BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein
[Candidatus Liberibacter asiaticus str. psy62]
         (189 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|148251664|ref|YP_001236249.1| putative nifU protein [Bradyrhizobium sp. BTAi1]
 gi|146403837|gb|ABQ32343.1| putative nifU protein [Bradyrhizobium sp. BTAi1]
          Length = 189

 Score =  219 bits (558), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 101/188 (53%), Positives = 143/188 (76%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + FS+ + A  SPLA R+F+I G+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVLPSGTMEFSSREAAARSPLAERLFAIGGVTGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K+  +W+HL+P +LG IMEH++SG P++ +G   +    D     + E+D+  V  
Sbjct: 61  ITVTKNDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDDATDEDDEFYDEADTETVGM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIRT 188
           PEV ++R 
Sbjct: 181 PEVVEVRP 188


>gi|126730479|ref|ZP_01746290.1| nifU domain protein [Sagittula stellata E-37]
 gi|126709212|gb|EBA08267.1| nifU domain protein [Sagittula stellata E-37]
          Length = 187

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A  SPLA R+F++ G+  ++FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDMGTADFPSADAAGASPLAQRLFAVDGVTGIFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++ +G        +         D  +V 
Sbjct: 61  VTVTKADTVDWDHMKPAILGAIMEHFQSGQPVMSDGAAQAGGHAEHE-----GEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|222084688|ref|YP_002543217.1| nitrogen fixation protein [Agrobacterium radiobacter K84]
 gi|221722136|gb|ACM25292.1| nitrogen fixation protein [Agrobacterium radiobacter K84]
          Length = 188

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 108/189 (57%), Positives = 146/189 (77%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VV+  G   F +A EAE+SPLA+R+F IPG++ VYFGYDF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMESGTAEFRSADEAEVSPLAARLFDIPGVSGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++    +     D  G   F E D+ +V  
Sbjct: 61  ISVSKDDQEWQHLKPAILGSIMEHFMSGKPVMGAASVLSEAQDASGE-FFDEGDATIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G+RDG V+L+M+G+C+GCPS++ TLK+G+ N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFRDGKVYLNMKGSCAGCPSSTATLKHGIQNLLRHFV 179

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 180 PEVQEVEAV 188


>gi|260431494|ref|ZP_05785465.1| NifU domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415322|gb|EEX08581.1| NifU domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 187

 Score =  218 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ AE SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPTAEAAENSPLAKRIFAVKGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD    W+H++P +LG +MEH+ SG PI+ +G          G  +    DS +V 
Sbjct: 61  VTVTKDDDVQWDHIKPAILGAVMEHYQSGQPIMGDGADAAS-----GHAEHTGEDSEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|83949998|ref|ZP_00958731.1| nifU domain protein [Roseovarius nubinhibens ISM]
 gi|83837897|gb|EAP77193.1| nifU domain protein [Roseovarius nubinhibens ISM]
          Length = 188

 Score =  217 bits (553), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF I G+  V+FG+DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAAGKSPLAERIFKIAGVTGVFFGHDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P +LG IMEHF SG P++ + G          +G     D  +V 
Sbjct: 61  VTVTKDEGTEWDHVKPAILGAIMEHFQSGKPVMLDAGGDPQSGHAEHTG----EDGEIVN 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|146337209|ref|YP_001202257.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp.
           ORS278]
 gi|146190015|emb|CAL74007.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp.
           ORS278]
          Length = 189

 Score =  217 bits (552), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 100/188 (53%), Positives = 141/188 (75%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++   A  SPLA R+F++ G+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVLPAGTMEFASRDAAARSPLAERLFAVDGVTGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K   +W+HL+P +LG IMEH++SG P++ +G   +    D     F E+D+  V  
Sbjct: 61  ITVTKSDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDASADEDDEFFDEADTETVGM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIRT 188
           PEV ++R 
Sbjct: 181 PEVVEVRP 188


>gi|260426420|ref|ZP_05780399.1| scaffold protein Nfu/NifU [Citreicella sp. SE45]
 gi|260420912|gb|EEX14163.1| scaffold protein Nfu/NifU [Citreicella sp. SE45]
          Length = 185

 Score =  217 bits (552), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 104/190 (54%), Positives = 134/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA  A+ SPLA R+FS+ G+  V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQAVLGAGTADFPNADGADASPLARRLFSVTGVTGVFLGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   DW+H++P VLG IMEHF SGDP++   G         G   F   D  +V 
Sbjct: 61  VTVTKDDGADWDHVKPAVLGAIMEHFQSGDPVMAGEGGSS------GHAAFDGEDKEIVG 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|126740480|ref|ZP_01756167.1| nifU domain protein [Roseobacter sp. SK209-2-6]
 gi|126718281|gb|EBA14996.1| nifU domain protein [Roseobacter sp. SK209-2-6]
          Length = 187

 Score =  216 bits (551), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA+ AE SPLA R+F+  G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPNAEAAENSPLAQRVFAAAGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEHF SG P+++ GG         G  +    D+ VV 
Sbjct: 61  VTVTKSEDVEWDHIKPAILGAIMEHFQSGQPVLNAGGAQSS-----GHAEHSGEDAEVVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKDLLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|99078069|ref|YP_611327.1| nitrogen-fixing NifU-like [Ruegeria sp. TM1040]
 gi|99035207|gb|ABF62065.1| nitrogen-fixing NifU-like protein [Ruegeria sp. TM1040]
          Length = 187

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAASKSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   +W+H++P VLG +MEH+ SG P+     + + +    G  +    D  +V 
Sbjct: 61  VTVTKDDSVEWDHIKPAVLGAVMEHYQSGQPV-----INEGQQQASGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254465238|ref|ZP_05078649.1| NifU domain protein [Rhodobacterales bacterium Y4I]
 gi|206686146|gb|EDZ46628.1| NifU domain protein [Rhodobacterales bacterium Y4I]
          Length = 188

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 100/190 (52%), Positives = 136/190 (71%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A  SPLASRIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSADAAGKSPLASRIFAVDGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW+H++P +LG +MEH+ SG P++ +G           SG     D+ +V 
Sbjct: 61  VTVTKAEGIDWDHIKPAILGAVMEHYQSGQPVMADGSADPASGHAEHSG----EDAEIVN 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|259415063|ref|ZP_05738985.1| NifU domain protein [Silicibacter sp. TrichCH4B]
 gi|259348973|gb|EEW60727.1| NifU domain protein [Silicibacter sp. TrichCH4B]
          Length = 187

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAEAASKSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   +W+H++P VLG +MEH+ SG P+     + + +    G  +    D  +V 
Sbjct: 61  VTVTKDDSVEWDHIKPAVLGAVMEHYQSGQPV-----IDEGQQQASGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|85705721|ref|ZP_01036818.1| nifU domain protein [Roseovarius sp. 217]
 gi|85669711|gb|EAQ24575.1| nifU domain protein [Roseovarius sp. 217]
          Length = 187

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ AE SPLA RIF +PG++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPTAEGAEKSPLAERIFRVPGVSGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEH+ SG P++   G G       G  +    DS +V 
Sbjct: 61  VTVTKGEATEWDHIKPAILGAIMEHYQSGQPVMLGEGGGAS-----GHAEHSGEDSEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|89068101|ref|ZP_01155518.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516]
 gi|89046340|gb|EAR52397.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516]
          Length = 186

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F++ + A  SPLA RIFS+ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGEAVLDAGTADFASPEAANTSPLARRIFSVQGVTGVFFGTDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P +LG IMEH+ SG P++          +  G       D  +V 
Sbjct: 61  VTVTKDEATEWDHVKPAILGAIMEHYQSGAPVVEGAEGATGHAEHTG------EDGEIVA 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRPV 184


>gi|114764450|ref|ZP_01443675.1| nifU domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114543017|gb|EAU46036.1| nifU domain protein [Roseovarius sp. HTCC2601]
          Length = 186

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 100/190 (52%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+  + SPLA R+F + G+  V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLGAGTADFPSAEGTDASPLAKRLFGVTGVTGVFLGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P VLG IMEHF SG+P++   G         G   F   D  +V 
Sbjct: 61  VTVTKADGADWDHVKPAVLGAIMEHFQSGEPVMAGEGGAS------GHAAFEGEDEEIVG 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|310815348|ref|YP_003963312.1| NifU domain protein [Ketogulonicigenium vulgare Y25]
 gi|308754083|gb|ADO42012.1| NifU domain protein [Ketogulonicigenium vulgare Y25]
          Length = 185

 Score =  215 bits (547), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 134/190 (70%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+ GYDF
Sbjct: 1   MFIQTESTPNPATLKFLPGQQVLELGTADFPSAEAATTSPLAKRLFAVDGVTGVFLGYDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  +W HL+P VLG IMEHF SG P++    +   +  D         D A+V+
Sbjct: 61  ITVTKTDNLEWPHLKPAVLGAIMEHFQSGQPVMEGEAVSAHRAHDG-------EDGAIVE 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+G+C+GCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGSCAGCPSSTLTLKMGIENLLRHY 173

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 174 IPEVLEVRPV 183


>gi|119383283|ref|YP_914339.1| NifU domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119373050|gb|ABL68643.1| nitrogen-fixing NifU domain protein [Paracoccus denitrificans
           PD1222]
          Length = 184

 Score =  215 bits (547), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 127/190 (66%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F     A  SPLA RIF++PG+  V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGETVLGSGTADFPAPDTAAASPLARRIFAVPGVTGVFLGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W+HL+P VLG IMEH+ SG P I           D         D+ +V 
Sbjct: 61  VTVTKAEDAVWDHLKPSVLGAIMEHYQSGAPAIEGATASGHNDQDGP-------DAEIVN 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 173

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 174 IPEVTEVRPV 183


>gi|84683414|ref|ZP_01011317.1| nifU domain protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84668157|gb|EAQ14624.1| nifU domain protein [Rhodobacterales bacterium HTCC2654]
          Length = 186

 Score =  215 bits (546), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 134/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQEVLEAGTADFPSAEAAAKSPLAQRVFAVNGVKGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEHF SG P++  G       +  G       D+ +V 
Sbjct: 61  VTVTKADDVEWDHVKPAILGAIMEHFQSGAPVMGEGPREAAHAEHDGP------DAEIVV 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKDLLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLKHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|325291785|ref|YP_004277649.1| scaffold protein Nfu/NifU [Agrobacterium sp. H13-3]
 gi|325059638|gb|ADY63329.1| putative scaffold protein Nfu/NifU [Agrobacterium sp. H13-3]
          Length = 187

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 111/189 (58%), Positives = 141/189 (74%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G   F N  +A+ SPLA R+F+IPG+  VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLESGTAEFLNPAQAQASPLAERLFTIPGVTGVYFGFDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD  +W+HL+P +LG IMEHF+SG PI+      +  + D     F   D  +V  
Sbjct: 61  ITVTKDDAEWQHLKPAILGSIMEHFMSGRPIMGTAIAAE--VSDEEGEFFEAGDETIVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD RVRPAVA+DGGDI F+G+RDG VFL+M+GACSGCPS++ TLK+GV N+L HFV
Sbjct: 119 IKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCPSSTATLKHGVQNLLRHFV 178

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 179 PEVREVEAV 187


>gi|149913250|ref|ZP_01901784.1| NifU-like domain protein [Roseobacter sp. AzwK-3b]
 gi|149813656|gb|EDM73482.1| NifU-like domain protein [Roseobacter sp. AzwK-3b]
          Length = 187

 Score =  214 bits (544), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ ++ SPLA+R+F + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPTAEASDKSPLATRLFGVKGVRGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEHF SG P++             G       DS +V 
Sbjct: 61  VTVTKTDDAEWDHIKPSILGAIMEHFQSGQPVMAVDAE-----HASGHAAHEGEDSEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|239830990|ref|ZP_04679319.1| Scaffold protein Nfu/NifU [Ochrobactrum intermedium LMG 3301]
 gi|239823257|gb|EEQ94825.1| Scaffold protein Nfu/NifU [Ochrobactrum intermedium LMG 3301]
          Length = 211

 Score =  214 bits (544), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 103/190 (54%), Positives = 139/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   A   SPLA+++FS+PG+  V+FGYD
Sbjct: 22  MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPSTAGNTSPLAAKLFSVPGVTGVFFGYD 81

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  +W+HL+P +LG IMEHF+SG P +      D          F E+D+  V+
Sbjct: 82  FITVTKDDGEWQHLKPAILGTIMEHFMSGAPAMAGNSNADAAAAHGDEEFFDEADAETVE 141

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL+M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 142 IIKELIETRVRPAVAQDGGDITFRGFENGTVFLNMKGACSGCPSSTATLKHGIQNLLRHF 201

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 202 VPEVQQVEQI 211


>gi|84500284|ref|ZP_00998550.1| nifU domain protein [Oceanicola batsensis HTCC2597]
 gi|84392218|gb|EAQ04486.1| nifU domain protein [Oceanicola batsensis HTCC2597]
          Length = 187

 Score =  214 bits (544), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ +  SPLA+R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAETSGKSPLAARLFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D+  W+H++P +LG IMEH+ SG P++  G        D         D  +V 
Sbjct: 61  VTVTKADETQWDHIKPALLGAIMEHYQSGQPVMATGDQPTSGHADHE-----GEDQEIVV 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLYMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|163744246|ref|ZP_02151606.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45]
 gi|161381064|gb|EDQ05473.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45]
          Length = 186

 Score =  213 bits (543), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 95/190 (50%), Positives = 128/190 (67%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F        SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPTPDAGATSPLAQRLFAVEGVTGVFFGTDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV  +D  +W+H++P +LG IMEHF SGD ++             G       D  +V 
Sbjct: 61  VTVTKQDAVEWDHVKPALLGAIMEHFQSGDAVM-----ASDHQPTSGHAAHDGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|83943871|ref|ZP_00956328.1| nifU domain protein [Sulfitobacter sp. EE-36]
 gi|83953512|ref|ZP_00962234.1| nifU domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83842480|gb|EAP81648.1| nifU domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83845118|gb|EAP82998.1| nifU domain protein [Sulfitobacter sp. EE-36]
          Length = 186

 Score =  213 bits (543), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F   + A  SPLA+R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPAPEAASASPLATRLFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+ K D  +W+HL+P +LG IMEHF SG P++  G          G  +    D A+V 
Sbjct: 61  VTITKADGIEWDHLKPALLGAIMEHFQSGQPVMETG-----HDHASGHAEHTGEDGAIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|260462744|ref|ZP_05810949.1| Scaffold protein Nfu/NifU [Mesorhizobium opportunistum WSM2075]
 gi|259031388|gb|EEW32659.1| Scaffold protein Nfu/NifU [Mesorhizobium opportunistum WSM2075]
          Length = 189

 Score =  213 bits (543), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 106/190 (55%), Positives = 138/190 (72%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL+EG   F +A  A + SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAAVASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G             + ++D  +V 
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPAAETSQTGE--FYDKADEELVI 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ +  V
Sbjct: 179 VPEVQQVEQV 188


>gi|254474955|ref|ZP_05088341.1| NifU domain protein [Ruegeria sp. R11]
 gi|214029198|gb|EEB70033.1| NifU domain protein [Ruegeria sp. R11]
          Length = 187

 Score =  213 bits (543), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAEAAGSSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEHF SG P+     + +      G  +    D  +V 
Sbjct: 61  VTVTKADGVEWDHIKPAILGAVMEHFQSGQPV-----ISEGGEQTSGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|163738966|ref|ZP_02146379.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107]
 gi|163741789|ref|ZP_02149179.1| nifU domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161384962|gb|EDQ09341.1| nifU domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161387771|gb|EDQ12127.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107]
          Length = 187

 Score =  213 bits (543), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A  A  SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPTADAAGSSPLAQRIFAVSGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEHF SG P+     + +      G  +    D  +V 
Sbjct: 61  VTVTKADTVEWDHIKPAILGAVMEHFQSGQPV-----ISEGGEQTSGHAEHTGEDGEIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|13474434|ref|NP_106002.1| hypothetical protein mll5315 [Mesorhizobium loti MAFF303099]
 gi|14025187|dbj|BAB51788.1| mll5315 [Mesorhizobium loti MAFF303099]
          Length = 189

 Score =  213 bits (542), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 106/190 (55%), Positives = 137/190 (72%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL+EG   F +A  A   SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAATASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G             + ++D  +V 
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKSGPAAETSQTGE--FYDKADEELVI 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ +  V
Sbjct: 179 VPEVQQVEQV 188


>gi|149202972|ref|ZP_01879943.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035]
 gi|149143518|gb|EDM31554.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035]
          Length = 187

 Score =  213 bits (542), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 136/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+++  SPLA RIF +PG++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAEKSGSSPLAERIFRVPGVSGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEH+ SG P++             G  +    DSA+V 
Sbjct: 61  VTVTKGEAIEWDHIKPAILGAIMEHYQSGQPVMLGESAVAS-----GHAEHTGEDSAIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|260574570|ref|ZP_05842574.1| Scaffold protein Nfu/NifU [Rhodobacter sp. SW2]
 gi|259023466|gb|EEW26758.1| Scaffold protein Nfu/NifU [Rhodobacter sp. SW2]
          Length = 186

 Score =  213 bits (542), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 104/190 (54%), Positives = 136/190 (71%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF+  G+ASV+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLELGTADFPSAEAAGKSPLAQRIFAAGGVASVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+H++P +LG IMEHF SG P+I          D  G       DS +V+
Sbjct: 61  VTVTKTDTAAWDHIKPGILGAIMEHFQSGAPVIEGEQAASGHADHDGP------DSDIVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R+V
Sbjct: 175 IPEVLEVRSV 184


>gi|115522240|ref|YP_779151.1| NifU domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115516187|gb|ABJ04171.1| nitrogen-fixing NifU domain protein [Rhodopseudomonas palustris
           BisA53]
          Length = 188

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 142/189 (75%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G + FS+   A  SPLA R+F +PG+  V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFLPGRAVLDSGTMEFSDRAAAARSPLAERLFEVPGVTGVFYGLDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++V KD  DW+HL+P +LG IMEHF+SG+P++ +G +      +     F ++D+  V  
Sbjct: 61  VSVTKDDGDWQHLKPAILGAIMEHFMSGEPLMADGRVDGEDASE-DDEFFEKADTETVVI 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI+F+G++DGIV+L MRGACSGCPS++ TL++G+ N+L HFV
Sbjct: 120 IKDLIETRVRPAVANDGGDIIFRGFKDGIVYLHMRGACSGCPSSTATLQHGIQNLLKHFV 179

Query: 181 PEVKDIRTV 189
           PEV ++R +
Sbjct: 180 PEVVEVRPI 188


>gi|86138949|ref|ZP_01057520.1| nifU domain protein [Roseobacter sp. MED193]
 gi|85824180|gb|EAQ44384.1| nifU domain protein [Roseobacter sp. MED193]
          Length = 187

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 139/190 (73%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA+RIF++ G+A V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDAGTADFPSAETAGSSPLATRIFAVSGVAGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG PI++ GG         G  +    +S +V 
Sbjct: 61  VTVTKSDSVEWDHIKPAILGAIMEHYQSGQPIVNAGGEQSS-----GHAEHSGENSEIVD 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKDLLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254510570|ref|ZP_05122637.1| NifU domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534281|gb|EEE37269.1| NifU domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 187

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA+RIF + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEAGTADFPSAEAAEKSPLATRIFGVAGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+H++P +LG +MEH+ SG P++             G  +    D+ +V 
Sbjct: 61  VTVTKSDDMQWDHIKPAILGAVMEHYQSGQPVMGTDADTGA-----GHAEHSGEDAEIVD 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD+RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKDLLDSRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTITLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|319779939|ref|YP_004139415.1| Scaffold protein Nfu/NifU [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165827|gb|ADV09365.1| Scaffold protein Nfu/NifU [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 189

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 107/190 (56%), Positives = 138/190 (72%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VLVEG   F +A  A + SPLA R+F IPG+  V+FGYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKEVLVEGTADFRDADSAAVASPLAGRLFEIPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  DW+HL+P +LG IMEHF+SG P++   G             + ++D  +V 
Sbjct: 61  FITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPAAETSQTGE--FYDKADEELVI 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G+ +G VFL M+GAC+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGCPSSTATLKHGIQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ +  V
Sbjct: 179 VPEVQQVEQV 188


>gi|158426327|ref|YP_001527619.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571]
 gi|158333216|dbj|BAF90701.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571]
          Length = 186

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/189 (52%), Positives = 136/189 (71%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G +   +  EA  SPL  R+F + G+  V+ G DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRTVLGDGTLEARSPAEAGRSPLVQRLFEVKGVGGVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV K   DW H++P +LG IMEHF+SG P++ +G   D    + G   F E+D  +V  
Sbjct: 61  VTVTKTDGDWAHMKPAILGAIMEHFMSGAPVLADGVAAD---QEDGEEFFNEADEEIVGT 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+++ RVRPAVA DGGDI F+G+R+G+V+L+M+G+CSGCPS++ TLK G+ N+L HFV
Sbjct: 118 IKELIETRVRPAVAADGGDITFRGFREGVVYLNMKGSCSGCPSSTATLKNGIENLLRHFV 177

Query: 181 PEVKDIRTV 189
           PEV ++R V
Sbjct: 178 PEVNEVRPV 186


>gi|126725029|ref|ZP_01740872.1| nifU domain protein [Rhodobacterales bacterium HTCC2150]
 gi|126706193|gb|EBA05283.1| nifU domain protein [Rhodobacterales bacterium HTCC2150]
          Length = 187

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA+RIF I GIA V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPSAETADQSPLATRIFGIQGIAGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG IMEHF SG P++          +        E D  +V 
Sbjct: 61  VTVTKAENSEWDHIKPAILGAIMEHFQSGQPVLSGENTAPAHAEAAN-----EEDKEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|163797123|ref|ZP_02191078.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199]
 gi|159177639|gb|EDP62192.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199]
          Length = 187

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/189 (51%), Positives = 130/189 (68%), Gaps = 7/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNPATLKF+PG+ V+  G   F +  E   SPLA  +F + G+  V+ GYDF
Sbjct: 1   MFIQTEETPNPATLKFLPGRQVMESGTAEFKSEDETARSPLAQALFQVDGVTGVFLGYDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V   D  +W  ++P VLG+IMEHF++G P I   G      +D G       D+ +V 
Sbjct: 61  ISVSKHDGKEWYLMKPGVLGVIMEHFVAGRPTIVEDGASASAPEDAG------EDTEIVS 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDI F+GY DG+V L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAMDGGDITFQGYEDGVVTLQMQGACSGCPSSTATLKMGIENMLRHY 174

Query: 180 VPEVKDIRT 188
           +PEV+++R 
Sbjct: 175 IPEVREVRA 183


>gi|299133388|ref|ZP_07026583.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
 gi|298593525|gb|EFI53725.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
          Length = 187

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 101/188 (53%), Positives = 138/188 (73%), Gaps = 2/188 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G + F++   A  SPLA ++F IPG+  V++G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGRTVLDSGTMEFTSRDSAARSPLAVKLFEIPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+HL+P +LG IMEH++SG PI+ +G   D          F E+D+  V  
Sbjct: 61  VTVTKDDGDWQHLKPAILGTIMEHYMSGGPILADGAQPDAGPH--AEEFFNEADAETVGI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++L+ RVRPAVA DGGDI F+G++DGIVFL M+G+CSGCPS++ TLK+G+ N+L H+V
Sbjct: 119 IKDILETRVRPAVASDGGDITFRGFKDGIVFLDMKGSCSGCPSSTATLKHGIQNLLKHYV 178

