILNHFVPE 182
            L   V E
Sbjct: 265 TLRDHVDE 272


>gi|298708751|emb|CBJ30713.1| NifU-like protein 2, chloroplast precursor (AtCNfu2) (AtCnfU-V)
           [Ectocarpus siliculosus]
          Length = 276

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            ++ ++ VLD  +RP +  DGG++        +V L + GAC  CPS++ T+K G+   L
Sbjct: 123 TLENVETVLDE-MRPYLMSDGGNVRVVEIDGPVVRLELEGACGSCPSSTMTMKMGLERRL 181

Query: 177 NHFVPEVKDI 186
              +PE+ ++
Sbjct: 182 VQRIPEISEV 191


>gi|330443916|ref|YP_004376902.1| NifU-like protein [Chlamydophila pecorum E58]
 gi|328807026|gb|AEB41199.1| NifU-like protein [Chlamydophila pecorum E58]
          Length = 275

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           IE+  AV++ I E    ++ P +A DGG +  K   + IV ++  G CSGCPS+  T   
Sbjct: 182 IENKIAVLRTITE---EKISPYIALDGGAVSIKTLENNIVTIAYSGNCSGCPSSIGTTLN 238

Query: 171 GVANILNHFV-PEVK 184
            +  +L  +V PE++
Sbjct: 239 SIGQLLRTYVYPELQ 253


>gi|227112203|ref|ZP_03825859.1| putative DNA uptake protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 191

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLK 169
           ++ ++ +++R++ VL +++ P +A  GG +      D G+  L   G C+GC     TLK
Sbjct: 101 VDDNAPLMERVEYVLQSQINPQLAGHGGRVTLMEITDDGLAILQFGGGCNGCSMVDVTLK 160

Query: 170 YGVANILNHFVPEVKDIR 187
            G+   L    PE+K +R
Sbjct: 161 EGIEKELLQTFPELKGVR 178


>gi|254410535|ref|ZP_05024314.1| Fe-S cluster assembly protein NifU [Microcoleus chthonoplastes PCC
           7420]
 gi|196182741|gb|EDX77726.1| Fe-S cluster assembly protein NifU [Microcoleus chthonoplastes PCC
           7420]
          Length = 315

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VL+  +RP +A DGGD+         V + ++G+C GCPS   TLK  +   L   V
Sbjct: 246 IQQVLETEIRPTLAYDGGDVELYDVEGDRVKVILKGSCDGCPSVMITLKMAIEKRLQERV 305


>gi|56459359|ref|YP_154640.1| putative DNA uptake protein [Idiomarina loihiensis L2TR]
 gi|81363232|sp|Q5QZC8|NFUA_IDILO RecName: Full=Fe/S biogenesis protein nfuA
 gi|56178369|gb|AAV81091.1| hypothetical protein IL0248 [Idiomarina loihiensis L2TR]
          Length = 192

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 16/159 (10%)

Query: 44  RIFSI-PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           R+F + PG+A+   G  +      + D E L  P  G          P + +  + D + 
Sbjct: 26  RVFVVNPGMANAECGVSYCPPDSVEPDDERL--PFNGFDAVVDSGSAPFLEDAAI-DFEE 82

Query: 103 DDMGS----------GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVF 151
            +MGS             +  D+ +++R++ V+   + P +A  GG ++     D G+  
Sbjct: 83  QEMGSQLTLKAPNAKARKVADDAPLIERVEYVIQAEINPQLASHGGQVMISEITDDGVAI 142

Query: 152 LSMRGACSGCPSASETLKYGV-ANILNHFVPEVKDIRTV 189
           L   G C+GC     TLK G+   +L  F  EVK +R +
Sbjct: 143 LQFGGGCNGCSMIDVTLKNGIEKELLERFPEEVKGVRDI 181


>gi|323436167