Query: 181 PEVKDIRT 188
           P+V ++R 
Sbjct: 179 PDVVEVRP 186


>gi|328545933|ref|YP_004306042.1| nitrogen-fixing NifU-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415673|gb|ADZ72736.1| Nitrogen-fixing NifU-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 185

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 101/189 (53%), Positives = 144/189 (76%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G   F ++ EA  SPLA ++F++PG+ +V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLADGTYDFRSSDEAGASPLAEKLFAVPGVVAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD  DW+H++P +LG IME F+SG P++ +  +     D+     F   D   V  
Sbjct: 61  ITVTKDDTDWQHMKPAILGAIMEQFMSGTPVMRSAAVQAGGEDE----FFDSDDEETVTV 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++L+ RVRPAVA+DGGDI FKG+++G+V+LSMRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 117 IKDLLETRVRPAVAQDGGDITFKGFKEGVVYLSMRGACAGCPSSTATLQHGIQNLLRHFV 176

Query: 181 PEVKDIRTV 189
           PEV+++R +
Sbjct: 177 PEVEEVRAI 185


>gi|90421987|ref|YP_530357.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18]
 gi|90104001|gb|ABD86038.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18]
          Length = 188

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 142/189 (75%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++   A  SPLA RIF +PG+  V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFNDRATAARSPLAERIFEVPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+HL+P +LG IMEH++SG+P++ +G +   +  +     F ++D+  V  
Sbjct: 61  VTVTKDDSDWQHLKPSILGAIMEHYMSGEPLMADGRVDGDEPSE-DDEFFDKADAETVDM 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIV+L M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 120 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLKMQGACSGCPSSTATLQHGIQNLLKHFV 179

Query: 181 PEVKDIRTV 189
           P V ++R +
Sbjct: 180 PAVVEVRPI 188


>gi|222147346|ref|YP_002548303.1| hypothetical protein Avi_0430 [Agrobacterium vitis S4]
 gi|221734336|gb|ACM35299.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 186

 Score =  212 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 107/189 (56%), Positives = 143/189 (75%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VV+  G   F + + A  SPLA ++F+IPG+ SV+FGYDF
Sbjct: 1   MFIQTESTPNPATLKFLPGKVVMDNGTAEFRDREAAMASPLAEKLFAIPGVTSVFFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  +W HL+P +LG IMEHF+SG PI+ +   GD   D+     F E D  +V  
Sbjct: 61  VTVTKDTAEWPHLKPAILGSIMEHFMSGAPIMGSAVAGDEASDEE---FFNEGDETIVAT 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G+RDG VFL+M+G+C+GCPS++ TLK+GV N+L HF+
Sbjct: 118 IKELLETRVRPAVAQDGGDITFRGFRDGKVFLNMKGSCAGCPSSTATLKHGVQNLLRHFI 177

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 178 PEVQEVEAV 186


>gi|126734863|ref|ZP_01750609.1| NifU-like domain protein [Roseobacter sp. CCS2]
 gi|126715418|gb|EBA12283.1| NifU-like domain protein [Roseobacter sp. CCS2]
          Length = 187

 Score =  212 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 131/190 (68%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA RIF   G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPSAEAAENSPLAKRIFDAGGVTGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG  ++      +      G  +    D  +V 
Sbjct: 61  VTVTKADDVEWDHIKPGILGAIMEHYQSGQSVM-----AEDHKPVSGHAEHTGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|255264504|ref|ZP_05343846.1| NifU domain protein [Thalassiobium sp. R2A62]
 gi|255106839|gb|EET49513.1| NifU domain protein [Thalassiobium sp. R2A62]
          Length = 187

 Score =  211 bits (538), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLDMGTADFPSAEAAEKSPLAKRIFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG +MEH+ SG  +I             G  +    D+ +V 
Sbjct: 61  VTVTKGDDIEWDHIKPAILGAVMEHYQSGAAVIDGEAPTSG-----GHAEHTGEDAEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFLGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVLEVRPV 185


>gi|84515908|ref|ZP_01003269.1| nifU domain protein [Loktanella vestfoldensis SKA53]
 gi|84510350|gb|EAQ06806.1| nifU domain protein [Loktanella vestfoldensis SKA53]
          Length = 187

 Score =  211 bits (537), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 132/190 (69%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F NA+ A+ SPLA RIF+  G++ V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPNAEAAQHSPLAQRIFAAGGVSGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEH+ SG  ++             G  +    D  +V 
Sbjct: 61  VTVTKADGAEWDHIKPGILGAIMEHYQSGQSVM-----AADHKPVSGHAEHSGEDGDIVT 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVIEVRPV 185


>gi|218461569|ref|ZP_03501660.1| Scaffold protein Nfu/NifU [Rhizobium etli Kim 5]
          Length = 188

 Score =  211 bits (537), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 106/188 (56%), Positives = 144/188 (76%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EA+ SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAQASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +     D  G   F E D ++V  
Sbjct: 61  ISVSKDDAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA-GDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|159045379|ref|YP_001534173.1| hypothetical protein Dshi_2839 [Dinoroseobacter shibae DFL 12]
 gi|157913139|gb|ABV94572.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 187

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 100/190 (52%), Positives = 134/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA RIF++ G+ +V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLETGTADFPSAEAAGSSPLAGRIFAVNGVTAVFFGTDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W+H++P VLG +MEH+ SGD ++             G       DS +V 
Sbjct: 61  VTVTKDEGVEWDHIKPAVLGAVMEHYQSGDAVMTGEASAPA-----GHAAHDGPDSEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVLEVRPV 185


>gi|56695297|ref|YP_165645.1| NifU domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56677034|gb|AAV93700.1| nifU domain protein [Ruegeria pomeroyi DSS-3]
          Length = 187

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ AE SPLA+RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEVGTADFPSAEAAEKSPLAARIFAVSGVTGVFFGNDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W+H++P +LG +MEH+ SG P++             G  +    D+ VV 
Sbjct: 61  VTVTKAEGVEWDHIKPAILGAVMEHYQSGQPVMGADAQTGS-----GHAEHSGEDAEVVT 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKALLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|332557651|ref|ZP_08411973.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides WS8N]
 gi|332275363|gb|EGJ20678.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides WS8N]
          Length = 186

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+  + A  SPLA RIF++ G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATPEAAATSPLARRIFAVGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++             G       D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLEGEQAASGHASHDGP------DEDVVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|110678955|ref|YP_681962.1| NifU-like domain-containing protein [Roseobacter denitrificans OCh
           114]
 gi|109455071|gb|ABG31276.1| NifU-like domain protein [Roseobacter denitrificans OCh 114]
          Length = 187

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA R+F++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAETADKSPLAERVFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++             G  +    D  +V 
Sbjct: 61  VTVTKADNVDWDHIKPALLGAIMEHFQSGQPVM-----AGDHTPTSGHAEHTGDDGVIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040107|gb|ACT56903.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 189

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 189/189 (100%), Positives = 189/189 (100%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF
Sbjct: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR
Sbjct: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV
Sbjct: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180

Query: 181 PEVKDIRTV 189
           PEVKDIRTV
Sbjct: 181 PEVKDIRTV 189


>gi|126461658|ref|YP_001042772.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221638629|ref|YP_002524891.1| nitrogen-fixing NifU domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|126103322|gb|ABN76000.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159410|gb|ACM00390.1| Nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides KD131]
          Length = 186

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+  + A  SPLA RIF+  G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATPEAAATSPLARRIFAAGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++             G       D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLEGEQAASGHASHDGP------DEDVVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|86356038|ref|YP_467930.1| nitrogen fixation protein [Rhizobium etli CFN 42]
 gi|86280140|gb|ABC89203.1| nitrogen fixation protein [Rhizobium etli CFN 42]
          Length = 188

 Score =  211 bits (536), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 107/188 (56%), Positives = 145/188 (77%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFDIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +    + D G   F E D ++V  
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDV-DAGDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|300024980|ref|YP_003757591.1| Scaffold protein Nfu/NifU [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526801|gb|ADJ25270.1| Scaffold protein Nfu/NifU [Hyphomicrobium denitrificans ATCC 51888]
          Length = 184

 Score =  211 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 102/189 (53%), Positives = 131/189 (69%), Gaps = 5/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G   F    EA  SPLA+R+F+I G+  V+ G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRDVLAGGTADFRTRNEAVASPLATRLFAIDGVDGVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V K   +W+HL+P VLG IMEH++SG P+       +   +D G+  +   D A V  
Sbjct: 61  ISVTKGNVEWQHLKPMVLGAIMEHYMSGAPV-----SDEEDSNDEGAESYDPEDEATVTT 115

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F G+RDG+V+L MRGACSGCPS++ TL+ G+ N+L HF 
Sbjct: 116 IKELLETRVRPAVAQDGGDITFSGFRDGVVYLHMRGACSGCPSSTATLRNGIENLLKHFC 175

Query: 181 PEVKDIRTV 189
           PEV  +  V
Sbjct: 176 PEVTSVEAV 184


>gi|110636361|ref|YP_676569.1| nitrogen-fixing NifU-like [Mesorhizobium sp. BNC1]
 gi|110287345|gb|ABG65404.1| nitrogen-fixing NifU-like protein [Chelativorans sp. BNC1]
          Length = 189

 Score =  211 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 106/190 (55%), Positives = 143/190 (75%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG   F +A  A+ +SPLA+R+F +PG+  V+FG+D
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLEEGTADFRSADSAQAVSPLAARLFEVPGVTGVFFGFD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV KD  DW+HL+P +LG IMEHF+SG P++      +   +   S  + E+D  +V 
Sbjct: 61  FITVTKDGADWQHLKPAILGTIMEHFMSGQPVMAANDGSER--ETASSEFYDEADEEIVT 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+GY +G VFL M+GAC+GCPS++ TLK+G+ N+L+HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGYENGTVFLHMKGACAGCPSSTATLKHGIQNLLHHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ +  V
Sbjct: 179 VPEVQQVEQV 188


>gi|190890051|ref|YP_001976593.1| nitrogen fixation protein [Rhizobium etli CIAT 652]
 gi|218509253|ref|ZP_03507131.1| nitrogen fixation protein [Rhizobium etli Brasil 5]
 gi|190695330|gb|ACE89415.1| nitrogen fixation protein [Rhizobium etli CIAT 652]
          Length = 188

 Score =  210 bits (535), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 107/188 (56%), Positives = 143/188 (76%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAAEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +     D  G   F E D ++V  
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA-GDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|218678782|ref|ZP_03526679.1| nitrogen fixation protein [Rhizobium etli CIAT 894]
          Length = 188

 Score =  210 bits (535), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 106/188 (56%), Positives = 144/188 (76%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +     D  G   F E D ++V  
Sbjct: 61  ISVSKDNAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA-GDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|254453730|ref|ZP_05067167.1| NifU domain protein [Octadecabacter antarcticus 238]
 gi|198268136|gb|EDY92406.1| NifU domain protein [Octadecabacter antarcticus 238]
          Length = 186

 Score =  210 bits (534), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 131/190 (68%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F + + A  SPLA RIF + G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQNVLEVGTADFPSVEAAGKSPLAGRIFGVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  +W+H++P +LG +MEH+ SG  ++     G    +  G       D+ +V 
Sbjct: 61  ITVTKADDVEWDHIKPAILGAVMEHYQSGAAVMTGEQAGSGHAEHTG------EDADIVN 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRPV 184


>gi|114769272|ref|ZP_01446898.1| nifU domain protein [alpha proteobacterium HTCC2255]
 gi|114550189|gb|EAU53070.1| nifU domain protein [alpha proteobacterium HTCC2255]
          Length = 186

 Score =  210 bits (534), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 96/190 (50%), Positives = 130/190 (68%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ V+  G   F + +    SPLA RIF++ G  +V+ G DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVMNMGTADFPSPQAGSSSPLAKRIFAVDGATAVFLGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+ K +  DW+H++P +LG IMEHF SG P+I          +  G       DS +V 
Sbjct: 61  VTITKTEDADWDHIKPALLGAIMEHFQSGQPVIEGEDNSGGHAEHTG------EDSDIVN 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK++LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKDLLDTRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTITLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVTEVRPV 184


>gi|163734126|ref|ZP_02141567.1| NifU-like domain protein [Roseobacter litoralis Och 149]
 gi|161392662|gb|EDQ16990.1| NifU-like domain protein [Roseobacter litoralis Och 149]
          Length = 187

 Score =  210 bits (534), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A+ SPLA RIF+I G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAETADKSPLAERIFAIEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEHF SG P++             G  +    D  +V 
Sbjct: 61  VTVTKADSVDWDHIKPGLLGAIMEHFQSGQPVM-----AGDHTPTSGHAEHTGEDGVIVN 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDTRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVTEVRPV 185


>gi|254461257|ref|ZP_05074673.1| NifU domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206677846|gb|EDZ42333.1| NifU domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 188

 Score =  210 bits (534), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 138/190 (72%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A  A++SPLA+RIF++ G+  V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAVGADVSPLAARIFAVEGVTGVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+H++P +LG IMEHF SG  ++     GDM   + G  +    D  +V 
Sbjct: 61  VTVTKADAVEWDHIKPALLGAIMEHFQSGAAVM----AGDMAPPNSGHAEHTGEDGEIVV 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDSRVRPAVAQDGGDITFHGFERGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVTEVRPV 186


>gi|209547636|ref|YP_002279553.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533392|gb|ACI53327.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 188

 Score =  210 bits (534), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 106/188 (56%), Positives = 145/188 (77%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +    + D G   F E D ++V  
Sbjct: 61  ISVSKDDAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDV-DAGDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|153007498|ref|YP_001368713.1| scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188]
 gi|151559386|gb|ABS12884.1| Scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188]
          Length = 190

 Score =  210 bits (534), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 103/190 (54%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +A  A   SPLA+++FS+PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDASTAGNTSPLAAKLFSVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+  V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNSNADAAAAHGEEEFFDEADAETVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL+M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 IIKELIETRVRPAVAQDGGDITFRGFENGTVFLNMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|89053356|ref|YP_508807.1| nitrogen-fixing NifU-like [Jannaschia sp. CCS1]
 gi|88862905|gb|ABD53782.1| nitrogen-fixing NifU-like protein [Jannaschia sp. CCS1]
          Length = 187

 Score =  210 bits (533), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F  A+ +E SPLASRIF++ G+  V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGQSVLEVGTADFPTAETSEKSPLASRIFAVEGVTGVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  DW+H++P +LG IMEH+ SGDP++     GD      G  +    D  +V 
Sbjct: 61  VTVTKADAVDWDHVKPAILGAIMEHYQSGDPVM-----GDGHEVSSGHAEHTGEDGEIVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKSLLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRPV 185


>gi|225464130|ref|XP_002264979.1| PREDICTED: similar to NFU4 (NFU domain protein 4) [Vitis vinifera]
          Length = 271

 Score =  210 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 116/191 (60%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L F PG+ V+  G+  F N++ A  SPLA  ++ I GI  V+FG DF
Sbjct: 70  MFIQTQSTPNPASLMFYPGKPVMEVGSADFPNSRSAMSSPLAKSLYGIDGITRVFFGSDF 129

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ ++P +   IM+ + SG P+  +                 E DS  V 
Sbjct: 130 ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTAAAM-----DTAIHEDDSETVA 184

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 185 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 244

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 245 HYVPEVKGVEQ 255


>gi|15887702|ref|NP_353383.1| hypothetical protein Atu0351 [Agrobacterium tumefaciens str. C58]
 gi|15155261|gb|AAK86168.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score =  210 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 109/189 (57%), Positives = 144/189 (76%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G + F NA +A+ SPLA R+F+IPG+  VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLESGTVEFLNASQAQASPLAERLFTIPGVTGVYFGFDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD  +W+HL+P +LG IMEHF+SG PI+      ++  ++    +  +    +V  
Sbjct: 61  ITVTKDDAEWQHLKPAILGSIMEHFMSGRPIMGTAIAAEVSDEEGEFFEEGD--ETIVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD RVRPAVA+DGGDI F+G+RDG VFL+M+GACSGCPS++ TLK+GV N+L HFV
Sbjct: 119 IKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCPSSTATLKHGVQNLLRHFV 178

Query: 181 PEVKDIRTV 189
           PEV+++  V
Sbjct: 179 PEVREVEAV 187


>gi|241202790|ref|YP_002973886.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856680|gb|ACS54347.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 188

 Score =  209 bits (532), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 104/188 (55%), Positives = 142/188 (75%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F + +EA+ SPLA+R+F I G+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARLFEISGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  DW+HL+P +LG IMEHF+SG P++ +  +     D  G   F E D ++V  
Sbjct: 61  ISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA-GDEFFDEGDESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|254487441|ref|ZP_05100646.1| NifU domain protein [Roseobacter sp. GAI101]
 gi|214044310|gb|EEB84948.1| NifU domain protein [Roseobacter sp. GAI101]
          Length = 203

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F   + A  SPLA+R+F++ G+  V+FG DF
Sbjct: 18  MFIQTESTPNPATLKFLPGQTVLEMGTADFPAPEAASSSPLATRLFAVDGVTGVFFGTDF 77

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+HL+P +LG IMEHF SG  ++  G          G  +    D A+V 
Sbjct: 78  VTVTKADTIEWDHLKPALLGAIMEHFQSGQSVMEQG-----HEHASGHAEHTGEDGAIVG 132

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 133 QIKELLDSRVRPAVAQDGGDITFHGFERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHY 192

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 193 IPEVTEVRPV 202


>gi|154245767|ref|YP_001416725.1| scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2]
 gi|154159852|gb|ABS67068.1| Scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2]
          Length = 186

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/189 (52%), Positives = 140/189 (74%), Gaps = 3/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL EG +   +  +A++SPLA R+F + G+A+V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGRSVLGEGTLDLRSHDDADLSPLAQRLFDVRGVAAVFLGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV K + +W  ++P +LG IMEHF+SG P++ +G   ++   D     +   D+ +V  
Sbjct: 61  VTVTKAEAEWPQIKPAILGAIMEHFMSGAPVLSDGVKPEVADADE---FYEAKDAEIVAT 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD RVRPAVA DGGDI F+G++DGIVFL+M+G+CSGCPS++ TLK G+ N+L HFV
Sbjct: 118 IKELLDTRVRPAVANDGGDITFRGFKDGIVFLNMKGSCSGCPSSTATLKNGIENLLKHFV 177

Query: 181 PEVKDIRTV 189
           PEV +++ V
Sbjct: 178 PEVTEVQAV 186


>gi|298293916|ref|YP_003695855.1| Scaffold protein Nfu/NifU [Starkeya novella DSM 506]
 gi|296930427|gb|ADH91236.1| Scaffold protein Nfu/NifU [Starkeya novella DSM 506]
          Length = 184

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 103/189 (54%), Positives = 137/189 (72%), Gaps = 5/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G     +A EA  SPLA+R+F +PG+  V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRTVLGHGTFEARDADEASRSPLAARLFEVPGVTGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV K++ +W HL+P +LG IMEHF+SG P+     L +          F E D+ VV  
Sbjct: 61  VTVTKEKGEWAHLKPAILGAIMEHFVSGQPV-----LPEDHAHVADDAFFEEKDAGVVDT 115

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+E++D RVRPAVA DGGDI F+GY+DG+VFL+M+G+CSGCPS++ TLK G+ N+L HFV
Sbjct: 116 IRELIDTRVRPAVANDGGDITFRGYKDGVVFLAMKGSCSGCPSSTATLKNGIENLLRHFV 175

Query: 181 PEVKDIRTV 189
           P+V ++R V
Sbjct: 176 PDVVEVRPV 184


>gi|23501052|ref|NP_697179.1| NifU-like protein [Brucella suis 1330]
 gi|62289118|ref|YP_220911.1| NifU-like protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699057|ref|YP_413631.1| nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar
           Abortus 2308]
 gi|148560296|ref|YP_001258173.1| NifU-like protein [Brucella ovis ATCC 25840]
 gi|161618129|ref|YP_001592016.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365]
 gi|189023393|ref|YP_001934161.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19]
 gi|225851675|ref|YP_002731908.1| NifU-related protein [Brucella melitensis ATCC 23457]
 gi|237814609|ref|ZP_04593607.1| NifU-related protein [Brucella abortus str. 2308 A]
 gi|254690444|ref|ZP_05153698.1| NifU-related protein [Brucella abortus bv. 6 str. 870]
 gi|254694934|ref|ZP_05156762.1| NifU-related protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696564|ref|ZP_05158392.1| NifU-related protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700949|ref|ZP_05162777.1| NifU-related protein [Brucella suis bv. 5 str. 513]
 gi|254705318|ref|ZP_05167146.1| NifU-related protein [Brucella suis bv. 3 str. 686]
 gi|254718357|ref|ZP_05180168.1| NifU-related protein [Brucella sp. 83/13]
 gi|254731477|ref|ZP_05190055.1| NifU-related protein [Brucella abortus bv. 4 str. 292]
 gi|256060282|ref|ZP_05450455.1| NifU-related protein [Brucella neotomae 5K33]
 gi|256112644|ref|ZP_05453565.1| NifU-related protein [Brucella melitensis bv. 3 str. Ether]
 gi|256258700|ref|ZP_05464236.1| NifU-related protein [Brucella abortus bv. 9 str. C68]
 gi|256264815|ref|ZP_05467347.1| nitrogen-fixing NifU [Brucella melitensis bv. 2 str. 63/9]
 gi|256368604|ref|YP_003106110.1| NifU-related protein [Brucella microti CCM 4915]
 gi|260546415|ref|ZP_05822155.1| nitrogen-fixing NifU [Brucella abortus NCTC 8038]
 gi|260567221|ref|ZP_05837691.1| nitrogen-fixing NifU [Brucella suis bv. 4 str. 40]
 gi|260755996|ref|ZP_05868344.1| scaffold protein Nfu/NifU [Brucella abortus bv. 6 str. 870]
 gi|260759220|ref|ZP_05871568.1| scaffold protein Nfu/NifU [Brucella abortus bv. 4 str. 292]
 gi|260760942|ref|ZP_05873285.1| scaffold protein Nfu/NifU [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885016|ref|ZP_05896630.1| scaffold protein Nfu/NifU [Brucella abortus bv. 9 str. C68]
 gi|261215272|ref|ZP_05929553.1| scaffold protein Nfu/NifU [Brucella abortus bv. 3 str. Tulya]
 gi|261324254|ref|ZP_05963451.1| scaffold protein Nfu/NifU [Brucella neotomae 5K33]
 gi|261751468|ref|ZP_05995177.1| scaffold protein Nfu/NifU [Brucella suis bv. 5 str. 513]
 gi|261756030|ref|ZP_05999739.1| scaffold protein Nfu/NifU [Brucella suis bv. 3 str. 686]
 gi|265983318|ref|ZP_06096053.1| scaffold protein Nfu/NifU [Brucella sp. 83/13]
 gi|265994085|ref|ZP_06106642.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 3 str. Ether]
 gi|297247534|ref|ZP_06931252.1| thioredoxin-like protein [Brucella abortus bv. 5 str. B3196]
 gi|306839588|ref|ZP_07472392.1| NifU-related protein [Brucella sp. NF 2653]
 gi|306842572|ref|ZP_07475223.1| NifU-related protein [Brucella sp. BO2]
 gi|306844409|ref|ZP_07476999.1| NifU-related protein [Brucella sp. BO1]
 gi|23346918|gb|AAN29094.1| NifU-related protein [Brucella suis 1330]
 gi|62195250|gb|AAX73550.1| NifU-related protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615158|emb|CAJ10095.1| Nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar
           Abortus 2308]
 gi|148371553|gb|ABQ61532.1| NifU-related protein [Brucella ovis ATCC 25840]
 gi|161334940|gb|ABX61245.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365]
 gi|189018965|gb|ACD71687.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19]
 gi|225640040|gb|ACN99953.1| NifU-related protein [Brucella melitensis ATCC 23457]
 gi|237789446|gb|EEP63656.1| NifU-related protein [Brucella abortus str. 2308 A]
 gi|255998762|gb|ACU47161.1| NifU-related protein [Brucella microti CCM 4915]
 gi|260096522|gb|EEW80398.1| nitrogen-fixing NifU [Brucella abortus NCTC 8038]
 gi|260156739|gb|EEW91819.1| nitrogen-fixing NifU [Brucella suis bv. 4 str. 40]
 gi|260669538|gb|EEX56478.1| scaffold protein Nfu/NifU [Brucella abortus bv. 4 str. 292]
 gi|260671374|gb|EEX58195.1| scaffold protein Nfu/NifU [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676104|gb|EEX62925.1| scaffold protein Nfu/NifU [Brucella abortus bv. 6 str. 870]
 gi|260874544|gb|EEX81613.1| scaffold protein Nfu/NifU [Brucella abortus bv. 9 str. C68]
 gi|260916879|gb|EEX83740.1| scaffold protein Nfu/NifU [Brucella abortus bv. 3 str. Tulya]
 gi|261300234|gb|EEY03731.1| scaffold protein Nfu/NifU [Brucella neotomae 5K33]
 gi|261741221|gb|EEY29147.1| scaffold protein Nfu/NifU [Brucella suis bv. 5 str. 513]
 gi|261745783|gb|EEY33709.1| scaffold protein Nfu/NifU [Brucella suis bv. 3 str. 686]
 gi|262765066|gb|EEZ10987.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 3 str. Ether]
 gi|263095225|gb|EEZ18894.1| nitrogen-fixing NifU [Brucella melitensis bv. 2 str. 63/9]
 gi|264661910|gb|EEZ32171.1| scaffold protein Nfu/NifU [Brucella sp. 83/13]
 gi|297174703|gb|EFH34050.1| thioredoxin-like protein [Brucella abortus bv. 5 str. B3196]
 gi|306275222|gb|EFM56972.1| NifU-related protein [Brucella sp. BO1]
 gi|306287428|gb|EFM58908.1| NifU-related protein [Brucella sp. BO2]
 gi|306405286|gb|EFM61561.1| NifU-related protein [Brucella sp. NF 2653]
 gi|326408161|gb|ADZ65226.1| Nitrogen-fixing NifU, C-terminal protein [Brucella melitensis M28]
 gi|326537871|gb|ADZ86086.1| NifU-related protein [Brucella melitensis M5-90]
          Length = 190

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE + PLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|316931562|ref|YP_004106544.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris DX-1]
 gi|315599276|gb|ADU41811.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris DX-1]
          Length = 188

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 100/188 (53%), Positives = 142/188 (75%), Gaps = 2/188 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRSVLDSGTLEFTDAAQAARSPLAARLFDIDGVSGVFYGADF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+ +G              + E D+  V+ 
Sbjct: 61  VTVTKDRGEWQHLKPAILGAIMEHYMSGAPILADGKSDGDDG--DDDEFYAEGDAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHFV 178

Query: 181 PEVKDIRT 188
           PEV ++R 
Sbjct: 179 PEVVEVRP 186


>gi|225626680|ref|ZP_03784719.1| NifU-related protein [Brucella ceti str. Cudo]
 gi|254707168|ref|ZP_05168996.1| NifU-related protein [Brucella pinnipedialis M163/99/10]
 gi|254709289|ref|ZP_05171100.1| NifU-related protein [Brucella pinnipedialis B2/94]
 gi|254713288|ref|ZP_05175099.1| NifU-related protein [Brucella ceti M644/93/1]
 gi|254716359|ref|ZP_05178170.1| NifU-related protein [Brucella ceti M13/05/1]
 gi|256030812|ref|ZP_05444426.1| NifU-related protein [Brucella pinnipedialis M292/94/1]
 gi|256158837|ref|ZP_05456694.1| NifU-related protein [Brucella ceti M490/95/1]
 gi|256254218|ref|ZP_05459754.1| NifU-related protein [Brucella ceti B1/94]
 gi|260169716|ref|ZP_05756527.1| NifU-related protein [Brucella sp. F5/99]
 gi|261218142|ref|ZP_05932423.1| scaffold protein Nfu/NifU [Brucella ceti M13/05/1]
 gi|261221368|ref|ZP_05935649.1| scaffold protein Nfu/NifU [Brucella ceti B1/94]
 gi|261314644|ref|ZP_05953841.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M163/99/10]
 gi|261316798|ref|ZP_05955995.1| scaffold protein Nfu/NifU [Brucella pinnipedialis B2/94]
 gi|261321011|ref|ZP_05960208.1| scaffold protein Nfu/NifU [Brucella ceti M644/93/1]
 gi|261759255|ref|ZP_06002964.1| nitrogen-fixing NifU [Brucella sp. F5/99]
 gi|265987868|ref|ZP_06100425.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M292/94/1]
 gi|265997328|ref|ZP_06109885.1| scaffold protein Nfu/NifU [Brucella ceti M490/95/1]
 gi|225618337|gb|EEH15380.1| NifU-related protein [Brucella ceti str. Cudo]
 gi|260919952|gb|EEX86605.1| scaffold protein Nfu/NifU [Brucella ceti B1/94]
 gi|260923231|gb|EEX89799.1| scaffold protein Nfu/NifU [Brucella ceti M13/05/1]
 gi|261293701|gb|EEX97197.1| scaffold protein Nfu/NifU [Brucella ceti M644/93/1]
 gi|261296021|gb|EEX99517.1| scaffold protein Nfu/NifU [Brucella pinnipedialis B2/94]
 gi|261303670|gb|EEY07167.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M163/99/10]
 gi|261739239|gb|EEY27235.1| nitrogen-fixing NifU [Brucella sp. F5/99]
 gi|262551796|gb|EEZ07786.1| scaffold protein Nfu/NifU [Brucella ceti M490/95/1]
 gi|264660065|gb|EEZ30326.1| scaffold protein Nfu/NifU [Brucella pinnipedialis M292/94/1]
          Length = 190

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE + PLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHSEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|17988091|ref|NP_540725.1| NifU protein [Brucella melitensis bv. 1 str. 16M]
 gi|256045931|ref|ZP_05448803.1| NifU protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563213|ref|ZP_05833699.1| nitrogen-fixing NifU [Brucella melitensis bv. 1 str. 16M]
 gi|265992342|ref|ZP_06104899.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 1 str. Rev.1]
 gi|17983843|gb|AAL52989.1| nifu protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153229|gb|EEW88321.1| nitrogen-fixing NifU [Brucella melitensis bv. 1 str. 16M]
 gi|263003408|gb|EEZ15701.1| scaffold protein Nfu/NifU [Brucella melitensis bv. 1 str. Rev.1]
          Length = 190

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE + PLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+GV N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGVQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|326497811|dbj|BAJ94768.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326521670|dbj|BAK00411.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 268

 Score =  208 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 87/191 (45%), Positives = 119/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 68  MFIQTQSTPNPQSLMFHPGKPVMDVGSSDFPNARTAMTSPLAKALFAIEGVTRVFFGSDF 127

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D+  W++L+P V   IM+ + SG P+  +                 E DS +V 
Sbjct: 128 VTVTKSDETSWDYLKPEVFAAIMDFYSSGQPLFLDSNTAAAM-----DTAIHEDDSEIVA 182

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 183 MIKELLETRIRPAVQDDGGDIEYRGFEPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 242

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 243 HYVPEVKGVEQ 253


>gi|294678745|ref|YP_003579360.1| NifU domain-containing protein [Rhodobacter capsulatus SB 1003]
 gi|294477565|gb|ADE86953.1| NifU domain protein [Rhodobacter capsulatus SB 1003]
          Length = 188

 Score =  208 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 134/190 (70%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG  V+ EG   F++ + A++SPLA RIF + G+ +V+ G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGLDVMPEGVADFTSVEAAQVSPLAGRIFRVAGVKAVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD+  +W H RP ++G IMEH+ SG P++     G        +G     D A++ 
Sbjct: 61  VTVTKDEATEWAHARPAIMGAIMEHYQSGQPVLMGAAAGGHTTGGADTG----EDGAIIS 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVARDGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 117 QIKELLDTRVRPAVARDGGDITFHGFEKGVVYLHMQGACAGCPSSTYTLKMGIENLLRHY 176

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 177 IPEVSEVRAV 186


>gi|325087305|gb|ADY77002.1| iron-sulfur cluster assembly protein NFU4 [Ipomoea batatas]
 gi|325087311|gb|ADY77005.1| iron-sulfur cluster assembly protein NFU4 [Ipomoea batatas]
          Length = 281

 Score =  208 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 88/191 (46%), Positives = 116/191 (60%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F I GI  V++G DF
Sbjct: 80  MFIQTQSTPNPLSLMFYPGKPVMETGSADFPNARSAMNSPLAKALFGIDGITRVFYGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   IM+ F SG P+  +                 E DS  V 
Sbjct: 140 VTVTKSDDASWDLLKPEIFAAIMDFFSSGKPLFLDSNTAASM-----DTAIQEDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+     IV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYRGFDADSGIVKLRMQGACSGCPSSSVTLKSGIENMLM 254

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 255 HYVPEVKGVEQ 265


>gi|163842411|ref|YP_001626815.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445]
 gi|163673134|gb|ABY37245.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445]
          Length = 190

 Score =  208 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE + PLA+++F++PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPPSAENTSPLAAKLFAVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEHGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|238231487|ref|NP_001154157.1| HIRA-interacting protein 5 [Oncorhynchus mykiss]
 gi|225704456|gb|ACO08074.1| HIRA-interacting protein 5 [Oncorhynchus mykiss]
          Length = 250

 Score =  207 bits (527), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 82/191 (42%), Positives = 121/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG++VL +G + F+  +EA  SPLA ++F I G+  V+ G DF
Sbjct: 56  MFIQTQDTPNPNSLKFLPGRMVLEQGTMDFTAPREAYCSPLARQLFRIDGVKGVFLGPDF 115

Query: 61  ITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   D  W+ ++P V   IM+ F SG P+++                  + D  V+
Sbjct: 116 ITITKTDVDLEWKLIKPDVFAAIMDFFTSGLPVVNEEDTP------RADTAPSDDDDEVI 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVLYCGFEDGIVKLKLQGSCTSCPSSMVTLKSGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 230 YVPEVEGVEQV 240


>gi|227820624|ref|YP_002824594.1| putative scaffold protein Nfu/NifU [Sinorhizobium fredii NGR234]
 gi|227339623|gb|ACP23841.1| putative scaffold protein Nfu/NifU [Sinorhizobium fredii NGR234]
          Length = 188

 Score =  207 bits (527), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 111/190 (58%), Positives = 144/190 (75%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPG++ VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEARTGSPLAARLFSIPGVSGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P VLG IMEHF+SG PI+      +    D     + E D A+V 
Sbjct: 61  FITVSKEGQEWQHLKPAVLGSIMEHFMSGQPIMSGASRAE--ETDQEGEFYDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVESVESV 188


>gi|294851540|ref|ZP_06792213.1| thioredoxin-like protein [Brucella sp. NVSL 07-0026]
 gi|294820129|gb|EFG37128.1| thioredoxin-like protein [Brucella sp. NVSL 07-0026]
          Length = 190

 Score =  207 bits (526), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 139/190 (73%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+ EG   F +   AE + PLA+++F +PG+  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAKLFVVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG P +      D          F E+D+ +V+
Sbjct: 61  FITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAAHGEEEFFDEADTEIVE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+G+ +G VFL M+GACSGCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHF 180

Query: 180 VPEVKDIRTV 189
           VPEV+ +  +
Sbjct: 181 VPEVQQVEQI 190


>gi|121601928|ref|YP_989428.1| NifU family protein [Bartonella bacilliformis KC583]
 gi|120614105|gb|ABM44706.1| NifU family protein [Bartonella bacilliformis KC583]
          Length = 192

 Score =  207 bits (526), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 97/189 (51%), Positives = 133/189 (70%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+V+L EG + F +++ A   SPLA+++F I  ++ V  GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVILSEGVLEFRDSEAAALGSPLAAKLFQISNVSGVLLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEH +S  PI+  G     +        + E D+ +V 
Sbjct: 61  FITVTKSDGEWQHLKPVILGTIMEHLLSNAPIVSTGAAAHAQSHTHNEEFYDEKDADIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F+G+  GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRVRPAVANDGGDITFRGFEHGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVVGVEA 189


>gi|163868796|ref|YP_001610020.1| NifU-related protein [Bartonella tribocorum CIP 105476]
 gi|161018467|emb|CAK02025.1| NifU-related protein [Bartonella tribocorum CIP 105476]
          Length = 192

 Score =  206 bits (525), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 99/189 (52%), Positives = 139/189 (73%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG + F + +EA + SPLA+++F+IP +  V+ GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSEGVLEFRDREEAAKNSPLAAKLFNIPNVNGVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+S +P+I            +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPVILGTIMEHFLSNEPVITTNATTQAHAHALNEEFYDEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVLGVEA 189


>gi|114706882|ref|ZP_01439782.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506]
 gi|114537830|gb|EAU40954.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506]
          Length = 187

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 103/189 (54%), Positives = 139/189 (73%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G   F++  EA + SPLA+R+F + G+  V+FG+D
Sbjct: 1   MFIQTEVTPNPATLKFLPGRVVLEQGTEEFTSIDEAAQRSPLAARLFEVDGVTGVFFGFD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F+TV KDQ DW HL+P +L  +MEHF++  P++           + G   F E D   V 
Sbjct: 61  FVTVTKDQGDWAHLKPAILAGLMEHFVANRPVMAETSA---MNSEPGEEFFDEGDKETVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA+DGGDI F+GYRDGIV+L+MRGACSGCPS++ TLK+G+ N+L HF
Sbjct: 118 TIKELIETRVRPAVAQDGGDITFRGYRDGIVYLNMRGACSGCPSSTATLKHGIQNLLRHF 177

Query: 180 VPEVKDIRT 188
           VPEV+++  
Sbjct: 178 VPEVEEVEA 186


>gi|15964154|ref|NP_384507.1| hypothetical protein SMc01119 [Sinorhizobium meliloti 1021]
 gi|307301299|ref|ZP_07581061.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti BL225C]
 gi|307317970|ref|ZP_07597407.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti AK83]
 gi|15073330|emb|CAC41838.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896372|gb|EFN27121.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti AK83]
 gi|306903755|gb|EFN34342.1| Scaffold protein Nfu/NifU [Sinorhizobium meliloti BL225C]
          Length = 188

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 111/190 (58%), Positives = 144/190 (75%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPG+  VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEALAGSPLAARLFSIPGVTGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG PI+   G  +    D     F E D A+V 
Sbjct: 61  FITVSKEAQEWQHLKPAILGSIMEHFMSGQPIMSGAGRAEQT--DEEDEFFDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVEAVESV 188


>gi|49476032|ref|YP_034073.1| hypothetical protein BH13490 [Bartonella henselae str. Houston-1]
 gi|49238840|emb|CAF28122.1| hypothetical protein BH13490 [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 102/189 (53%), Positives = 143/189 (75%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG VVL EG + F +++EA + SPLA+++F+IP +  V+FGYD
Sbjct: 1   MFIQTETTPNPATLKFLPGCVVLSEGVLEFRDSEEAAKNSPLAAKLFNIPNVNGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+SGDP+I+       +   +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPAILGTIMEHFLSGDPVINTNATRQAQTHALNEEFYNEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVVGVEA 189


>gi|319409218|emb|CBI82862.1| NifU-related protein [Bartonella schoenbuchensis R1]
          Length = 196

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 102/189 (53%), Positives = 141/189 (74%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G + F N+KEA + SPLA+++F+IP ++SV  G+D
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLAKGVLEFHNSKEADQNSPLAAKLFTIPNVSSVLLGHD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FI V K+  +W+HL+P +LG IMEHF+S DP + N      +  +     + E D+ +V 
Sbjct: 61  FIAVTKNDGEWQHLKPAILGTIMEHFLSNDPTVINDATLQTQAPEAYEEFYDEKDADIVM 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F+G+ DGIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKEILETRVRPAVANDGGDITFRGFEDGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVLGVEA 189


>gi|118590483|ref|ZP_01547885.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614]
 gi|118436946|gb|EAV43585.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614]
          Length = 185

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 101/189 (53%), Positives = 146/189 (77%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +  +A +SPLA ++F +PG+ +V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTYDFRSKADAGVSPLAQKLFDVPGVVAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ DW+H++P +LG+IME F+SG P++      +++  +     F   D+  V  
Sbjct: 61  VTVTKDETDWQHMKPAILGVIMEQFMSGQPVMATSEAENIEEGE----FFEAGDADTVST 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 117 IKELLETRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLRHFV 176

Query: 181 PEVKDIRTV 189
           PEV+++R +
Sbjct: 177 PEVEEVRPI 185


>gi|242086973|ref|XP_002439319.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor]
 gi|241944604|gb|EES17749.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor]
          Length = 268

 Score =  206 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  ++FG DF
Sbjct: 71  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRIFFGSDF 130

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V   IM+ + SG P+  +                 E DS +V 
Sbjct: 131 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQPLFLDSNAAASM-----DTAIHEDDSEIVA 185

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+     IV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 186 MIKELLETRIRPAVQDDGGDIEYRGFDPENGIVKLKMQGACSGCPSSSVTLKSGIENMLM 245

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 246 HYVPEVKGVEQ 256


>gi|332188730|ref|ZP_08390443.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. S17]
 gi|332011236|gb|EGI53328.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. S17]
          Length = 190

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 126/190 (66%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F++ +EA  SPLA  IF++  +  V+FG DF
Sbjct: 1   MLIETEPTPNPATLKFLPGRKVMDSGTRDFASPEEAAASPLAEAIFNLGDVTGVFFGRDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V      DW  ++P VLG++++HF +  P+   G        +  +      D+ +V 
Sbjct: 61  VSVTIAPGVDWSDVKPDVLGILLDHFSAQMPLFKQGAADFAVPAEEETFADNPEDADIVA 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D RVRPAVA DGGDIV++G+  G V+L M+GAC+GCPS++ TLK G+  +L H+
Sbjct: 121 QIRELIDTRVRPAVANDGGDIVYRGFDKGKVYLKMQGACAGCPSSTATLKNGIEQLLRHY 180

Query: 180 VPEVKDIRTV 189
           VPEV ++R V
Sbjct: 181 VPEVTEVRAV 190


>gi|254503238|ref|ZP_05115389.1| Scaffold protein Nfu/NifU N terminal domain protein [Labrenzia
           alexandrii DFL-11]
 gi|222439309|gb|EEE45988.1| Scaffold protein Nfu/NifU N terminal domain protein [Labrenzia
           alexandrii DFL-11]
          Length = 185

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 103/189 (54%), Positives = 146/189 (77%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +  +A  SPLA ++F +PG+A+V+FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTYDFRSKADAGASPLAEKLFDVPGVAAVFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+H++P +LG+IME F+SG P+++ G   D++  +       E+    V  
Sbjct: 61  VTVTKDDTDWQHMKPAILGVIMEQFMSGQPVMNAGESEDIEEGEFFEEGDQET----VAT 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L HFV
Sbjct: 117 IKELLETRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLRHFV 176

Query: 181 PEVKDIRTV 189
           PEV+++R +
Sbjct: 177 PEVEEVRPI 185


>gi|150395264|ref|YP_001325731.1| scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419]
 gi|150026779|gb|ABR58896.1| Scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419]
          Length = 188

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 112/190 (58%), Positives = 144/190 (75%), Gaps = 3/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F + +EA   SPLA+R+FSIPGI  VYFGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEALAGSPLAARLFSIPGITGVYFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K+  +W+HL+P +LG IMEHF+SG PI+   G  +    D     F E D A+V 
Sbjct: 61  FITVSKEAQEWQHLKPAILGSIMEHFMSGQPIMSGAGRAEQL--DEDEEFFDEGDEAIVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHF 178

Query: 180 VPEVKDIRTV 189
           VPEV+ + +V
Sbjct: 179 VPEVESVESV 188


>gi|163757734|ref|ZP_02164823.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43]
 gi|162285236|gb|EDQ35518.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43]
          Length = 187

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 100/190 (52%), Positives = 138/190 (72%), Gaps = 4/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPL-ASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VV+  G   F +A+EA  +   A ++F IPG+  V++GYD
Sbjct: 1   MFIQTESTPNPATLKFLPGKVVMQSGTADFRDAEEAGATSQLAGKLFGIPGVIGVFYGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ KD  DW+HL+P +LG IMEHF+SG P++        + ++         D  +V 
Sbjct: 61  FITITKDDADWQHLKPAILGTIMEHFMSGAPVMSGPVGEVPEGEEEFFES---GDETIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L++RVRPAVA+DGGDI F+G+RDG VFL M+GAC+GCPS++ TLK+G+ N+L HF
Sbjct: 118 TIKELLESRVRPAVAQDGGDITFRGFRDGKVFLHMKGACAGCPSSTATLKHGIQNLLRHF 177

Query: 180 VPEVKDIRTV 189
           VPEV+++  V
Sbjct: 178 VPEVREVEAV 187


>gi|254454487|ref|ZP_05067924.1| NifU domain protein [Octadecabacter antarcticus 238]
 gi|198268893|gb|EDY93163.1| NifU domain protein [Octadecabacter antarcticus 238]
          Length = 183

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 93/190 (48%), Positives = 132/190 (69%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ++ TPNPATLKF+PG  V+ +G + F   ++A  SPLAS++F + G+  V+FG DF
Sbjct: 1   MFIQSQQTPNPATLKFLPGVAVMEQGTVSFPTREDAARSPLASQLFDVNGVDGVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW  L+P +LG IMEHF SG P+++           M      + D  +V 
Sbjct: 61  ITVTKTDDMDWTPLKPAILGAIMEHFTSGQPLLNEDAS-------MSDHAVSDDDDELVT 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F G+  G+V+L ++GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDTRVRPAVAQDGGDILFHGFERGVVYLQLQGACSGCPSSTATLKGGIENMLRHY 173

Query: 180 VPEVKDIRTV 189
           +P+V ++R +
Sbjct: 174 IPDVIEVRAI 183


>gi|224110188|ref|XP_002315442.1| predicted protein [Populus trichocarpa]
 gi|222864482|gb|EEF01613.1| predicted protein [Populus trichocarpa]
          Length = 279

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 89/191 (46%), Positives = 119/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F NA+ A  SPLA  I+ I GI  V+FG DF
Sbjct: 78  MFIQTQSTPNPSSLMFYPGKPVMDVGSADFPNARSAMNSPLAKAIYGIDGINRVFFGPDF 137

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K D   WE L+P +   IM+ + SG+P+  +      K          E DS  V 
Sbjct: 138 ITITKSDDATWEFLKPEIFAAIMDFYSSGEPLFLDSQTAAAK-----DTAISEDDSETVA 192

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+ +    V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 193 MIKELLETRIRPAVQDDGGDIEYQGFDEETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 252

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 253 HYVPEVKGVEQ 263


>gi|288959669|ref|YP_003450010.1| thioredoxin [Azospirillum sp. B510]
 gi|288911977|dbj|BAI73466.1| thioredoxin [Azospirillum sp. B510]
          Length = 185

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 94/190 (49%), Positives = 131/190 (68%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL  G   F+  ++A  SPLA R+F I G+  V+ G DF
Sbjct: 1   MFIQTEQTPNPATLKFLPGRDVLGRGTADFTGREDAARSPLAQRLFEIEGVVGVFLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K D  DW  L+P +LG+IMEHF +  P++   G            +       +V+
Sbjct: 61  ITITKTDARDWFLLKPSILGVIMEHFTADRPVLLEEGGDGHAAAASADDEE------IVE 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRP+VA+DGGDI F+G+  G+V+L+M+GACSGCPS++ TLK+G+ N+L H+
Sbjct: 115 QIKELLDTRVRPSVAQDGGDITFQGFERGVVYLAMKGACSGCPSSTATLKHGIENMLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVVEVRAV 184


>gi|115462181|ref|NP_001054690.1| Os05g0155300 [Oryza sativa Japonica Group]
 gi|54291852|gb|AAV32220.1| unknown protein [Oryza sativa Japonica Group]
 gi|113578241|dbj|BAF16604.1| Os05g0155300 [Oryza sativa Japonica Group]
 gi|215697325|dbj|BAG91319.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222630253|gb|EEE62385.1| hypothetical protein OsJ_17174 [Oryza sativa Japonica Group]
          Length = 272

 Score =  205 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 72  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRVFFGSDF 131

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V  +IM+ + SG  +  +                 E DS +V 
Sbjct: 132 VTVTKSEETSWDYLKPEVFAVIMDFYSSGQSLFLDSSTAASM-----DTAIHEDDSEIVA 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 187 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 246

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 247 HYVPEVKGVEQ 257


>gi|301758232|ref|XP_002914967.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 420

 Score =  205 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 225 MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 284

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 285 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVTEETSSGEAGS--------EEDDEVV 336

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 337 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 396

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 397 YIPEVEGVEQV 407


>gi|125550903|gb|EAY96612.1| hypothetical protein OsI_18522 [Oryza sativa Indica Group]
          Length = 272

 Score =  205 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 118/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA  +F+I G+  V+FG DF
Sbjct: 72  MFIQTQSTPNPQSLMFYPGKPVMEVGSSDFPNARTAMTSPLAKALFAIDGVTRVFFGSDF 131

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W++L+P V   IM+ + SG  +  +                 E DS +V 
Sbjct: 132 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQSLFLDSSTAASM-----DTAIHEDDSEIVA 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 187 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 246

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 247 HYVPEVKGVEQ 257


>gi|302832552|ref|XP_002947840.1| hypothetical protein VOLCADRAFT_88148 [Volvox carteri f.
           nagariensis]
 gi|300266642|gb|EFJ50828.1| hypothetical protein VOLCADRAFT_88148 [Volvox carteri f.
           nagariensis]
          Length = 314

 Score =  205 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/189 (44%), Positives = 122/189 (64%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F+PG+ V+  G + FS+A+E   SPLA ++F+I GI SV+FG DF
Sbjct: 82  MFIQTQPTPNPNSLMFVPGKPVMESGTLEFSSAREGMKSPLAKKLFAIDGITSVFFGSDF 141

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV  +D + W  L+P +   IM+ + SG+P++ +                   DS VV 
Sbjct: 142 VTVTKRDDFTWPVLKPDIFAAIMDFYSSGEPLVSDAAALAS-----SDTAIHPDDSEVVA 196

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDIV+KG+ +    V + + GACS CPS++ TLK G+ N+L 
Sbjct: 197 MIKELLETRIRPAVQEDGGDIVYKGFEEDTGMVMVKLVGACSTCPSSTVTLKNGIENMLM 256

Query: 178 HFVPEVKDI 186
           H++PEVK +
Sbjct: 257 HYIPEVKGV 265


>gi|225717260|gb|ACO14476.1| NFU1 iron-sulfur cluster scaffold homolog [Esox lucius]
          Length = 253

 Score =  205 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG +VL  G + F+  +EA   PLA ++F I G+  V+ G DF
Sbjct: 59  MFIQTQDTPNPNSLKFLPGCMVLERGTMDFAAPREAYCCPLARQLFGIDGVKGVFLGPDF 118

Query: 61  ITVGKDQYD--WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   D  W+ ++P V   IM+ F SG P+++                  + D  V+
Sbjct: 119 ITITKANVDLEWKLIKPDVFAAIMDFFASGLPVMNEEDTP------RADTAPSDDDDEVI 172

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 173 TMIKELLDTRIRPTVQEDGGDVLYRGFEDGIVKLKLQGSCTSCPSSIVTLKSGIQNMLQF 232

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 233 YVPEVEGVEQV 243


>gi|240850980|ref|YP_002972380.1| nitrogen fixation protein [Bartonella grahamii as4aup]
 gi|240268103|gb|ACS51691.1| nitrogen fixation protein [Bartonella grahamii as4aup]
          Length = 192

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 140/189 (74%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL EG + F + +EA + SPLA+++F+IP I  V+ GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSEGVLEFRDPEEAAKNSPLAAKLFNIPNINGVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K + +W+HL+P +LG IMEHF+S +P+I        +   +    + E D+ +V 
Sbjct: 61  FITVSKKEGEWQHLKPVILGTIMEHFLSNEPVITTNATIQAQTHALNEEFYDEKDADIVL 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F+G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 TIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVLGVEA 189


>gi|116250169|ref|YP_766007.1| nifU iron-sulphur cluster scaffold protein [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254817|emb|CAK05891.1| putative nifU iron-sulphur cluster scaffold protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 188

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 101/188 (53%), Positives = 139/188 (73%), Gaps = 1/188 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F + +EA+ SPLA+R+F I G+  VYFGYDF
Sbjct: 1   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARLFEISGVTGVYFGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V KD  DW+HL+P +LG IMEHF+SG P++ +  +     D          D ++V  
Sbjct: 61  ISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADADDEFFDEG-DESIVLT 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+G++DG V+L+M+G+C+GCPS++ TLK+GV N+L HFV
Sbjct: 120 IKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFV 179

Query: 181 PEVKDIRT 188
           PEV+++  
Sbjct: 180 PEVQEVIA 187


>gi|49474596|ref|YP_032638.1| hypothetical protein BQ10720 [Bartonella quintana str. Toulouse]
 gi|49240100|emb|CAF26539.1| hypothetical protein BQ10720 [Bartonella quintana str. Toulouse]
          Length = 192

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 135/189 (71%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL +G + F N++EA + SPLA+++F+IP +  V  GYD
Sbjct: 1   MFIQTETTPNPATLKFLPGRVVLSKGVLEFRNSEEAAKNSPLAAKLFNIPNVNGVLLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEHF+S  P+I        +   +    + E D  +V 
Sbjct: 61  FITVSKKDGEWQHLKPAILGTIMEHFLSDAPVIKTNATIQAQTHALNEEFYDEKDVDIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK G+ N+L HF
Sbjct: 121 TIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKTGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVLGVEA 189


>gi|83594860|ref|YP_428612.1| nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170]
 gi|83577774|gb|ABC24325.1| Nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170]
          Length = 183

 Score =  204 bits (518), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 94/190 (49%), Positives = 133/190 (70%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPA+LKF+PG+ VL  G   F++   A  SPLA R+F+I G+  +Y G DF
Sbjct: 1   MFIQTERTPNPASLKFLPGKAVLPGGGRDFADVGAAGPSPLARRLFAIDGVTGIYLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K +  DW+ ++P VLG IMEHF SG+P++  G   +              D  VV+
Sbjct: 61  ITVSKAEAEDWQVIKPLVLGAIMEHFTSGEPVLIAGTAAESAGSA--------EDDEVVR 112

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+++L+ RVRPAVA+DGGDIVF  ++DG+V+L +RG+CSGCPS++ TLK+G+ N+L H+
Sbjct: 113 QIRDLLETRVRPAVAQDGGDIVFDRFQDGVVYLHLRGSCSGCPSSTATLKHGIENMLRHY 172

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 173 IPEVEAVEAV 182


>gi|294012036|ref|YP_003545496.1| nitrogen-fixing NifU-like protein [Sphingobium japonicum UT26S]
 gi|292675366|dbj|BAI96884.1| nitrogen-fixing NifU-like protein [Sphingobium japonicum UT26S]
          Length = 190

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/190 (44%), Positives = 125/190 (65%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KFIPG+VV+  G   F+  +EAE SPLA  +F +  +  V+FG DF
Sbjct: 1   MLIETEATPNPATVKFIPGRVVMGMGTRDFATPEEAEASPLADALFGLGDVTGVFFGGDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V       W  ++P +L +++EHF +  P+   G  G++ +           D  +V 
Sbjct: 61  ISVTIAPGAQWSDVKPDILSILLEHFSANMPLFRPGSAGEIFVPQEEEFADDPEDEEIVA 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D RVRPAVA DGGDI+++G+  G V+L M+GACSGCPS++ TLK G+  +L H+
Sbjct: 121 QIRELIDTRVRPAVANDGGDIIYRGFDKGTVYLRMQGACSGCPSSTATLKNGIEQLLKHY 180

Query: 180 VPEVKDIRTV 189
           VPEV ++R V
Sbjct: 181 VPEVTEVRAV 190


>gi|241156886|ref|XP_002407882.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215494245|gb|EEC03886.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 260

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 123/191 (64%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP  LKF+P   VL +G   F     A+ SPLA  +F + G+ +V+FG DF
Sbjct: 48  MFIQTQETPNPNCLKFLPNVKVLEQGTRDFPTLASAKDSPLAKHLFRVEGVKAVFFGSDF 107

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D+ +W+ L+P +   IM+ F +G P+++  G   +  D        E DS  V
Sbjct: 108 ITVTKADDETEWQVLKPHLYAAIMDFFTTGLPVVNEDGTEPVAED----TRPKEDDSETV 163

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGGDIV+ G+ DG+V L ++G+C+GCPS+S TLK G+ N+L  
Sbjct: 164 LMIKELIETRIRPTVQEDGGDIVYMGFEDGVVKLKLQGSCTGCPSSSVTLKAGIQNMLQF 223

Query: 179 FVPEVKDIRTV 189
           +VPEVKD+  V
Sbjct: 224 YVPEVKDVEQV 234


>gi|307293136|ref|ZP_07572982.1| Scaffold protein Nfu/NifU [Sphingobium chlorophenolicum L-1]
 gi|306881202|gb|EFN12418.1| Scaffold protein Nfu/NifU [Sphingobium chlorophenolicum L-1]
          Length = 190

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KF+PG+VV+  G   F+  +EAE SPLA  +F +  +  V+FG DF
Sbjct: 1   MLIETEATPNPATVKFLPGRVVMGMGTRDFATPEEAEASPLADALFGLGDVTGVFFGGDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V       W  ++P +L +++EHF    P+   G  GD+ + +         D+ +V 
Sbjct: 61  ISVTIAPGAQWSDVKPDILSILLEHFSVNMPLFAPGSAGDIFVPEEEEFADDPEDAEIVS 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D RVRPAVA DGGDIV++G+  G V+L M+GACSGCPS++ TLK G+  +L H+
Sbjct: 121 QIRELIDTRVRPAVANDGGDIVYRGFDKGTVYLRMQGACSGCPSSTATLKNGIEQLLKHY 180

Query: 180 VPEVKDIRTV 189
           VPEV ++R V
Sbjct: 181 VPEVTEVRAV 190


>gi|149186788|ref|ZP_01865099.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21]
 gi|148829696|gb|EDL48136.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21]
          Length = 193

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 88/192 (45%), Positives = 130/192 (67%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPA+LKF+PG+ V+ +G   F+N + AE SPLA  IF    + +V+FG DF
Sbjct: 1   MFIETETTPNPASLKFLPGRPVMGQGTREFANPEAAEASPLAQAIFDTGEVVNVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES---DSA 116
           ITV       W  L+P VL ++++HF+S  P+   G  G + +        +E    D+ 
Sbjct: 61  ITVTSAPGVSWSDLKPQVLSILLDHFVSEAPLFVPGTAGGIAVPAEDEALLVEENAADAD 120

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +V +I E+L+ RVRPAVA DGGDI ++G++DG+V+L ++GACSGCPS++ TLK+G+  +L
Sbjct: 121 IVAQINELLETRVRPAVAGDGGDIQYRGFKDGVVYLQLQGACSGCPSSTATLKHGIEGLL 180

Query: 177 NHFVPEVKDIRT 188
            H+VPEV ++R 
Sbjct: 181 KHYVPEVVEVRA 192


>gi|170016007|ref|NP_001116180.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Danio
           rerio]
 gi|169158109|emb|CAQ14737.1| HIRA interacting protein 5 [Danio rerio]
          Length = 243

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 122/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG+ VL  G + F+  ++A  SPLA ++F I G+ SV+FG DF
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAFCSPLARQLFRIDGVKSVFFGPDF 110

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   + +W+ ++P V   IM+ F SG P+I+                  E D  VV
Sbjct: 111 ITITKTSGETEWKVIKPDVFATIMDFFTSGLPVINEADAP------RADTAPSEDDDEVV 164

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 165 AMIKELLDTRIRPTVQEDGGDVLYHGFEDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQF 224

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 225 YVPEVEGVEQV 235


>gi|37681825|gb|AAQ97790.1| HIRA interacting protein 5 [Danio rerio]
 gi|62205090|gb|AAH92670.1| HIRA interacting protein 5 [Danio rerio]
 gi|182891738|gb|AAI65097.1| Hirip5 protein [Danio rerio]
          Length = 243

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 122/191 (63%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG+ VL  G + F+  ++A  SPLA ++F I G+ SV+FG DF
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAFCSPLARQLFRIDGVKSVFFGPDF 110

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K   + +W+ ++P V   IM+ F SG P+++                  E D  VV
Sbjct: 111 ITITKTSGETEWKVIKPDVFATIMDFFTSGLPVVNEADAP------RADTAPSEDDDEVV 164

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++ G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 165 AMIKELLDTRIRPTVQEDGGDVLYHGFEDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQF 224

Query: 179 FVPEVKDIRTV 189
           +VPEV+ +  V
Sbjct: 225 YVPEVEGVEQV 235


>gi|294085162|ref|YP_003551922.1| nitrogen-fixing NifU domain-containing protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664737|gb|ADE39838.1| nitrogen-fixing NifU domain protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 187

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 96/189 (50%), Positives = 125/189 (66%), Gaps = 6/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNPATLKFIPG  VL +G   F  A  A  SP+A R+F + G+A V+ G DF
Sbjct: 1   MFIQTQDTPNPATLKFIPGVPVLEQGTADFPAADSAGSSPMARRLFQVDGVAGVFLGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I V K D+ DW  L+P +L  IMEHF SG P+I +        +     D        V+
Sbjct: 61  IAVTKVDEMDWFALKPSILAGIMEHFASGLPVIEDNAGNMTDANTDDDEDDD-----TVK 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +LD RVRPAVA DGGDIVF+ + DG+V L MRGAC GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKHLLDTRVRPAVAMDGGDIVFQDFDDGVVTLQMRGACQGCPSSTATLKMGIENMLKHY 175

Query: 180 VPEVKDIRT 188
           +P+V+++R 
Sbjct: 176 IPQVREVRA 184


>gi|239047306|ref|NP_001131382.2| hypothetical protein LOC100192708 [Zea mays]
 gi|238908578|gb|ACF79773.2| unknown [Zea mays]
          Length = 268

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ A  SPLA   F+I G+  V+FG DF
Sbjct: 71  MFIQTQSTPNPQSLMFYPGKPVMEIGSSDFPNARTAMTSPLAKSPFAIDGVTRVFFGSDF 130

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++  W+ L+P V   IM+ + SG P+  +                 E DS +V 
Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAAASM-----DTAIHEDDSEIVA 185

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 186 MIKELLETRIRPAVQDDGGDIEYRGFDPETGTVKLKMQGACSGCPSSSVTLKSGIENMLM 245

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 246 HYVPEVKGVEQ 256


>gi|209883678|ref|YP_002287535.1| nitrogen-fixing NifU domain protein [Oligotropha carboxidovorans
           OM5]
 gi|209871874|gb|ACI91670.1| nitrogen-fixing NifU domain protein [Oligotropha carboxidovorans
           OM5]
          Length = 187

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 98/188 (52%), Positives = 138/188 (73%), Gaps = 2/188 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG++V+  G + F++      SPLA+++F IPG+  V++  DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRLVIESGTMEFTDRDSTARSPLAAKLFDIPGVTGVFYSSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K + DW+HL+P +LG IMEH++SG PI+ +G   D          F E+D+  V  
Sbjct: 61  ITVTKGEGDWQHLKPAILGTIMEHYMSGAPILADGAKPDAGPHAEE--FFNEADAETVTI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIVFL M+G+CSGCPS++ TLK+G+ N+L HFV
Sbjct: 119 IKDIIETRVRPAVASDGGDITFRGFKDGIVFLDMKGSCSGCPSSTATLKHGIQNLLKHFV 178

Query: 181 PEVKDIRT 188
           P+V ++R 
Sbjct: 179 PDVVEVRP 186


>gi|319898609|ref|YP_004158702.1| NifU-related protein [Bartonella clarridgeiae 73]
 gi|319402573|emb|CBI76118.1| NifU-related protein [Bartonella clarridgeiae 73]
          Length = 196

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 99/189 (52%), Positives = 139/189 (73%), Gaps = 1/189 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG +VL +G + F N +EA + SPLA+++F+IP + SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGCIVLPQGVLEFYNREEAAKNSPLAAKLFNIPNVKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I    +   +   +    F E D+ +V 
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEHFLSNDPVITTNVITQTEAHMLDKEFFDEKDADIVV 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ R+RPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 121 VIKELLETRIRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 180

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 181 IPEVLGVEA 189


>gi|209484091|gb|ACI47520.1| iron-sulfer cluster scaffold protein NFU4 [Eucalyptus grandis]
          Length = 243

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 114/191 (59%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V+  G+  F NA+ +  S LA  +F I G+  V++G DF
Sbjct: 40  MFIQTQSTPNPMSLMFYPGKPVMEVGSADFPNARTSMNSALARALFGIDGVTRVFYGSDF 99

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   IM+ + SG P+  +                 E DS  V 
Sbjct: 100 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLFLDSQTASAM-----DTAIHEDDSETVA 154

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 155 MIKELLETRIRPAVQDDGGDIEYRGFDLDTGIVKLRMQGACSGCPSSSVTLKSGIENMLM 214

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 215 HYVPEVKAVEQ 225


>gi|255568026|ref|XP_002524990.1| HIRA-interacting protein, putative [Ricinus communis]
 gi|223535734|gb|EEF37397.1| HIRA-interacting protein, putative [Ricinus communis]
          Length = 271

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G++ F NA+ A  SPLA  ++ I G   V+FG DF
Sbjct: 70  MFIQTQSTPNPSSLMFYPGKPVMEVGSVDFPNARAALNSPLAKSLYGIDGTTRVFFGSDF 129

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ L+P +   IM+ + SG P+  +  +   K          + DS  V 
Sbjct: 130 ITVTKSDDVSWDLLKPEIFAAIMDFYSSGQPLFLDSEIAASK-----DTAIHKDDSETVA 184

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 185 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 244

Query: 178 HFVPEVKDIRT 188
           H+V EVK +  
Sbjct: 245 HYVSEVKGVEQ 255


>gi|71021777|ref|XP_761119.1| hypothetical protein UM04972.1 [Ustilago maydis 521]
 gi|46100569|gb|EAK85802.1| hypothetical protein UM04972.1 [Ustilago maydis 521]
          Length = 293

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 124/193 (64%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKF+PG+ V+  G   F + + +  SPLA ++F+IPG+ SV++G DF
Sbjct: 72  MFIQTESTPNEDSLKFLPGRQVMESGTHEFLDTRSSMASPLAKKLFNIPGVVSVFYGPDF 131

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD ++ W  L+P +   IME F SG P+  +        D       +++DS VV 
Sbjct: 132 VTVSKDAEHQWSILKPEIYSSIMEFFTSGHPLFTDPESAAGSQD----TVILDTDSEVVA 187

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY---RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+LD RVRPA+  DGGD+ ++G+    DGIV + ++G+C GC S++ TLK G+  +L
Sbjct: 188 MIKELLDTRVRPAIQEDGGDLEYRGFGEDTDGIVKVKLKGSCRGCDSSTVTLKSGIERML 247

Query: 177 NHFVPEVKDIRTV 189
            H++PEVK +  V
Sbjct: 248 MHYIPEVKGVEQV 260


>gi|91089707|ref|XP_974909.1| PREDICTED: similar to AGAP000598-PA [Tribolium castaneum]
 gi|270011317|gb|EFA07765.1| hypothetical protein TcasGA2_TC005319 [Tribolium castaneum]
          Length = 244

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/192 (46%), Positives = 121/192 (63%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT++TPNP +LKF+PG  VL EG  I F N + A  SPL   +F I G+ SV+ G +
Sbjct: 49  MFIQTQETPNPNSLKFLPGVKVLEEGQTIDFPNGQAAYCSPLGKLLFRIEGVKSVFLGPE 108

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  D+ +W+ ++P +   IM+ F SG P++++                 E DS +
Sbjct: 109 FITVTKTDDEIEWKIIKPEIFATIMDFFASGLPVLNDATPN-------ADTQINEDDSEI 161

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGDI+F GY DGIV L ++GAC+ CPS+  TLK GV N+L 
Sbjct: 162 VQMIKELLDTRIRPTVQEDGGDIIFMGYDDGIVKLKLQGACTSCPSSIVTLKNGVQNMLQ 221

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 222 FYIPEVLGVEQV 233


>gi|296087967|emb|CBI35250.3| unnamed protein product [Vitis vinifera]
          Length = 202

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 116/191 (60%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L F PG+ V+  G+  F N++ A  SPLA  ++ I GI  V+FG DF
Sbjct: 1   MFIQTQSTPNPASLMFYPGKPVMEVGSADFPNSRSAMSSPLAKSLYGIDGITRVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D   W+ ++P +   IM+ + SG P+  +                 E DS  V 
Sbjct: 61  ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTAAAM-----DTAIHEDDSETVA 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 116 MIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLM 175

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 176 HYVPEVKGVEQ 186


>gi|217979031|ref|YP_002363178.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2]
 gi|217504407|gb|ACK51816.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2]
          Length = 187

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 94/189 (49%), Positives = 133/189 (70%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP TLKF+PG+ V+  G +     ++A  SPLA  +F + G+  V+FG DF
Sbjct: 1   MFIETETTPNPKTLKFLPGRPVMSAGTLDIKEPEDARQSPLAEALFELDGVKGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV     DW+ L+P VLG IMEHF+SGDP+++      +  D      F ESD+  V  
Sbjct: 61  ITVTNANEDWQELKPTVLGAIMEHFLSGDPLLNEHAH--VSPDAGEREFFEESDAETVTA 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++  VRPAVA DGGDI F+GYRDGIV+L+M+G+CSGCPS++ TLK+G+ N+L H+V
Sbjct: 119 IKQLIETHVRPAVANDGGDIKFRGYRDGIVYLAMKGSCSGCPSSTATLKHGIQNLLKHYV 178

Query: 181 PEVKDIRTV 189
           P+V+ + ++
Sbjct: 179 PDVQSVESI 187


>gi|94498004|ref|ZP_01304568.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58]
 gi|94422587|gb|EAT07624.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58]
          Length = 194

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/191 (46%), Positives = 132/191 (69%), Gaps = 2/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPAT+KFIPG+VV+  G   F++ +EAE SPLAS +F++  +  V+FG DF
Sbjct: 4   MLIETEPTPNPATVKFIPGRVVMGAGTRDFASPEEAEASPLASALFTLGDVTGVFFGGDF 63

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK-LDDMGSGDFIESDSAVV 118
           I+V   +  DW  ++P VL +++EHF +  P+   G  G++    D  +      D+ +V
Sbjct: 64  ISVTIGEGSDWRDVKPEVLSILLEHFSANMPLFVAGSAGEIHVPADDDAFAENPEDAEIV 123

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +I+E++D RVRPAVA DGGDI+++G+  G V+L M+GAC+GCPS+S TLK G+  +L H
Sbjct: 124 DQIRELIDTRVRPAVANDGGDIIYRGFDKGTVYLKMQGACAGCPSSSATLKNGIEQLLKH 183

Query: 179 FVPEVKDIRTV 189
           +VPEV ++R V
Sbjct: 184 YVPEVTEVRAV 194


>gi|156548302|ref|XP_001602506.1| PREDICTED: similar to protein phosphatase 2a [Nasonia vitripennis]
          Length = 511

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 88/192 (45%), Positives = 118/192 (61%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL +G    F +A +A  SPLA  +F I G+ SV+FG D
Sbjct: 67  MFIQTQDTPNPNSLKFIPGVEVLGKGQTKDFPSATDAFCSPLAKMLFRIEGVKSVFFGSD 126

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  +  +W+ ++P +   IM+ F SG PI                    E D  +
Sbjct: 127 FITITKIDEDVEWKLIKPEIFATIMDFFASGLPIFTEAQSS-------SDTVINEDDDEI 179

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TLK GV N++ 
Sbjct: 180 VQMIKELLDTRIRPTVQEDGGDIVFMGFENGIVKLKMQGSCTSCPSSVVTLKNGVQNMMQ 239

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 240 FYIPEVLGVEQV 251


>gi|103487552|ref|YP_617113.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256]
 gi|98977629|gb|ABF53780.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256]
          Length = 190

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 86/190 (45%), Positives = 132/190 (69%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F++A+EAE SPLAS +FS+  +  V+FG DF
Sbjct: 1   MLIETESTPNPATLKFLPGRTVMETGTRDFASAEEAEASPLASALFSLGDVTGVFFGRDF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V      +W  ++P VLG++M+HF++G P+ +    G     +        +D+ +++
Sbjct: 61  VSVTIAPGAEWADVKPDVLGIVMDHFLAGVPLFNAASAGSAVPPEDAGFADDPADADIIE 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+++ RVRPAVA DGGDIV++G+  G V+L M+GAC+GCPS++ TLK G+ ++L H+
Sbjct: 121 QIKELIETRVRPAVANDGGDIVYRGFDKGNVYLKMQGACAGCPSSTATLKNGIESLLKHY 180

Query: 180 VPEVKDIRTV 189
           VPEV  +  V
Sbjct: 181 VPEVTAVHAV 190


>gi|146278315|ref|YP_001168474.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556556|gb|ABP71169.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 186

 Score =  201 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F++A+ A  SPLA RIF   G+ASV+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFASAEAAATSPLARRIFGAGGVASVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I V K D+  W+H++P +LG IMEH+ SG P++             G       D  +V+
Sbjct: 61  IAVTKEDEVVWDHVKPAILGAIMEHYQSGAPVLEGEQAASGHATHDGP------DEEIVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|154254042|ref|YP_001414866.1| scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1]
 gi|154157992|gb|ABS65209.1| Scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1]
          Length = 201

 Score =  201 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 102/190 (53%), Positives = 134/190 (70%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL EG A  F  A+ A  SPLA R+F++  +  V+FG D
Sbjct: 16  MFIQTEATPNPATLKFLPGREVLGEGRAADFPTAEAAARSPLAMRLFAVENVTGVFFGSD 75

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FITV K   +W+HL+P +LG IMEHF  G PI+ +    D        G     D  +V 
Sbjct: 76  FITVTKSGGEWQHLKPALLGAIMEHFTGGAPILFSAAPDDDDAHAAHEG----EDGEIVT 131

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F+GY +G+VFL+M+GAC+GCPS++ TLK GV N+L H+
Sbjct: 132 QIKEILDTRVRPAVAQDGGDITFQGYEEGVVFLNMQGACAGCPSSTVTLKRGVENMLKHY 191

Query: 180 VPEVKDIRTV 189
           +PE+ ++R V
Sbjct: 192 IPEIVEVRQV 201


>gi|326386713|ref|ZP_08208334.1| nitrogen-fixing NifU-like protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208766|gb|EGD59562.1| nitrogen-fixing NifU-like protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 191

 Score =  200 bits (509), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 130/190 (68%), Gaps = 2/190 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG++V+ +G   F++A+EA ISPLA  +FS+  +  V FG +F
Sbjct: 1   MFIETETTPNPATLKFLPGEIVMADGTREFTSAEEAAISPLADALFSLGDVTGVLFGREF 60

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG-DMKLDDMGSGDFIESDSAVV 118
           ++V       W   +P VL ++++HF+S  P+      G  +  ++        +D+ +V
Sbjct: 61  VSVTIAPGSAWSDTKPQVLAVLLDHFVSQAPLFVAASAGFSVPAEEDEDFGDDPADADIV 120

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +I ++++ R+RPAVA DGGDI ++G+RDG+V+L M+GACSGCPS+S TLK G+  +L H
Sbjct: 121 DQILDLIETRIRPAVANDGGDISYRGFRDGVVYLRMQGACSGCPSSSATLKNGIEALLKH 180

Query: 179 FVPEVKDIRT 188
           +VPEV ++R 
Sbjct: 181 YVPEVNEVRA 190


>gi|114571567|ref|YP_758247.1| NifU domain-containing protein [Maricaulis maris MCS10]
 gi|114342029|gb|ABI67309.1| nitrogen-fixing NifU domain protein [Maricaulis maris MCS10]
          Length = 187

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 87/192 (45%), Positives = 129/192 (67%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+ +  +G   F + ++A  +PLA+ +F + G++ V+FG DF
Sbjct: 1   MFIQTEATPNPNTLKFLPGREIAPDGPREFESEEDAASAPLAADLFLVDGVSGVFFGEDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I + K D Y+W+H++P +LG IM+   SG P      L   + ++ G  ++   +  +V+
Sbjct: 61  IAITKTDAYEWDHIKPFLLGTIMDGLQSGRP------LVGSETNETGHANYAGENEGLVK 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            I E++D RVRPAVA+DGGDI+F  Y    GIV L MRGACSGCPS++ TLK G+ N+L 
Sbjct: 115 EIIELIDTRVRPAVAQDGGDILFHSYLADSGIVRLKMRGACSGCPSSTMTLKSGIENLLK 174

Query: 178 HFVPEVKDIRTV 189
           H++PE++ +  V
Sbjct: 175 HYIPEIQSVEAV 186


>gi|114326814|ref|YP_743971.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314988|gb|ABI61048.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis
           CGDNIH1]
          Length = 186

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG+ V+  G   F++A  A+ SPLA  +F +PGIA V+ G DF
Sbjct: 1   MFIETEGTPNPATLKFLPGRDVMPGGTADFASAATAQRSPLALALFELPGIARVFLGADF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K    +W  L+P VL  +M+HF++G P++++         D+   D    D  +V 
Sbjct: 61  VTVTKSSDVEWPELKPQVLAALMDHFVTGRPVLNDTPS------DVLEEDIRPEDREIVD 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+GYRDG+V L M+GACSGCPS+  TLK+G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAGDGGDIVFRGYRDGVVLLHMQGACSGCPSSRATLKHGIENMLRHY 174

Query: 180 VPEVKDIRTV 189
           VPEV  +  V
Sbjct: 175 VPEVLAVEQV 184


>gi|194897711|ref|XP_001978709.1| GG17526 [Drosophila erecta]
 gi|263504966|sp|B3NYF7|NFU1_DROER RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|190650358|gb|EDV47636.1| GG17526 [Drosophila erecta]
          Length = 283

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+  ++  +W  ++P V  +IM+ F SG P++H+              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLHDAQPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|18402817|ref|NP_566673.1| NFU4; structural molecule [Arabidopsis thaliana]
 gi|75273382|sp|Q9LIG6|NIFU4_ARATH RecName: Full=NifU-like protein 4, mitochondrial; Short=AtNfu-III;
           Short=AtNfu4; Flags: Precursor
 gi|13899085|gb|AAK48964.1|AF370537_1 Unknown protein [Arabidopsis thaliana]
 gi|9294004|dbj|BAB01907.1| unnamed protein product [Arabidopsis thaliana]
 gi|18377516|gb|AAL66924.1| unknown protein [Arabidopsis thaliana]
 gi|28207822|emb|CAD55561.1| NFU4 protein [Arabidopsis thaliana]
 gi|332642927|gb|AEE76448.1| NifU-like protein 4 [Arabidopsis thaliana]
          Length = 283

 Score =  200 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 116/191 (60%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N + A  SPLA  I+SI G+  V+FG DF
Sbjct: 80  MFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPLAKSIYSIDGVVRVFFGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   +M+ + SG P+  +      K          E DS  V 
Sbjct: 140 VTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAAK-----DTAISEDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI + G+     IV L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSGIENMLM 254

Query: 178 HFVPEVKDIRT 188
           H+V EVK +  
Sbjct: 255 HYVSEVKGVEQ 265


>gi|148555295|ref|YP_001262877.1| scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1]
 gi|148500485|gb|ABQ68739.1| Scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1]
          Length = 192

 Score =  200 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 89/189 (47%), Positives = 131/189 (69%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+PG+ V+  G   F +  EA  SPLA  +FS+  +  V+FG DF
Sbjct: 4   MLIETEPTPNPATLKFLPGRPVMTTGTRDFVDPDEASASPLAEALFSLGDVTGVFFGRDF 63

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V   +  +W  L+P VLG++++HF S  P+   G   ++ +DD        +D+ +V 
Sbjct: 64  VSVTAAEGVEWTGLKPQVLGVLLDHFSSEAPLFTGGSAAEIAIDD-SDFTDDPADADIVA 122

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK+++D RVRPAVARDGGDIV++G++ G V+LSM+GACSGCPS++ TLK G+  +L H+
Sbjct: 123 QIKDLIDTRVRPAVARDGGDIVYRGFQRGTVYLSMQGACSGCPSSAATLKQGIETLLKHY 182

Query: 180 VPEVKDIRT 188
           VPEV ++R 
Sbjct: 183 VPEVTEVRA 191


>gi|159465189|ref|XP_001690805.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158279491|gb|EDP05251.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 319

 Score =  200 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 85/189 (44%), Positives = 118/189 (62%), Gaps = 8/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F+PG+ V+  G + F +A+E   SPLA ++F++ GI SV+FG DF
Sbjct: 84  MFIQTQPTPNPNSLMFVPGKPVMQSGTMEFGSAREGMKSPLAKKLFAVDGITSVFFGSDF 143

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+  KD+Y W  L+P V   IME + S         + D              DS VV 
Sbjct: 144 VTITKKDEYSWPVLKPDVFAAIMEFYAS-----GEALISDADALAASDTAIHPDDSEVVA 198

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDIVFKG+ +    V + + GACS CPS++ TLK G+ N+L 
Sbjct: 199 MIKELLETRIRPAVQEDGGDIVFKGFEEDTGMVQVKLVGACSTCPSSTVTLKNGIENMLM 258

Query: 178 HFVPEVKDI 186
           H++PEVK +
Sbjct: 259 HYIPEVKGV 267


>gi|221232999|ref|YP_002515435.1| mitochondrial-type Fe-S cluster assembly protein NFU [Caulobacter
           crescentus NA1000]
 gi|220962171|gb|ACL93527.1| mitochondrial-type Fe-S cluster assembly protein NFU [Caulobacter
           crescentus NA1000]
          Length = 190

 Score =  200 bits (508), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 95/191 (49%), Positives = 125/191 (65%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL +GA  F   +E + SPLA  +F +  ++ V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLGDGAREFRTPEEGDASPLAKALFELGDVSRVFFGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +        D+   GD+ E  S +V 
Sbjct: 61  LTVTKGEDAQWPHLKAPILAAIMDHFTSGRPLLLDQTAESGGHDE---GDYDEETSQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +      V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 118 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKSGVENMLK 177

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 178 HYVPEVTRVEQ 188


>gi|16124317|ref|NP_418881.1| NifU-like domain-containing protein [Caulobacter crescentus CB15]
 gi|13421157|gb|AAK22049.1| NifU-like domain protein [Caulobacter crescentus CB15]
          Length = 224

 Score =  200 bits (508), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 95/191 (49%), Positives = 125/191 (65%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL +GA  F   +E + SPLA  +F +  ++ V+FG DF
Sbjct: 35  MFIQTETTPNPEVLKFLPGREVLGDGAREFRTPEEGDASPLAKALFELGDVSRVFFGPDF 94

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +        D+   GD+ E  S +V 
Sbjct: 95  LTVTKGEDAQWPHLKAPILAAIMDHFTSGRPLLLDQTAESGGHDE---GDYDEETSQIVA 151

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +      V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 152 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKSGVENMLK 211

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 212 HYVPEVTRVEQ 222


>gi|46201919|ref|ZP_00054106.2| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum
           magnetotacticum MS-1]
          Length = 182

 Score =  200 bits (508), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG VV+ +G   F+ A  A  SPLA+R+F+I G+ SV+ G DF
Sbjct: 1   MFIQTEPTPNPATLKFLPGTVVMGQGTADFAEASRASGSPLATRLFAIEGVGSVFLGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW+ ++P VL  IM+H+ SGDP+I+ G        D         D  +V 
Sbjct: 61  ITVAKADSADWQVVKPQVLAAIMDHYNSGDPVINPGSEAASASGD---------DDGIVM 111

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F+ + DGIV+L ++GACSGCPS+S TLK+G+ N+L ++
Sbjct: 112 QIKELLDTRVRPAVAQDGGDIIFRAFEDGIVYLHLQGACSGCPSSSATLKHGIENMLKYY 171

Query: 180 VPEVKDIRTV 189
           VPEV  ++ V
Sbjct: 172 VPEVMAVQAV 181


>gi|83313502|ref|YP_423766.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1]
 gi|82948343|dbj|BAE53207.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1]
          Length = 190

 Score =  200 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG VV+ +G   F+ A  A  SPLA+R+F+I G+ SV+ G DF
Sbjct: 9   MFIQTEPTPNPATLKFLPGTVVMGQGTADFAEASRASGSPLATRLFAIDGVGSVFLGTDF 68

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K D  DW+ ++P VL  IM+H+ SGDP+I+ G        D         D  +V 
Sbjct: 69  ITVAKLDAADWQVVKPQVLAAIMDHYNSGDPVINPGSEAAAASGD---------DDGIVM 119

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F+ + DGIV+L ++GACSGCPS+S TLK+G+ N+L ++
Sbjct: 120 QIKELLDTRVRPAVAQDGGDIIFRAFEDGIVYLHLQGACSGCPSSSATLKHGIENMLKYY 179

Query: 180 VPEVKDIRTV 189
           VPEV  ++ V
Sbjct: 180 VPEVMAVQAV 189


>gi|307942729|ref|ZP_07658074.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Roseibium
           sp. TrichSKD4]
 gi|307773525|gb|EFO32741.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Roseibium
           sp. TrichSKD4]
          Length = 186

 Score =  200 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 105/190 (55%), Positives = 146/190 (76%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL  G   F++  EA  SPLA ++F +PG+A+++FGYDF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLETGTYDFTSPTEAGASPLAEKLFQVPGVAAIFFGYDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV  K+  DW+H++P +LG IME F+SG P++ +G   D +  +     F E+D   V 
Sbjct: 61  ITVTKKEDTDWQHMKPAILGAIMEQFMSGQPVMASGQAEDTEEGE----FFEEADQETVT 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++LD RVRPAVA+DGGDI FKG+++GIV+LSMRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 117 VIKDLLDTRVRPAVAQDGGDITFKGFKEGIVYLSMRGACAGCPSSTATLQHGIQNLLKHF 176

Query: 180 VPEVKDIRTV 189
           VPEV+++R +
Sbjct: 177 VPEVQEVRPI 186


>gi|114053059|ref|NP_001040031.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Bos
           taurus]
 gi|86823819|gb|AAI05370.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Bos
           taurus]
 gi|296482427|gb|DAA24542.1| HIRA interacting protein 5 [Bos taurus]
          Length = 253

 Score =  200 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPATAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 118 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EDDDEVV 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 230 YIPEVEGVEQV 240


>gi|85709112|ref|ZP_01040178.1| possible NifU-like domain protein [Erythrobacter sp. NAP1]
 gi|85690646|gb|EAQ30649.1| possible NifU-like domain protein [Erythrobacter sp. NAP1]
          Length = 193

 Score =  200 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/192 (42%), Positives = 129/192 (67%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP++LKF+PG+ V+  G   F++ + AE SPLA  IF    + +V++G+DF
Sbjct: 1   MFIETETTPNPSSLKFLPGRAVMPSGTREFASPEAAEASPLAQAIFDTGEVVNVFYGWDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD---FIESDSA 116
           +TV      DW  L+P V  ++++HF+S  P+   G    + +    +       E D+ 
Sbjct: 61  VTVTAAPGVDWSALKPQVHAILLDHFVSEAPLFVGGTADGISVPPEEAEMVVEDREEDAE 120

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++  I E+L+ RVRPAVA DGGDI ++G+ DG+V+L+++GAC+GCPS++ TLK+G+ ++L
Sbjct: 121 IIASINELLETRVRPAVAGDGGDIAYRGFSDGVVYLTLQGACAGCPSSTATLKHGIESLL 180

Query: 177 NHFVPEVKDIRT 188
            H+VPEV ++R 
Sbjct: 181 KHYVPEVVEVRA 192


>gi|149727512|ref|XP_001491099.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Equus
           caballus]
          Length = 253

 Score =  200 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 118 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVTEETSSGEAGS--------EEDDEVV 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 230 YIPEVEGVEQV 240


>gi|148666782|gb|EDK99198.1| mCG130855, isoform CRA_b [Mus musculus]
          Length = 256

 Score =  200 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P+     + +      G     E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPL-----VTEETPPPPGEAGSSEEDDEVV 171

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 172 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 231

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 232 YIPEVEGVEQV 242


>gi|315122122|ref|YP_004062611.1| nitrogen fixation protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495524|gb|ADR52123.1| nitrogen fixation protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 190

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 1/190 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPGQVVLV G++HFSNAKEA ISPLASRIFSI GI SVY GYDF
Sbjct: 1   MFIQTEYTPNPATLKFIPGQVVLVRGSVHFSNAKEAGISPLASRIFSISGIVSVYLGYDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL-DDMGSGDFIESDSAVVQ 119
           ITV KD+YDWE L+P +LG+IMEHF+SGDPII NGGL  + + DD+G GDF ESDS +VQ
Sbjct: 61  ITVAKDKYDWEQLKPLILGVIMEHFMSGDPIISNGGLDAVNVNDDLGEGDFSESDSVIVQ 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK+VLDNRVRPAVARDGGDIVFKGYRDGIVFLSM GACSGCPSA+ETLKYGV N+LNHF
Sbjct: 121 KIKDVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMMGACSGCPSATETLKYGVINLLNHF 180

Query: 180 VPEVKDIRTV 189
           VPEVKDIRTV
Sbjct: 181 VPEVKDIRTV 190


>gi|195482335|ref|XP_002102005.1| GE15286 [Drosophila yakuba]
 gi|263505516|sp|B4PZ52|NFU1_DROYA RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194189529|gb|EDX03113.1| GE15286 [Drosophila yakuba]
          Length = 283

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+  ++  +W  ++P V  +IM+ F SG P++H+              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLHDAQPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|85374519|ref|YP_458581.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594]
 gi|84787602|gb|ABC63784.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594]
          Length = 192

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 128/191 (67%), Gaps = 3/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNP+TLKF+PGQ V+  G   F++ +EAE SPLA  IF    + +V+FG DF
Sbjct: 1   MFIETETTPNPSTLKFLPGQQVMPGGTREFTSPEEAEASPLAQAIFDTGEVTNVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAV 117
           ++V      DW  L+  V+ ++++HF+S  P+   G    + +         E   D+ +
Sbjct: 61  VSVSAAPGADWSSLKGMVVSILLDHFVSQAPLFVGGDASGISVPAEDDLLVEENADDADI 120

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +I E+L+ RVRPAVA DGGDI ++G++DG+V+L+++GACSGCPS++ TLK G+  +L 
Sbjct: 121 VAQINELLETRVRPAVAGDGGDIAYRGFKDGVVYLTLQGACSGCPSSTATLKQGIEGLLK 180

Query: 178 HFVPEVKDIRT 188
           H+VPEV ++R 
Sbjct: 181 HYVPEVVEVRA 191


>gi|319403933|emb|CBI77521.1| NifU-related protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 190

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 138/189 (73%), Gaps = 7/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGRIVLPQGTLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IME+F+S DP+I          +      F E D+ +V 
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEYFLSNDPVITTEA------NLPNKEFFDEKDTDIVV 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 115 VIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 174

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 175 IPEVLGVEA 183


>gi|196003412|ref|XP_002111573.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens]
 gi|190585472|gb|EDV25540.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens]
          Length = 236

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +LKF+PG  VL  G I +S+A++A  SPLA  +F + G+ SV+ G DF
Sbjct: 36  MFIQTLDTPNPNSLKFVPGVPVLGSGTIDYSSARDALTSPLAKNLFRVDGVKSVFLGPDF 95

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +T+ +  D  +W  L+P +  +IM+ F SG P++ +        +          DS  V
Sbjct: 96  VTISRADDDIEWNTLKPDIYAVIMDFFASGAPVLID-------YEPATDTAVQPEDSDTV 148

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ R+RP +  DGGDIV+ GY +GIV L M+GAC  CPSA+ TLK+G+ N+L  
Sbjct: 149 AMIKELLETRIRPTLQEDGGDIVYMGYDNGIVKLKMQGACDSCPSATVTLKHGIQNMLQF 208

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  +
Sbjct: 209 YIPEVEGVEQI 219


>gi|282154803|ref|NP_001164062.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 1
           precursor [Mus musculus]
 gi|74211556|dbj|BAE26508.1| unnamed protein product [Mus musculus]
          Length = 256

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P+     + +      G     E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPL-----VTEETPPPPGEAGSSEEDDEVV 171

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 172 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 231

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 232 YIPEVEGVEQV 242


>gi|302381462|ref|YP_003817285.1| Scaffold protein Nfu/NifU [Brevundimonas subvibrioides ATCC 15264]
 gi|302192090|gb|ADK99661.1| Scaffold protein Nfu/NifU [Brevundimonas subvibrioides ATCC 15264]
          Length = 185

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 122/193 (63%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V   G+  F +  +A  SPLA  +F +  ++ V+FG D 
Sbjct: 1   MFIQTEPTPNPNALKFLPGRDVAPGGSREFLSIDQATASPLAEALFQLEDVSGVFFGGDH 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V +     DW  ++P +L +IM+HF+SG P++  G           + D  E DS +V
Sbjct: 61  ISVTRAEHGRDWSEMKPEILSVIMDHFVSGQPLMREGA---------DAVDHAEDDSEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +   ++ L MRGAC+GCPS++ TLK GV  ++
Sbjct: 112 AEIKSLLDSRIRPAVAQDGGDILFDAFDEESGVLRLRMRGACAGCPSSAMTLKAGVEQMM 171

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 172 RHYVPEVTSVEQV 184


>gi|295687469|ref|YP_003591162.1| Scaffold protein Nfu/NifU [Caulobacter segnis ATCC 21756]
 gi|295429372|gb|ADG08544.1| Scaffold protein Nfu/NifU [Caulobacter segnis ATCC 21756]
          Length = 191

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 99/191 (51%), Positives = 126/191 (65%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VLVEGA  F  A+E E SPLA  +F +  +  V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLVEGAREFRTAEEGEASPLAKALFDLGDVTRVFFGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W HL+ P+L  IM+HF SG P++ +   G    +D   G + E  S +V 
Sbjct: 61  LTVTKGEAAQWPHLKAPILAAIMDHFTSGRPLLLDAEPGGGHDED---GVYDEEASQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RPAVA+DGGDIVF  +      V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 118 EIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKAGVENMLK 177

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 178 HYVPEVTRVEQ 188


>gi|254470949|ref|ZP_05084352.1| nitrogen fixation protein [Pseudovibrio sp. JE062]
 gi|211960091|gb|EEA95288.1| nitrogen fixation protein [Pseudovibrio sp. JE062]
          Length = 186

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 109/188 (57%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG   F +A+EA ISPLA ++FSIPG+  ++FG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTRDFRSAEEAAISPLAEKLFSIPGVVGIFFGHDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV KD+ DW+H+RP +LG IME+F++  PI+     GD    D+G   F   D   V  
Sbjct: 61  ITVTKDETDWQHMRPAILGAIMENFMANTPILKGEETGDG---DIGEEFFDAEDEETVTM 117

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+L+ RVRPAVA+DGGDI F+GYR+GIV+LSMRGAC+GCPS++ TL +G+ N++ HF+
Sbjct: 118 IKELLETRVRPAVAQDGGDITFRGYREGIVYLSMRGACAGCPSSTATLSHGIQNLMRHFI 177

Query: 181 PEVKDIRT 188
           PEV+++R 
Sbjct: 178 PEVQEVRQ 185


>gi|224080725|ref|XP_002196481.1| PREDICTED: putative iron-sulfur cluster scaffold protein Nfu
           variant 3 [Taeniopygia guttata]
          Length = 252

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 85/190 (44%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 55  MFIQTQDTPNPNSLKFIPGRAVLESRTMEFSTPAAAYCSPLARQLFRIEGVKSVFFGPDF 114

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++ +                 E D  VV
Sbjct: 115 ITITKESEDLDWNLLKPDIYATIMDFFASGLPVVTDEAP-------RTDTAASEEDDEVV 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 168 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVLLKLQGSCTSCPSSLITLKSGIQNMLQF 227

Query: 179 FVPEVKDIRT 188
           ++PEV+ +  
Sbjct: 228 YIPEVEGVEQ 237


>gi|27375911|ref|NP_767440.1| hypothetical protein bll0800 [Bradyrhizobium japonicum USDA 110]
 gi|27349049|dbj|BAC46065.1| bll0800 [Bradyrhizobium japonicum USDA 110]
          Length = 189

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/188 (51%), Positives = 138/188 (73%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VV+    + F++ + A  SPLA ++F +PG+  V++G DF
Sbjct: 1   MFIQTEATPNPATLKFIPGRVVVDGSPMEFASRESAARSPLAEKLFEVPGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ITV K   +W+ L+P +LG IMEH++SG P++ +G        D     F E+D+  V  
Sbjct: 61  ITVTKANGEWQQLKPAILGAIMEHYMSGAPLLADGAAQSDADLDDEDEFFDEADAETVDM 120

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HFV
Sbjct: 121 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFV 180

Query: 181 PEVKDIRT 188
           P+V ++R 
Sbjct: 181 PDVVEVRP 188


>gi|34500321|gb|AAQ73785.1| NifU-like protein HIRIP5 [Mus musculus]
          Length = 245

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 47  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 106

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 107 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGS------EEDDEVV 160

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 161 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 220

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 221 YIPEVEGVEQV 231


>gi|312113945|ref|YP_004011541.1| Scaffold protein Nfu/NifU [Rhodomicrobium vannielii ATCC 17100]
 gi|311219074|gb|ADP70442.1| Scaffold protein Nfu/NifU [Rhodomicrobium vannielii ATCC 17100]
          Length = 184

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 103/190 (54%), Positives = 140/190 (73%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+ VL EG   F  + +AE +SPLA+R+F + G+ +V+ G D
Sbjct: 1   MFIQTEMTPNPATLKFLPGRTVLEEGTREFLTSDDAEGVSPLAARLFEVEGVTAVFLGSD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F++V KD+ DWE L+PPVLG+IMEHF+SG P++ +        D   +         VV 
Sbjct: 61  FVSVTKDRGDWESLKPPVLGVIMEHFMSGQPVLSDERHVAEDEDFDDADK------EVVT 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ RVRPAVA DGGDI FKG+RDG+V+L M+GACSGCPSA+ TL++G+ N+L HF
Sbjct: 115 TIKELIETRVRPAVANDGGDITFKGFRDGVVYLKMQGACSGCPSATATLRHGIENLLKHF 174

Query: 180 VPEVKDIRTV 189
           VPEV++++ V
Sbjct: 175 VPEVQEVQPV 184


>gi|31874276|emb|CAD98142.1| hypothetical protein [Homo sapiens]
          Length = 242

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|148666781|gb|EDK99197.1| mCG130855, isoform CRA_a [Mus musculus]
          Length = 255

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGS------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|195357024|ref|XP_002044916.1| GM13534 [Drosophila sechellia]
 gi|263505008|sp|B4IMF6|NFU1_DROSE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194124051|gb|EDW46094.1| GM13534 [Drosophila sechellia]
          Length = 283

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+  ++  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|209965893|ref|YP_002298808.1| NifU-like domain protein [Rhodospirillum centenum SW]
 gi|209959359|gb|ACI99995.1| NifU-like domain protein [Rhodospirillum centenum SW]
          Length = 186

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNPATLKF+PG+ VL  G   F+  + A  SPLA+R+F + G+  V+ G DF
Sbjct: 1   MFIQTEETPNPATLKFLPGRDVLGRGTADFAGPETAGPSPLAARLFEVEGVTRVFLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW  L+P VLG++MEHF +G P++  G       DD  +      D  VV 
Sbjct: 61  VTVTKTEDKDWYALKPSVLGVLMEHFTAGRPVLLEGTA-----DDGHAEAANAEDEEVVA 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  G+V+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 116 QIKELLDIRVRPAVAQDGGDITFHGFDKGVVYLHMKGACAGCPSSTATLKAGIENLLRHY 175

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 176 IPEVVEVRQV 185


>gi|197128017|gb|ACH44515.1| putative iron-sulfur cluster scaffold protein Nfu variant 3
           [Taeniopygia guttata]
          Length = 252

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 85/190 (44%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 55  MFIQTQDTPNPNSLKFIPGRAVLESRTMEFSTPAAAYCSPLARQLFRIEGVKSVFFGPDF 114

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++ +                 E D  VV
Sbjct: 115 ITITKESEDLDWNLLKPDIYATIMDFFASGLPVVTDEAS-------RTDTAASEEDDEVV 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 168 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVLLKLQGSCTSCPSSLITLKSGIQNMLQF 227

Query: 179 FVPEVKDIRT 188
           ++PEV+ +  
Sbjct: 228 YIPEVEGVEQ 237


>gi|197106919|ref|YP_002132296.1| thioredoxin-like protein [Phenylobacterium zucineum HLK1]
 gi|196480339|gb|ACG79867.1| thioredoxin-like protein [Phenylobacterium zucineum HLK1]
          Length = 191

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 95/191 (49%), Positives = 125/191 (65%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL EG   F + +EA+ SPLA+ IF I G+  V+FG DF
Sbjct: 1   MFIQTEATPNPEVLKFLPGRAVLGEGTRDFGSMEEAQASPLAADIFDIEGVTRVFFGPDF 60

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV     +DW HL+ PVL  IM+HF SG P+    G      D+   G +    + +V 
Sbjct: 61  LTVGKHPSFDWPHLKAPVLAAIMDHFTSGRPLFAEAGEQAGGHDE---GAYEGETAQIVA 117

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IK++LD R+RPAVA+DGGDI+F  +      V+L+MRGACSGCPS++ TLK GV N+L 
Sbjct: 118 EIKDLLDTRIRPAVAQDGGDILFHKFEPDTGVVWLNMRGACSGCPSSTATLKAGVENMLK 177

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 178 HYVPEVTRVEQ 188


>gi|144900396|emb|CAM77260.1| NifU domain protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 182

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 90/190 (47%), Positives = 134/190 (70%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TPNP+TLKF+PG+ V+  G   F +A+ A  SPLA+++F++ G+ASV+ G DF
Sbjct: 1   MFIQTENTPNPSTLKFLPGREVMPAGTADFGSAEAAIRSPLAAKLFTVDGVASVFLGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITVGK +   W  L+P +L  IM+ F +G   + N G   +   +          + +V+
Sbjct: 61  ITVGKTEAATWGTLKPLLLSAIMDFFTAGLLPVINEGTEKVSDGEE---------TDIVR 111

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI+F+ + DGIV++ ++GACSGCPS++ TLK+G+ N+L ++
Sbjct: 112 QIKELLDTRVRPAVAQDGGDIIFRSFDDGIVYVHLQGACSGCPSSTATLKHGIENMLKYY 171

Query: 180 VPEVKDIRTV 189
           VPEV  ++ V
Sbjct: 172 VPEVVAVQAV 181


>gi|195169040|ref|XP_002025336.1| GL13432 [Drosophila persimilis]
 gi|263504975|sp|B4H303|NFU1_DROPE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194108792|gb|EDW30835.1| GL13432 [Drosophila persimilis]
          Length = 282

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 63  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGTAAHCSPLAKLLFRVEGVRAVFFGSD 122

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + ++ D   V
Sbjct: 123 FITISKEESAEWSLIKPEVFAVIMDFFASGLPILHEARPN-------ADTEILDDDDETV 175

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 176 MMIKELLDTRIRPTVQEDGGDIVFISYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 235

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 236 YIPEVESVEQV 246


>gi|198470316|ref|XP_002133420.1| GA22888 [Drosophila pseudoobscura pseudoobscura]
 gi|263504850|sp|B5DKJ8|NFU1_DROPS RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|198145392|gb|EDY72048.1| GA22888 [Drosophila pseudoobscura pseudoobscura]
          Length = 286

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 67  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGTAAHCSPLAKLLFRVEGVRAVFFGSD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + ++ D   V
Sbjct: 127 FITISKEESAEWSLIKPEVFAVIMDFFASGLPILHEARPN-------ADTEILDDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFISYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|282154801|ref|NP_064429.2| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 2
           precursor [Mus musculus]
 gi|205830867|sp|Q9QZ23|NFU1_MOUSE RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; AltName: Full=HIRA-interacting protein 5;
           Short=mHIRIP5; Flags: Precursor
 gi|12834577|dbj|BAB22965.1| unnamed protein product [Mus musculus]
          Length = 255

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGS------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|282154799|ref|NP_001100076.2| NFU1 iron-sulfur cluster scaffold homolog precursor [Rattus
           norvegicus]
 gi|149036647|gb|EDL91265.1| histone cell cycle regulation defective interacting protein 5
           (predicted), isoform CRA_a [Rattus norvegicus]
          Length = 253

 Score =  198 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 57  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 116

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 117 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPGEAGS--------EEDDEVV 168

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 169 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 228

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 229 YIPEVEGVEQV 239


>gi|114577887|ref|XP_001137189.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 248

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|296282499|ref|ZP_06860497.1| hypothetical protein CbatJ_02705 [Citromicrobium bathyomarinum
           JL354]
          Length = 192

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 131/191 (68%), Gaps = 3/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M+I+TE TPNPATLKF+P + V+ +G   F+N ++AE SPLA  +F    +  V+FG DF
Sbjct: 1   MYIETETTPNPATLKFLPQRQVMPQGTRDFANPEDAEASPLAQALFDTGEVTGVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES--DSAV 117
           ++V K +   W  L+P ++ ++++HF+S  P+ H G    +++    +    E   D+ +
Sbjct: 61  VSVTKGEGTQWTELKPQIVAVLLDHFVSEAPLFHGGSAAGIEVPAEDTLTVEEDPADADI 120

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+L+ R+RPAVA DGGDI ++GYRDG+V L ++GAC GCPS++ TLK+G+  +L 
Sbjct: 121 VDQIKELLETRIRPAVAGDGGDIAYRGYRDGVVHLQLQGACDGCPSSTATLKHGIEGLLK 180

Query: 178 HFVPEVKDIRT 188
           H+VPEV ++R 
Sbjct: 181 HYVPEVVEVRA 191


>gi|323138525|ref|ZP_08073593.1| Scaffold protein Nfu/NifU [Methylocystis sp. ATCC 49242]
 gi|322396159|gb|EFX98692.1| Scaffold protein Nfu/NifU [Methylocystis sp. ATCC 49242]
          Length = 187

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 98/188 (52%), Positives = 138/188 (73%), Gaps = 2/188 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL +GA+ F +   A  +PLA  + +I G+ +V +G DF
Sbjct: 1   MFIQTETTPNPATLKFLPGQDVLGQGAMEFRSPDAAANAPLAQALLAIDGVQAVMYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++V KD  DW HL+P +LG IMEHF SG P++  G  G  + +D     +  SD+  V  
Sbjct: 61  VSVTKDGADWAHLKPAILGTIMEHFASGAPLLTEGAAGAQQHEDGE--FYDPSDAETVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+++ RVRPAVA DGGDIVF+G+RDG+V+L+M+GACSGCPS++ TL+ G+ N+L HF+
Sbjct: 119 IKELIETRVRPAVAGDGGDIVFRGFRDGVVYLTMKGACSGCPSSTATLRNGIENLLRHFL 178

Query: 181 PEVKDIRT 188
           P++K +++
Sbjct: 179 PQIKAVQS 186


>gi|164657977|ref|XP_001730114.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966]
 gi|159104009|gb|EDP42900.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966]
          Length = 276

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 78/193 (40%), Positives = 119/193 (61%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKF+PG  V+ +G   F + + +  SPLA  +F++ G++ V++G DF
Sbjct: 56  MFIQTESTPNEDSLKFLPGCRVMEKGTAEFLDQRSSMTSPLAKDLFALDGVSGVFYGPDF 115

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD    W  ++P V   +ME F +G  +  +        D       +++DS VV 
Sbjct: 116 VTVTKDTDTPWSAIKPEVYSTMMEFFTAGHSLFPDPSSAQPGSD----TTILDTDSEVVA 171

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGY---RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+LD RVRPA+  DGGD+ ++G+    DGIV + ++G+C GC S++ TLK G+  +L
Sbjct: 172 MIKELLDTRVRPAIQEDGGDLEYRGFGEDSDGIVRVKLKGSCRGCDSSTVTLKSGIERML 231

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV+ +  V
Sbjct: 232 MHYVPEVQGVEQV 244


>gi|319406947|emb|CBI80584.1| NifU-related protein [Bartonella sp. 1-1C]
          Length = 190

 Score =  197 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 101/189 (53%), Positives = 138/189 (73%), Gaps = 7/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTESTPNPTTLKFLPGRIVLPQGTLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I          +      F E D+ +V 
Sbjct: 61  FITITKNDGEWQHLKPAILGTIMEHFLSNDPVITTE------TNIPNKEFFDEKDTDIVI 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 115 VIKELLETRVRPAVANDGGDITFCGFENGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 174

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 175 IPEVLGVEA 183


>gi|195568040|ref|XP_002107563.1| GD15490 [Drosophila simulans]
 gi|263505455|sp|B4R3T1|NFU1_DROSI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194204973|gb|EDX18549.1| GD15490 [Drosophila simulans]
          Length = 283

 Score =  197 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPHGTTAHSSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+  ++  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|77462766|ref|YP_352270.1| nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1]
 gi|77387184|gb|ABA78369.1| Nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1]
          Length = 186

 Score =  197 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ+VL  G   F+ A+ A  SPLA RIF+  G+++V+FG DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQMVLEAGTADFATAEAAATSPLARRIFAAGGVSAVFFGTDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + V K D+  W+H++P +LG IMEH+ SG P++             G       D  VV+
Sbjct: 61  VAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLEGEQAASGHASHDGP------DEDVVR 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA+DGGDI F G+  GIV+L M+GAC+GCPS++ TLK G+ N+L H+
Sbjct: 115 QIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHY 174

Query: 180 VPEVKDIRTV 189
           +PEV ++R V
Sbjct: 175 IPEVLEVRPV 184


>gi|67633331|gb|AAY78582.1| predicted thioredoxin-like protein [uncultured bacterium
           MedeBAC82F10]
          Length = 185

 Score =  197 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 97/190 (51%), Positives = 131/190 (68%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QTE TPNPATLKF+PG+ V+ EG I F N   A  SPLA  +F+I G+ SV+FG DF
Sbjct: 1   MFVQTEPTPNPATLKFLPGREVMKEGTIFFQNQDSAVNSPLAQNLFNIKGVESVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+ K +  +W  ++P +LG I+EHF    P+I                 + E+DS VV+
Sbjct: 61  ITITKAEANEWTLMKPAILGCIIEHFTMNKPVISKQAP-------RTEHTYDENDSDVVK 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD +VRPAVA DGGDI+F  Y +GIVFL M+GAC GCPS++ TLK G+ N+L H+
Sbjct: 114 KIKELLDTKVRPAVAMDGGDIIFDKYNEGIVFLQMQGACQGCPSSTATLKMGIENMLKHY 173

Query: 180 VPEVKDIRTV 189
           +PEV+++R V
Sbjct: 174 IPEVREVRPV 183


>gi|304393809|ref|ZP_07375734.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Ahrensia
           sp. R2A130]
 gi|303294008|gb|EFL88383.1| putative NFU1 iron-sulfur cluster scaffold-like protein [Ahrensia
           sp. R2A130]
          Length = 190

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 101/191 (52%), Positives = 139/191 (72%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PGQ V   G   FS+A +AE  SPLA+ +F+IP ++ V+FGYD
Sbjct: 1   MFIQTEATPNPATLKFLPGQTVAENGPFEFSDAVDAEDRSPLAAGLFAIPSVSGVFFGYD 60

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+   D  DW+H++P VLG+IMEHF+SG P+++    G  ++     G   E    +V
Sbjct: 61  FVTITKNDTADWQHVKPAVLGVIMEHFMSGAPVMNADAAGGTEV--APEGFVEEGSEEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+L+ RVRPAVA+DGGDI F G++DG V+L MRGAC+GCPS++ TL++G+ N+L H
Sbjct: 119 STIKELLETRVRPAVAQDGGDITFHGFKDGRVYLKMRGACAGCPSSTATLQHGIQNLLKH 178

Query: 179 FVPEVKDIRTV 189
           F+PEV+ +  V
Sbjct: 179 FIPEVEAVEAV 189


>gi|24643765|ref|NP_728443.1| CG32857 [Drosophila melanogaster]
 gi|45551492|ref|NP_728447.2| CG32500 [Drosophila melanogaster]
 gi|45556188|ref|NP_996529.1| CG33502 [Drosophila melanogaster]
 gi|74866115|sp|Q8SY96|NFU1_DROME RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|17946577|gb|AAL49319.1| RH16335p [Drosophila melanogaster]
 gi|22831388|gb|AAG22462.2| CG33502 [Drosophila melanogaster]
 gi|22831391|gb|AAN09001.1| CG32857 [Drosophila melanogaster]
 gi|45446754|gb|AAN09005.2| CG32500 [Drosophila melanogaster]
 gi|220949278|gb|ACL87182.1| CG32500-PA [synthetic construct]
 gi|220958368|gb|ACL91727.1| CG32500-PA [synthetic construct]
          Length = 283

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F N   A  SPLA  +F + G+  V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGAD 126

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+  ++  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 127 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|6760408|gb|AAF28338.1|AF213379_1 r10h10-like protein TO42 [Drosophila melanogaster]
 gi|6554171|gb|AAF16622.1| TO42 [Drosophila melanogaster]
          Length = 286

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F N   A  SPLA  +F + G+  V+FG D
Sbjct: 70  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGAD 129

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+  ++  +W  ++P V  +IM+ F SG P++++              + +E D   V
Sbjct: 130 FVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN-------ADTEILEDDDETV 182

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 183 MMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 242

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 243 YIPEVESVEQV 253


>gi|34500319|gb|AAQ73784.1| NifU-like protein HIRIP5 [Homo sapiens]
 gi|194374137|dbj|BAG62381.1| unnamed protein product [Homo sapiens]
          Length = 254

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|126304005|ref|XP_001381686.1| PREDICTED: similar to iron-sulfur cluster scaffold protein Nfu
           [Monodelphis domestica]
          Length = 235

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 87/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+ G DF
Sbjct: 40  MFIQTQDTPNPNSLKFIPGKSVLGSQTMDFPTPATAFRSPLARQLFRIEGVKSVFLGPDF 99

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG PI+          +   S    E D  VV
Sbjct: 100 ITVTKESEDLDWNLLKPDIYATIMDFFASGLPILTE--------ETPSSETATEEDDEVV 151

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 152 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 211

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 212 YIPEVEGVEQV 222


>gi|291386642|ref|XP_002709869.1| PREDICTED: HIRA interacting protein 5 [Oryctolagus cuniculus]
          Length = 255

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 60  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPASAFRSPLARQLFRIEGVKSVFFGPDF 119

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ KD    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 120 ITITKDNEELDWNLLKPDIYATIMDFFASGLPLVTEETSSGEAGS--------EEDDEVV 171

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 172 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 231

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 232 YIPEVEGVEQV 242


>gi|224097626|ref|XP_002311017.1| predicted protein [Populus trichocarpa]
 gi|222850837|gb|EEE88384.1| predicted protein [Populus trichocarpa]
          Length = 198

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 88/191 (46%), Positives = 118/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ ++  G+  F NA+ A  SPLA  I+ I GI  V+FG DF
Sbjct: 4   MFIQTQSTPNPLSLMFHPGKPIMDVGSADFPNARSAMNSPLAKSIYEIDGITRVFFGSDF 63

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   WE L P +   IM+ + SG+P+  +      K          E DS  V 
Sbjct: 64  VTVTKSDDASWEFLEPEIFAAIMDFYSSGEPLFQDSKTASAK-----DTAISEDDSETVT 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+ +    V L+M+GACSGCPS+S TLK G+ N+L 
Sbjct: 119 MIKELLETRIRPAVQDDGGDIEYRGFDEETGVVKLTMQGACSGCPSSSVTLKSGIENMLM 178

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 179 HYVPEVKGVEQ 189


>gi|50593021|ref|NP_001002755.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 2
           [Homo sapiens]
 gi|205371805|sp|Q9UMS0|NFU1_HUMAN RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; AltName: Full=HIRA-interacting protein 5;
           Flags: Precursor
 gi|32967069|gb|AAP92372.1| iron-sulfur cluster scaffold protein Nfu [Homo sapiens]
 gi|109731123|gb|AAI13693.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo
           sapiens]
 gi|109731125|gb|AAI13695.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo
           sapiens]
 gi|119620255|gb|EAW99849.1| HIRA interacting protein 5, isoform CRA_a [Homo sapiens]
 gi|261860742|dbj|BAI46893.1| NFU1 iron-sulfur cluster scaffold homolog [synthetic construct]
 gi|313884030|gb|ADR83501.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae)
           [synthetic construct]
          Length = 254

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|194763845|ref|XP_001964043.1| GF20932 [Drosophila ananassae]
 gi|263505256|sp|B3MRT7|NFU1_DROAN RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|190618968|gb|EDV34492.1| GF20932 [Drosophila ananassae]
          Length = 286

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 88/191 (46%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 67  MFIQTQDTPNPESLKFLPGVEVLGKGNTHDFPSGTTAHGSPLAKLLFRVEGVRAVFFGAD 126

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 127 FITISKEEGAEWSLIKPEVFAVIMDFFASGLPILHESTPN-------ADTEILEDDDETV 179

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +GIV L M+G+CS CPS+  TLK GV N+L  
Sbjct: 180 MMIKELLDTRIRPTVQEDGGDIVFMGYENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 239

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 240 YIPEVESVEQV 250


>gi|55596270|ref|XP_525775.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 8 [Pan troglodytes]
 gi|332813518|ref|XP_001137508.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 6 [Pan troglodytes]
          Length = 254

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|332226730|ref|XP_003262545.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 1 [Nomascus leucogenys]
 gi|332226732|ref|XP_003262546.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 2 [Nomascus leucogenys]
          Length = 254

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITITKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 231 YIPEVEGVEQV 241


>gi|167643992|ref|YP_001681655.1| scaffold protein Nfu/NifU [Caulobacter sp. K31]
 gi|167346422|gb|ABZ69157.1| Scaffold protein Nfu/NifU [Caulobacter sp. K31]
          Length = 189

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ VL EGA  F  A+E + SPLA  +F +  +  V+FG DF
Sbjct: 1   MFIQTETTPNPEVLKFLPGREVLGEGAREFKTAEEGDASPLAEALFRLGDVNRVFFGPDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +W HL+ P+L  IM+HF SG P++ +             G + E  S +V 
Sbjct: 61  LTVTKAEGAEWPHLKAPILAAIMDHFTSGRPLLLDQAESGHD----NDGVYDEETSQIVA 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IK++LD R+RPAVA+DGGDIVF  +      V+L MRGACSGCPS+S TLK GV N+L 
Sbjct: 117 EIKDLLDTRIRPAVAQDGGDIVFSKFEPATGVVWLHMRGACSGCPSSSATLKAGVENMLK 176

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 177 HYVPEVTRVEQ 187


>gi|299755866|ref|XP_001828936.2| NifU-like protein c [Coprinopsis cinerea okayama7#130]
 gi|298411416|gb|EAU92943.2| NifU-like protein c [Coprinopsis cinerea okayama7#130]
          Length = 291

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 82/192 (42%), Positives = 118/192 (61%), Gaps = 5/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKFIPG  V+ EG+  F + + A  SPLA R+  I GI  V++G DF
Sbjct: 66  MFIQTESTPNEDSLKFIPGVPVMEEGSAEFLDTRSALASPLALRLMGIEGITGVFYGPDF 125

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K   + W  ++P V  ++ME F SG P+       D +         +++DS  V 
Sbjct: 126 VTVSKSSDHPWAVVKPEVYALLMEFFSSGQPLF--RSEEDREAAGPQDTRILDTDSETVA 183

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ RVRPA+  DGGDI ++G+ +   IV + ++G+C GC S+S TLK G+  +L 
Sbjct: 184 MIKELLETRVRPAIMEDGGDIEYRGFDENDGIVRVKLKGSCRGCESSSVTLKSGIERMLM 243

Query: 178 HFVPEVKDIRTV 189
           H+VPEVK +  +
Sbjct: 244 HYVPEVKGVEQI 255


>gi|47212055|emb|CAF90173.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 196

 Score =  196 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 78/191 (40%), Positives = 120/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QT+DTPNP +LKF+PG  VL  G ++F + ++A  SPLA ++F + G+ SV  G DF
Sbjct: 1   MFVQTQDTPNPNSLKFLPGCTVLETGTMNFDSPRDAHCSPLARQLFRVDGVKSVLLGPDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K     DW+ ++P V   IM+ F SG P++  G         +      + D  +V
Sbjct: 61  ITISKIDANIDWKVIKPDVFATIMDFFTSGLPVVSEGS------KQIEDTAPSDDDDELV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+  G+V L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVLYRGFEGGVVKLKLQGSCTSCPSSIITLKSGIQNMLQF 174

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 175 YIPEVESVEQV 185


>gi|220924300|ref|YP_002499602.1| Scaffold protein Nfu/NifU [Methylobacterium nodulans ORS 2060]
 gi|219948907|gb|ACL59299.1| Scaffold protein Nfu/NifU [Methylobacterium nodulans ORS 2060]
          Length = 187

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 101/191 (52%), Positives = 140/191 (73%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+VVL EG     +  +A  SPLA  +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPTTLKFLPGRVVLTEGTFEARSPDQAARSPLAQALFAVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF+SG P++  G  G+   ++     F E+D+  V
Sbjct: 61  ISVTKAEDGPEWPQVKPAVLGAIMEHFLSGAPVLEAGAAGEGTSEE----FFEEADADTV 116

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYR+G+V+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 117 ATIKDLLETRVRPAVAGDGGDITFRGYREGVVYLEMKGACSGCPSSTATLRQGVQNLFRH 176

Query: 179 FVPEVKDIRTV 189
           F+PEV+++++V
Sbjct: 177 FLPEVREVQSV 187


>gi|50593025|ref|NP_056515.2| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 1
           [Homo sapiens]
 gi|32967071|gb|AAP92373.1| cytosolic iron-sulfur cluster scaffold protein Nfu [Homo sapiens]
 gi|119620256|gb|EAW99850.1| HIRA interacting protein 5, isoform CRA_b [Homo sapiens]
          Length = 230

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 95  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 146

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 147 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 206

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 207 YIPEVEGVEQV 217


>gi|281346707|gb|EFB22291.1| hypothetical protein PANDA_002901 [Ailuropoda melanoleuca]
          Length = 186

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 4   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 63

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 64  ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVTEETSSGEAGS--------EEDDEVV 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 116 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 175

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 176 YIPEVEGVEQV 186


>gi|114577877|ref|XP_001137587.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 7 [Pan troglodytes]
          Length = 230

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 95  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 146

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 147 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 206

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 207 YIPEVEGVEQV 217


>gi|332226734|ref|XP_003262547.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 3 [Nomascus leucogenys]
          Length = 230

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 95  ITITKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 146

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 147 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 206

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 207 YIPEVEGVEQV 217


>gi|114108171|gb|AAI23134.1| Lpd-8 protein [Xenopus laevis]
          Length = 249

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F N   A  SPLA  +F I G+ SV+FG DF
Sbjct: 53  MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPNPASAFCSPLARHLFRIEGVKSVFFGPDF 112

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  ++P +   IM+ F +G P++ +           G     E +  VV
Sbjct: 113 ITITKNGEDMDWNLIKPDIFATIMDFFSTGLPVVTDEAP-------RGDPAASEEEDEVV 165

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 166 AMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQF 225

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 226 YIPEVEGVEQV 236


>gi|331214376|ref|XP_003319869.1| iron-sulfur cluster scaffold protein Nfu [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309298859|gb|EFP75450.1| iron-sulfur cluster scaffold protein Nfu [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 357

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 76/192 (39%), Positives = 116/192 (60%), Gaps = 4/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE TPN   LKFIPG+ V+  G+  F    +   SPLA  + S+ G+ SV+FG DF
Sbjct: 139 IFIQTEPTPNADALKFIPGRPVMKSGSREFLKGDDTRSSPLARSLLSVEGVKSVFFGPDF 198

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I++ K+ +  W  ++P +  ++ME F + D  +   G  + +   +      + DS VV 
Sbjct: 199 ISINKESEVGWPTMKPEIYSLLMEFFSASDRPVVQEGPIEEESGPL-DTRIHDDDSEVVA 257

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD RVRPA+  DGGD+ +KG+ +    V L ++G+C GC S++ TLK G+  +L 
Sbjct: 258 MIKELLDTRVRPAIQEDGGDLEYKGFNEETGVVQLMLKGSCRGCDSSAVTLKSGIERMLM 317

Query: 178 HFVPEVKDIRTV 189
           H+VPEV+ +  V
Sbjct: 318 HYVPEVQCVEQV 329


>gi|57529447|ref|NP_001006305.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial [Gallus
           gallus]
 gi|53136898|emb|CAG32778.1| hypothetical protein RCJMB04_35n21 [Gallus gallus]
          Length = 232

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/190 (44%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS+   A  SPLA ++F I G+ SV+FG DF
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKEVLESRTMEFSSPAAAFCSPLARQLFRIEGVKSVFFGPDF 94

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 95  ITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEAP-------RTDTAQSEEDDEVV 147

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 148 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 207

Query: 179 FVPEVKDIRT 188
           ++PEV+ +  
Sbjct: 208 YIPEVEGVEQ 217


>gi|195132295|ref|XP_002010579.1| GI14603 [Drosophila mojavensis]
 gi|193909029|gb|EDW07896.1| GI14603 [Drosophila mojavensis]
          Length = 259

 Score =  195 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 87/191 (45%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 40  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSGAAAHCSPLAKLLFRVEGVRAVFFGGD 99

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 100 FITISKEESGEWGLIKPEVFAIIMDFFASGLPILHEARAN-------ADTEILEDDDETV 152

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 153 MMIKELLDTRIRPTVQEDGGDIVFMGYENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 212

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 213 YIPEVESVEQV 223


>gi|114577889|ref|XP_001137105.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Pan
           troglodytes]
          Length = 240

 Score =  195 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/190 (44%), Positives = 116/190 (61%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 171 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 230

Query: 179 FVPEVKDIRT 188
           ++PEV+ +  
Sbjct: 231 YIPEVEGVEQ 240


>gi|146326964|gb|AAI41716.1| Lpd-8 protein [Xenopus laevis]
          Length = 250

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F N   A  SPLA  +F I G+ SV+FG DF
Sbjct: 54  MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPNPASAFCSPLARHLFRIEGVKSVFFGPDF 113

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  ++P +   IM+ F +G P++ +           G     E +  VV
Sbjct: 114 ITITKNGEDMDWNLIKPDIFATIMDFFSTGLPVVTDEAP-------RGDPAASEEEDEVV 166

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 167 AMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQF 226

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 227 YIPEVEGVEQV 237


>gi|91974729|ref|YP_567388.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5]
 gi|91681185|gb|ABE37487.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5]
          Length = 188

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 97/180 (53%), Positives = 138/180 (76%), Gaps = 3/180 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++ K+A  SPLA R+F + G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRKQAARSPLAERLFEVEGVSGVFYGSDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD   DW+HL+P +LG IMEH++SG PI+ +G +   + D+     F E D+  V+
Sbjct: 61  VTVTKDGAGDWQHLKPAILGAIMEHYMSGAPIMADGRVDGDETDE--DEFFAERDAETVE 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++ RVRPAVA DGGDI F+G++DG+V+L+M+GACSGCPS++ TL++G+ N+L HF
Sbjct: 119 IIKDLIETRVRPAVANDGGDITFRGFKDGVVYLAMKGACSGCPSSTATLQHGIQNLLKHF 178


>gi|297847512|ref|XP_002891637.1| hypothetical protein ARALYDRAFT_892107 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337479|gb|EFH67896.1| hypothetical protein ARALYDRAFT_892107 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 274

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I G+  V+FG DF
Sbjct: 74  MFIETQSTPNPSSLMFNPGKPVMDIGSADFPNSRSAMGSPLAKAIFAIDGVVRVFFGSDF 133

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +  ++M+ + SG P+  +      K          E DS  V 
Sbjct: 134 VTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAK-----DTAIHEDDSETVA 188

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RP+V  DGGDI + G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 189 MIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLM 248

Query: 178 HFVPEVKDIRT 188
           H+V EVK +  
Sbjct: 249 HYVSEVKGVEQ 259


>gi|26324295|dbj|BAC24985.1| unnamed protein product [Mus musculus]
          Length = 200

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P+     + +      G     E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPL-----VTEETPPPPGEAGSSEEDDEVV 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 116 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 175

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 176 YIPEVEGVEQV 186


>gi|83944990|ref|ZP_00957356.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851772|gb|EAP89627.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633]
          Length = 186

 Score =  195 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 93/192 (48%), Positives = 123/192 (64%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTEDTPNP TLKF+PGQ V ++    F+  +EAE S LA  +F + G+  V+ G DF
Sbjct: 1   MFIQTEDTPNPDTLKFLPGQSVSLDAPRDFATPEEAESSYLARELFRVEGVIRVFAGQDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K +  DW H++P VLG IM+   SG  +  +        DD G   +    + +V+
Sbjct: 61  ISVTKAEGVDWPHIKPAVLGAIMDCLESGKSLFSDA-------DDDGHAAYEGEAAGIVK 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IK+V+D RVRPAVARDGGDIVF  Y +    V L MRGAC+GCPS++ TLK G+ N+L 
Sbjct: 114 EIKDVIDTRVRPAVARDGGDIVFHSYDEATGVVNLHMRGACAGCPSSTMTLKQGIENLLK 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVSSVEAV 185


>gi|195447128|ref|XP_002071076.1| GK25604 [Drosophila willistoni]
 gi|263505026|sp|B4NE93|NFU1_DROWI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194167161|gb|EDW82062.1| GK25604 [Drosophila willistoni]
          Length = 289

 Score =  195 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 87/191 (45%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ SV+FG D
Sbjct: 68  MFIQTQDTPNPESLKFLPGVEVLGKGNTYDFPSVAAAHCSPLAKLLFRVEGVRSVFFGSD 127

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG PI+H          +    + +E D   V
Sbjct: 128 FITISKEEAAEWGLIKPEVFAVIMDFFASGLPILHEAR-------NNADTEILEDDDETV 180

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y +G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 181 MMIKELLDTRIRPTVQEDGGDIVFMSYDNGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 240

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 241 YIPEVESVEQV 251


>gi|296533479|ref|ZP_06896057.1| NifU domain protein [Roseomonas cervicalis ATCC 49957]
 gi|296266192|gb|EFH12239.1| NifU domain protein [Roseomonas cervicalis ATCC 49957]
          Length = 187

 Score =  195 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 100/191 (52%), Positives = 131/191 (68%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFI+TE TPNPATLKF+PGQ V+   G   F+NA  A  SPLA R+F + G+A ++ G D
Sbjct: 1   MFIETEATPNPATLKFLPGQDVMGSRGTADFTNAGAAARSPLAERLFGLEGVARIFLGSD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K +  +W+ L+P VLG IMEH ++G P++          D         +D+ +V
Sbjct: 61  FITVTKAEGVEWQALKPQVLGAIMEHVMAGRPVVLEEEGDAALEDSD------PADAEIV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L ++GACSGCPS+  TLK+GV N+L H
Sbjct: 115 AQIKELLDTRVRPAVAGDGGDIVFRGFRDGIVKLHLQGACSGCPSSRATLKHGVENMLRH 174

Query: 179 FVPEVKDIRTV 189
           +VPEV  +  V
Sbjct: 175 YVPEVMAVEQV 185


>gi|158288625|ref|XP_310479.4| AGAP000598-PA [Anopheles gambiae str. PEST]
 gi|157018658|gb|EAA06366.4| AGAP000598-PA [Anopheles gambiae str. PEST]
          Length = 226

 Score =  195 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F +   A+ SPLA  +F + G+ +V+FG D
Sbjct: 11  MFIQTQDTPNPDSLKFLPGVPVLEKGQTMDFPSVSAAQCSPLAKLLFRVEGVRAVFFGGD 70

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+  ++  +W  ++P V  +IM+ F SG P++ +               F E D   V
Sbjct: 71  FVTISKQEDAEWRIIKPEVFAVIMDFFASGLPVVTDAKPN-------PDTQFNEDDDETV 123

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IKE+LD R+RP V  DGGDI+F G+ DG+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 124 QMIKELLDTRIRPTVQEDGGDIIFMGFDDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 183

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 184 YIPEVVSVEQV 194


>gi|291225596|ref|XP_002732785.1| PREDICTED: GM13534-like [Saccoglossus kowalevskii]
          Length = 275

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 115/191 (60%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT +TPNP +LKFIPG  VL  G + F  A+ A  SPLA ++F I G+ SV+ G DF
Sbjct: 65  MFIQTHETPNPNSLKFIPGVPVLGSGTMDFPTARVAHGSPLARQLFRIDGVKSVFLGPDF 124

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K  D  +W+ ++P V   +M+ F +G PI+ +              +    D   V
Sbjct: 125 ITITKHDDDSEWKIIKPEVYAAVMDFFATGLPILTDEQPS-------ADTEIHPDDDETV 177

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIV+ G+  GIV L M+G+C+ CPS+  TLK GV N+L  
Sbjct: 178 AMIKELLDTRIRPTVQEDGGDIVYMGFEKGIVKLKMQGSCTSCPSSVVTLKSGVQNMLQF 237

Query: 179 FVPEVKDIRTV 189
           +VPEV  +  V
Sbjct: 238 YVPEVLSVEQV 248


>gi|319405374|emb|CBI78993.1| NifU-related protein [Bartonella sp. AR 15-3]
          Length = 190

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 101/189 (53%), Positives = 139/189 (73%), Gaps = 7/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE+TPNP TLKF+PG++VL +G + F N +EA + SPLA+++F+IP I SV+ GYD
Sbjct: 1   MFIQTENTPNPTTLKFLPGRIVLSQGVLEFHNREEAAKNSPLAAKLFNIPNIKSVFLGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           FIT+ K+  +W+HL+P +LG IMEHF+S DP+I         +       F E D+ +V 
Sbjct: 61  FITITKNDGEWKHLKPAILGTIMEHFLSNDPVITTE------VHISDKEFFDEKDTDIVV 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA DGGDI F G+ +GIV+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 115 VIKELLETRVRPAVANDGGDITFCGFANGIVYLNMRGACAGCPSSTATLKHGIENLLRHF 174

Query: 180 VPEVKDIRT 188
           +PEV  +  
Sbjct: 175 IPEVLGVEA 183


>gi|73970249|ref|XP_855433.1| PREDICTED: similar to HIRA interacting protein 5 isoform 2 [Canis
           familiaris]
          Length = 253

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 118/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 58  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 117

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+  + DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 118 ITVTKESEELDWNLLKPDIYATIMDFFASGLPLVTEETSSGEAGS--------EEDDEVV 169

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 170 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 229

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 230 YIPEVEGVEQV 240


>gi|195392814|ref|XP_002055049.1| GJ19011 [Drosophila virilis]
 gi|263505537|sp|B4M375|NFU1_DROVI RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|194149559|gb|EDW65250.1| GJ19011 [Drosophila virilis]
          Length = 298

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 88/191 (46%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +   A  SPLA  +F + G+ +V+FG D
Sbjct: 75  MFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPSGSAAHCSPLAKLLFRVEGVRAVFFGGD 134

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K++  +W  ++P V  +IM+ F SG P+IH               + +E D   V
Sbjct: 135 FITISKEESGEWGLIKPEVFAVIMDFFASGLPVIHEARPN-------ADTEILEDDDETV 187

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF GY +GIV L M+G+CS CPS+  TLK GV N+L  
Sbjct: 188 MMIKELLDTRIRPTVQEDGGDIVFMGYENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 247

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 248 YIPEVESVEQV 258


>gi|86747711|ref|YP_484207.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2]
 gi|86570739|gb|ABD05296.1| Nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2]
          Length = 188

 Score =  194 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 97/179 (54%), Positives = 134/179 (74%), Gaps = 1/179 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+VVL  G + F++  +A  SPLA R+F + G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRSQAARSPLAERLFDVDGVSGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD  DW+HL+P +LG IMEH++SG PI+ +G       D      F E D+  V+ 
Sbjct: 61  VTVTKDGGDWQHLKPAILGAIMEHYMSGAPILADGKTDGDAGD-EDDEFFAERDAETVEI 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+M+GACSGCPS++ TL++G+ N+L HF
Sbjct: 120 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLAMKGACSGCPSSTATLQHGIQNLLKHF 178


>gi|326932642|ref|XP_003212423.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Meleagris gallopavo]
          Length = 233

 Score =  194 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS+   A  SPLA ++F I G+ S++FG DF
Sbjct: 36  MFIQTQDTPNPNSLKFIPGKEVLDSRTMEFSSPAAAFCSPLARQLFRIEGVKSIFFGPDF 95

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 96  ITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEAP-------RTDTAQSEEDDEVV 148

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 149 LMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 208

Query: 179 FVPEVKDIRT 188
           ++PEV+ +  
Sbjct: 209 YIPEVEGVEQ 218


>gi|42562675|ref|NP_175550.2| NFU5; ATP binding / structural molecule [Arabidopsis thaliana]
 gi|75169527|sp|Q9C8J2|NIFU5_ARATH RecName: Full=NifU-like protein 5, mitochondrial; Short=AtNfu-I;
           Short=AtNfu5; Flags: Precursor
 gi|12325368|gb|AAG52627.1|AC024261_14 unknown protein; 90320-88994 [Arabidopsis thaliana]
 gi|28207824|emb|CAD55562.1| NFU5 protein [Arabidopsis thaliana]
 gi|105829764|gb|ABF74703.1| At1g51390 [Arabidopsis thaliana]
 gi|110741134|dbj|BAE98660.1| hypothetical protein [Arabidopsis thaliana]
 gi|332194540|gb|AEE32661.1| NifU-like protein 5 [Arabidopsis thaliana]
          Length = 275

 Score =  194 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I G+  V++G DF
Sbjct: 75  MFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIFAIDGVVRVFYGSDF 134

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +  ++M+ + SG P+  +      K          E DS  V 
Sbjct: 135 VTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAK-----DTAIHEDDSETVA 189

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RP+V  DGGDI + G+      V L M+GACSGCPS+S TLK G+ N+L 
Sbjct: 190 MIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLM 249

Query: 178 HFVPEVKDIRT 188
           H+V EVK +  
Sbjct: 250 HYVSEVKGVEQ 260


>gi|6013069|emb|CAB57314.1| HIRA-interacting protein (HIRIP5) [Mus musculus]
 gi|17390830|gb|AAH18355.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Mus
           musculus]
          Length = 199

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGS------EEDDEVV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQF 174

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 175 YIPEVEGVEQV 185


>gi|170741563|ref|YP_001770218.1| scaffold protein Nfu/NifU [Methylobacterium sp. 4-46]
 gi|168195837|gb|ACA17784.1| Scaffold protein Nfu/NifU [Methylobacterium sp. 4-46]
          Length = 187

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 98/191 (51%), Positives = 136/191 (71%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G     +  +A  SPLA  +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGKVVLTDGTFEARSPDQAAPSPLARALFAVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF+SG P++  G       ++  +      D+  V
Sbjct: 61  ISVTKAEDGSEWPQVKPAVLGAIMEHFLSGAPVLDAGAAPAAPAEEFFAEA----DADTV 116

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYR+G+V+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 117 ATIKDLLETRVRPAVAGDGGDITFRGYREGVVYLEMKGACSGCPSSTATLRQGVQNLFRH 176

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 177 FLPEVREVQAV 187


>gi|326430239|gb|EGD75809.1| HIRA-interacting protein 5 [Salpingoeca sp. ATCC 50818]
          Length = 269

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 82/190 (43%), Positives = 111/190 (58%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +L F PG  V   G   F+   +   SPLA  +  I G+  V+ G DF
Sbjct: 61  MFIQTRDTPNPNSLMFYPGTEVTGTGTADFARGGDTSKSPLARVLLRIDGVQGVFLGPDF 120

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+  ++  DW  ++P + G IM+ F S  P++  G       +   +    E D  VV 
Sbjct: 121 ITISKEEDVDWGVMKPHIFGSIMDFFASNQPVLLEG------EEANAASTASEEDDEVVS 174

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD R+RPAV  DGGDI+F  + +GIV L + GAC GCPS+  TLK GV N+L H+
Sbjct: 175 MIKELLDTRIRPAVQDDGGDIIFMEFTNGIVKLKLSGACEGCPSSMYTLKQGVENMLMHY 234

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 235 IPEVEGVEQV 244


>gi|332813521|ref|XP_003309120.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           [Pan troglodytes]
 gi|5738608|emb|CAB53015.1| HIRA-interacting protein HIRIP5 [Homo sapiens]
 gi|62822279|gb|AAY14828.1| unknown [Homo sapiens]
 gi|189054196|dbj|BAG36716.1| unnamed protein product [Homo sapiens]
          Length = 196

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 61  ITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 112

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 113 AMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF 172

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 173 YIPEVEGVEQV 183


>gi|192288888|ref|YP_001989493.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1]
 gi|192282637|gb|ACE99017.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1]
          Length = 188

 Score =  193 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/179 (52%), Positives = 136/179 (75%), Gaps = 2/179 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRRVLDSGTLEFTDASQAARSPLAARLFDIDGVSGVFYGTDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+ +G              + ++D+  V+ 
Sbjct: 61  VTVTKDKGEWQHLKPAILGAIMEHYMSGTPILADGKSDGEDG--DDDEFYADADAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHF 177


>gi|195059008|ref|XP_001995543.1| GH17809 [Drosophila grimshawi]
 gi|263505270|sp|B4JWR9|NFU1_DROGR RecName: Full=NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial; Flags: Precursor
 gi|193896329|gb|EDV95195.1| GH17809 [Drosophila grimshawi]
          Length = 298

 Score =  193 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 118/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G    F +A  A  SPLA  +F + G+ +V+FG D
Sbjct: 79  MFIQTQDTPNPDSLKFLPGVEVLGKGNTYDFPSATAAHCSPLAKLLFRVEGVRAVFFGSD 138

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+  ++  +W  ++P V  +IM+ F SG PI+H               + +E D   V
Sbjct: 139 FITISKEENGEWGLIKPEVFAVIMDFFASGLPILHEARPN-------ADTEILEDDDETV 191

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDIVF  Y  G+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 192 MMIKELLDTRIRPTVQEDGGDIVFISYEKGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 251

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 252 YIPEVESVEQV 262


>gi|39933530|ref|NP_945806.1| NifU-like domain-containing protein [Rhodopseudomonas palustris
           CGA009]
 gi|39647376|emb|CAE25897.1| possible NifU-like domain (residues 119-187) [Rhodopseudomonas
           palustris CGA009]
          Length = 188

 Score =  193 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/179 (52%), Positives = 136/179 (75%), Gaps = 2/179 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKFIPG+ VL  G + F++A +A  SPLA+R+F I G++ V++G DF
Sbjct: 1   MFIQTEPTPNPATLKFIPGRSVLDSGTLEFTDASQAARSPLAARLFDIDGVSGVFYGTDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +TV KD+ +W+HL+P +LG IMEH++SG PI+ +G              + ++D+  V+ 
Sbjct: 61  VTVTKDKGEWQHLKPAILGAIMEHYMSGTPILADGKSDGEDG--DDDEFYADADAETVEI 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           IK++++ RVRPAVA DGGDI F+G++DGIV+L+MRGAC+GCPS++ TL++G+ N+L HF
Sbjct: 119 IKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSSTATLQHGIQNLLKHF 177


>gi|114799747|ref|YP_759252.1| NifU domain-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114739921|gb|ABI78046.1| NifU domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 192

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNP T+KF+PGQ V+ + G   F +A  A  S LA  +F + G+  V+ G D
Sbjct: 1   MFIQTEATPNPDTIKFLPGQPVVGDRGPFDFPDAASARTSLLARALFQVEGVERVFLGSD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+++ K    DW H++P VL  IM+H++SG P+I  G        D     +    + +V
Sbjct: 61  FVSINKAQDKDWRHVKPMVLAAIMDHYMSGLPVIEEGTSSASSGADETE--YEGETAEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ RVRPAVA+DGGDI F  +      V LSMRGAC+GCPS++ TLK G+ N+L
Sbjct: 119 NEIKELIETRVRPAVAQDGGDITFHRFDADTGIVHLSMRGACAGCPSSTMTLKQGIENML 178

Query: 177 NHFVPEVKDIRT 188
             +VPEV  +  
Sbjct: 179 RTYVPEVTAVEA 190


>gi|92115649|ref|YP_575378.1| nitrogen-fixing NifU-like [Nitrobacter hamburgensis X14]
 gi|91798543|gb|ABE60918.1| nitrogen-fixing NifU-like protein [Nitrobacter hamburgensis X14]
          Length = 191

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 91/181 (50%), Positives = 131/181 (72%), Gaps = 2/181 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G + F+    A  S LA R+F++ G+  V++G DF
Sbjct: 1   MFIQTEVTPNPATLKFLPGRTVLGKGTMEFNGPDTAGRSQLAVRLFAVHGVTGVFYGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL--GDMKLDDMGSGDFIESDSAVV 118
           ITV KD  DW+HL+P +LG+IMEH++SG P++ +G     D    D     F E+D+  V
Sbjct: 61  ITVTKDASDWQHLKPAILGVIMEHYMSGAPLLADGETAGNDEANKDEAVEFFDEADAETV 120

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++++ RVRP VA DGGDI F+G++DG+V+++M+G+CSGCPS++ TL+ G+ N+L H
Sbjct: 121 TLIKDLIETRVRPGVADDGGDITFRGFKDGVVYVNMKGSCSGCPSSTVTLRNGIQNLLKH 180

Query: 179 F 179
           F
Sbjct: 181 F 181


>gi|329114732|ref|ZP_08243489.1| Scaffold Protein Nfu/NifU [Acetobacter pomorum DM001]
 gi|326695863|gb|EGE47547.1| Scaffold Protein Nfu/NifU [Acetobacter pomorum DM001]
          Length = 186

 Score =  192 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 100/192 (52%), Positives = 132/192 (68%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TE TPNPATLKF+PGQ V+ + G I F +A   A  SPLA  +F++PG++ V+ G 
Sbjct: 1   MFIETEGTPNPATLKFLPGQAVMGDAGTIDFIDADAVAGRSPLAEALFALPGVSRVFLGN 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D  DWE LRP +L  +M+HF++G P++  G                  D  +
Sbjct: 61  DFVSVTKADSEDWEELRPQILSTLMDHFVAGHPVVAEGVAVTEDATA-------PEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+LD RVRPAVA DGGDIVF+GYR+GIV L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VTQIKELLDTRVRPAVAGDGGDIVFRGYRNGIVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|170084143|ref|XP_001873295.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650847|gb|EDR15087.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 212

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 79/193 (40%), Positives = 118/193 (61%), Gaps = 6/193 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKFI G  V+ +G   F + + A ISPLA R+  + G++ V++G DF
Sbjct: 1   MFIQTETTPNEDSLKFILGVPVMGDGTAEFLDTRSALISPLAIRLMGVEGVSGVFYGPDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD ++ W  ++P +  +IME F SG  +       +           +++DS  V 
Sbjct: 61  VTVSKDSEHRWAVVKPEIYSIIMEFFSSGQKLFRTDEEREQAG--PQDTRILDTDSETVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYR---DGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+L+ RVRPA+  DGGDI F+G+    D +V + ++G+C GC S++ TLK G+  +L
Sbjct: 119 MIKELLETRVRPAIMEDGGDIEFRGFDEEGDRLVKVKLKGSCRGCDSSTVTLKSGIERML 178

Query: 177 NHFVPEVKDIRTV 189
            H+VPEVK +  V
Sbjct: 179 MHYVPEVKGVEQV 191


>gi|307108001|gb|EFN56242.1| hypothetical protein CHLNCDRAFT_48753 [Chlorella variabilis]
          Length = 209

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 89/191 (46%), Positives = 123/191 (64%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNPA+L FIPGQ VL  G+  F++A+EA  SPLA ++F+I G+  V+FG DF
Sbjct: 1   MFIQTQPTPNPASLMFIPGQKVLEGGSKSFTSAREAMASPLAKKLFAIDGVTQVFFGSDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K + Y W  L+P V   IM+H+ SG+ + ++                 E D  VV 
Sbjct: 61  VTVTKSEDYGWAVLKPDVFAAIMDHYSSGEALFYDEQDTGA-----AEHMIHEDDDEVVA 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDIVF+ +     +V L M GACSGCPS++ TLK G+ N+L 
Sbjct: 116 MIKELLETRIRPAVQEDGGDIVFRTWDPESGVVKLKMMGACSGCPSSAVTLKSGIENMLM 175

Query: 178 HFVPEVKDIRT 188
           H++PEV+ +  
Sbjct: 176 HYIPEVRGVEE 186


>gi|188582635|ref|YP_001926080.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001]
 gi|179346133|gb|ACB81545.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001]
          Length = 188

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 101/191 (52%), Positives = 136/191 (71%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL EG     +A  AE SPLA+ +FS+PG++ VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLPEGTFEARDAAGAERSPLATALFSVPGVSGVYFGHDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K     +W  ++P VLG IM+HF SG P++  G       +D     + E+D   V
Sbjct: 61  ISVTKADGVNEWPQVKPAVLGAIMDHFQSGRPVLAEGTALA---EDETEEFYDEADHDTV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 118 ATIKDLLETRVRPAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFRH 177

Query: 179 FVPEVKDIRTV 189
           F+P V++++ +
Sbjct: 178 FLPSVREVQAI 188


>gi|163852613|ref|YP_001640656.1| scaffold protein Nfu/NifU [Methylobacterium extorquens PA1]
 gi|218531454|ref|YP_002422270.1| Scaffold protein Nfu/NifU [Methylobacterium chloromethanicum CM4]
 gi|240139947|ref|YP_002964424.1| NifU-like protein [Methylobacterium extorquens AM1]
 gi|254562372|ref|YP_003069467.1| NifU-like [Methylobacterium extorquens DM4]
 gi|163664218|gb|ABY31585.1| Scaffold protein Nfu/NifU [Methylobacterium extorquens PA1]
 gi|218523757|gb|ACK84342.1| Scaffold protein Nfu/NifU [Methylobacterium chloromethanicum CM4]
 gi|240009921|gb|ACS41147.1| NifU-like protein [Methylobacterium extorquens AM1]
 gi|254269650|emb|CAX25622.1| NifU-like [Methylobacterium extorquens DM4]
          Length = 188

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 98/191 (51%), Positives = 135/191 (70%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL +G     +   AE SPLA+ +F++PG++ VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLTDGTFEARDTASAERSPLATALFAVPGVSGVYFGHDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K     +W  ++P VLG IM+HF SG P++  G       +D     + E+D   V
Sbjct: 61  ISVTKADGVNEWPQVKPAVLGAIMDHFQSGRPVLAEGTALA---EDETEEFYDEADHDTV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  H
Sbjct: 118 VTIKDLLETRVRPAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFRH 177

Query: 179 FVPEVKDIRTV 189
           F+P V++++ +
Sbjct: 178 FLPSVREVQAI 188


>gi|118403546|ref|NP_001072356.1| NFU1 iron-sulfur cluster scaffold homolog [Xenopus (Silurana)
           tropicalis]
 gi|111307911|gb|AAI21453.1| HIRA interacting protein 5 [Xenopus (Silurana) tropicalis]
          Length = 199

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 82/191 (42%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP ++KFIPG+ VL    + F +   A  SPLA  +F I G+ SV+ G DF
Sbjct: 1   MFIQTQDTPNPNSVKFIPGRAVLDARTMDFPSPASAFCSPLARHLFRIDGVKSVFLGPDF 60

Query: 61  ITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           IT+ K+  + DW  ++P +   IM+ F SG P++             G     E +  VV
Sbjct: 61  ITITKNSEELDWNLIKPDIYATIMDFFASGLPVVTEDAP-------RGDAAASEEEDEVV 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGD+++KG++DGIV L ++G+C+ CPS+  TLK G+ N+L  
Sbjct: 114 AMIKELLDTRIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQF 173

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 174 YIPEVEGVEQV 184


>gi|115953358|ref|XP_798698.2| PREDICTED: similar to HIRA interacting protein 5, partial
           [Strongylocentrotus purpuratus]
          Length = 211

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 87/192 (45%), Positives = 117/192 (60%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  VL  G   F +A  A  SPLA ++F I G+  V+FG DF
Sbjct: 3   MFIQTQDTPNPNSLKFLPGVEVLGTGTKDFPSAMNAHGSPLARQLFRIEGVQGVFFGPDF 62

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           ITV K   D  DW  L+P +   +M+ F +G PI+ +              +  E D   
Sbjct: 63  ITVTKMDDDNIDWRVLKPEIYATVMDFFATGVPILTDETA-------PTDTEIQEDDDET 115

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGDIV+ G+ +G+V L ++GAC+ CPS+  TLK+GV N+L 
Sbjct: 116 VMMIKELLDTRIRPTVQEDGGDIVYMGFEEGVVKLKLQGACTSCPSSIVTLKHGVQNMLQ 175

Query: 178 HFVPEVKDIRTV 189
            +VPEV  +  V
Sbjct: 176 FYVPEVLSVEAV 187


>gi|167520450|ref|XP_001744564.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776895|gb|EDQ90513.1| predicted protein [Monosiga brevicollis MX1]
          Length = 209

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 81/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT DTPNP +L F PG  +L    +  ++A  A  SPLA  +F + G+ SV+   DF
Sbjct: 1   MFIQTRDTPNPNSLMFYPGVDILPGSTLELTSAAAAHQSPLARALFRVDGVKSVFLASDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T+ KD+  +W  L+P +   +M+ F S  P++ +        +        E D  +V 
Sbjct: 61  VTINKDEAAEWSTLKPNIYATMMDFFASNQPVVLDSY------EAPTDTAVSEDDDEIVA 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD+R+RPAV  DGGDI+F+G+ DGIV L + GAC+GCPS+  TLK GV N+L H+
Sbjct: 115 MIKELLDSRIRPAVQEDGGDILFQGFVDGIVQLRLSGACTGCPSSIFTLKNGVENMLMHY 174

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 175 IPEVEGVEQV 184


>gi|75674208|ref|YP_316629.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255]
 gi|74419078|gb|ABA03277.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255]
          Length = 190

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 93/180 (51%), Positives = 134/180 (74%), Gaps = 1/180 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +G + F++A     SPLA ++F++ G+A V++G DF
Sbjct: 1   MFIQTEITPNPATLKFLPGRTVLGKGTMEFTSASTTARSPLAVKLFAVHGVAGVFYGSDF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV KD+  DW+HL+P +LG+IMEH+++G P++ +G        D     F E+D+  V 
Sbjct: 61  ITVTKDEGSDWQHLKPAILGVIMEHYMAGAPLLADGEGCSEANADSDVEFFDEADAETVT 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++ RVRP VA DGGDI F+G+RDGIV+++M+GACSGCPS++ TL+ G+ N+L HF
Sbjct: 121 LIKDLIETRVRPGVADDGGDITFRGFRDGIVYVNMKGACSGCPSSTVTLRNGIQNLLKHF 180


>gi|115946407|ref|XP_001184965.1| PREDICTED: similar to HIRA interacting protein 5
           [Strongylocentrotus purpuratus]
          Length = 209

 Score =  191 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 87/192 (45%), Positives = 117/192 (60%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  VL  G   F +A  A  SPLA ++F I G+  V+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFLPGVEVLGTGTKDFPSAMNAHGSPLARQLFRIEGVQGVFFGPDF 60

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           ITV K   D  DW  L+P +   +M+ F +G PI+ +              +  E D   
Sbjct: 61  ITVTKMDDDNIDWRVLKPEIYATVMDFFATGVPILTDETA-------PTDTEIQEDDDET 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGDIV+ G+ +G+V L ++GAC+ CPS+  TLK+GV N+L 
Sbjct: 114 VMMIKELLDTRIRPTVQEDGGDIVYMGFEEGVVKLKLQGACTSCPSSIVTLKHGVQNMLQ 173

Query: 178 HFVPEVKDIRTV 189
            +VPEV  +  V
Sbjct: 174 FYVPEVLSVEAV 185


>gi|254455619|ref|ZP_05069048.1| nitrogen-fixing NifU domain protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082621|gb|EDZ60047.1| nitrogen-fixing NifU domain protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 179

 Score =  191 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 70/190 (36%), Positives = 114/190 (60%), Gaps = 12/190 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QTE TPNP +LKF+PG+ V   G    +     +   L   I SI G+  ++ G DF
Sbjct: 1   MFVQTEVTPNPNSLKFLPGKKVSNSGPFEITKKDGIKN-DLVRNILSINGVEGIFLGEDF 59

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V   D+ +W+ ++  V+ +I + +  G   + +                 ++   + Q
Sbjct: 60  ISVNKNDEINWDEIKHIVISLINDFYSDGKEFVIDEDAEQSD----------DNLDEIEQ 109

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I ++LD ++RPAVARDGGDI FK ++DG+V + ++G+CSGCPS++ TLK GV N+L H+
Sbjct: 110 KIVKILDQKIRPAVARDGGDIKFKEFKDGVVKVQLQGSCSGCPSSTMTLKQGVQNLLCHY 169

Query: 180 VPEVKDIRTV 189
           +PEVK++  +
Sbjct: 170 LPEVKEVIAI 179


>gi|87199010|ref|YP_496267.1| nitrogen-fixing NifU-like [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134691|gb|ABD25433.1| nitrogen-fixing NifU-like protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 195

 Score =  191 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 128/191 (67%), Gaps = 3/191 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+TE TPNPATLKF+PG+ V+  G   F + +EAE SPLA  +F +  +  V FG DF
Sbjct: 4   MFIETETTPNPATLKFLPGEQVMASGTREFVSHEEAEASPLAQALFDLGDVTGVLFGRDF 63

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V       W  L+P VL ++++HF++  P+   G  G + +      DF +  +    
Sbjct: 64  VSVTAAPGVAWADLKPQVLSLLLDHFVAQAPLFAPGSAGGIVVPADADEDFADDPADADI 123

Query: 120 --RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
             +IK++++ RVRPAVA DGGDI+++G+R+G+V+L M+GACSGCPS++ TLK G+ ++L 
Sbjct: 124 IDQIKDLIETRVRPAVANDGGDIIYRGFREGVVYLKMQGACSGCPSSTATLKNGIESLLK 183

Query: 178 HFVPEVKDIRT 188
           H+VPEV ++R 
Sbjct: 184 HYVPEVSEVRA 194


>gi|258541120|ref|YP_003186553.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632198|dbj|BAH98173.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635255|dbj|BAI01224.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638310|dbj|BAI04272.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641364|dbj|BAI07319.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644419|dbj|BAI10367.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647474|dbj|BAI13415.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650527|dbj|BAI16461.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653518|dbj|BAI19445.1| nitrogen fixing thioredoxin-like protein NifU [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 186

 Score =  191 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 99/192 (51%), Positives = 132/192 (68%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TE TPNPATLKF+PGQ V+ + G I F +A   A  S LA  +F++PG++ V+ G 
Sbjct: 1   MFIETEGTPNPATLKFLPGQAVMGDAGTIDFIDADAVAGRSSLAEALFALPGVSRVFLGN 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D  DWE LRP +L  +M+HF++G P++  G         +        D  +
Sbjct: 61  DFVSVTKADSEDWEELRPQILSTLMDHFVAGHPVVAEGVA-------VTEDAIAPEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V +IKE+LD RVRPAVA DGGDIVF+GYR+GIV L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VTQIKELLDTRVRPAVAGDGGDIVFRGYRNGIVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|168061090|ref|XP_001782524.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666009|gb|EDQ52676.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 212

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 81/192 (42%), Positives = 115/192 (59%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ E TPNP +L F PG+ V+  G+  F N++ A  SPLA  IF + G+  V+FG DF
Sbjct: 14  MFIQVESTPNPQSLMFYPGKPVMEVGSSDFPNSRAAMASPLAKSIFIVDGVVRVFFGADF 73

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +   W+ L+P +   IM+ + +  P+ ++                 E D   V 
Sbjct: 74  VTVTKSEDVSWDILKPEIFAAIMDFYATKQPLFYDTQSQA------SDTAIHEDDDETVA 127

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+     IV L M+GACSGCPS++ TLK G+ N+L 
Sbjct: 128 MIKELLETRIRPAVQDDGGDIEYRGFDPESGIVSLKMQGACSGCPSSAVTLKSGIENMLM 187

Query: 178 HFVPEVKDIRTV 189
           H+V EVK ++ V
Sbjct: 188 HYVSEVKGVQEV 199


>gi|162147187|ref|YP_001601648.1| nitrogen fixation protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544240|ref|YP_002276469.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785764|emb|CAP55335.1| putative nitrogen fixation protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531917|gb|ACI51854.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5]
          Length = 187

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 93/192 (48%), Positives = 126/192 (65%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++       F +    A  S LA  +F  PG+A V+ G 
Sbjct: 1   MFIETEDTPNPATLKFLPGRTIVPGRATADFVSPDAVAGRSKLADALFGQPGVARVFLGG 60

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF+ V KD+  DW  L+P +L ++++ F+SG P I +    +              D  +
Sbjct: 61  DFVAVTKDEATDWSVLKPQLLSVLVDFFVSGMPAIEDDAAVE-------EELIAPEDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V++IKE+LD RVRPAVA DGGDIVF+GYRDG+V L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VRQIKELLDTRVRPAVAGDGGDIVFRGYRDGVVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|213512278|ref|NP_001134266.1| NFU1 iron-sulfur cluster scaffold homolog [Salmo salar]
 gi|209731958|gb|ACI66848.1| NFU1 iron-sulfur cluster scaffold homolog [Salmo salar]
          Length = 263

 Score =  190 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 83/189 (43%), Positives = 115/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           IQT+DTPNP +LKFIPG+ VL  G + F +   AE S LA  +F I G+ SV++G DFIT
Sbjct: 61  IQTQDTPNPRSLKFIPGKPVLGVGTLDFPSPSSAECSSLARDLFGIEGVKSVFYGPDFIT 120

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           V K  D  +W  ++   +  I + F SGDPI       +            E D  +V  
Sbjct: 121 VTKADDDVEWTDIKHHAMDAITKFFDSGDPITTGVTHHESSHS--------EDDDEIVSM 172

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ +G V L + G+C+GCPS++ TLK G+ N+L  ++
Sbjct: 173 IKELLDTRIRPTVMEDGGDVIFKGFENGTVKLKLVGSCTGCPSSTVTLKNGIQNMLQFYI 232

Query: 181 PEVKDIRTV 189
           PEV D+  V
Sbjct: 233 PEVDDVEQV 241


>gi|85714190|ref|ZP_01045179.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A]
 gi|85699316|gb|EAQ37184.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A]
          Length = 190

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/180 (49%), Positives = 131/180 (72%), Gaps = 1/180 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ VL +  + F++A     SPLA ++F++ G+  V++G DF
Sbjct: 1   MFIQTEITPNPATLKFLPGRTVLGKDTMEFTSASTTARSPLAVKLFAVHGVTGVFYGSDF 60

Query: 61  ITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV KD   DW+HL+P +LG+IMEH++SG P++ + G       +     F E+D+  V 
Sbjct: 61  ITVTKDDASDWQHLKPAILGVIMEHYMSGAPLLADDGGNTEPNAENDVEFFDEADAETVT 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IK++++ RVRP VA DGGDI F+G++DG+V+++M+GACSGCPS++ TL+ G+ N+L HF
Sbjct: 121 LIKDLIETRVRPGVADDGGDITFRGFKDGVVYVNMKGACSGCPSSTVTLRNGIQNLLKHF 180


>gi|157167461|ref|XP_001654807.1| hypothetical protein AaeL_AAEL002148 [Aedes aegypti]
 gi|108882432|gb|EAT46657.1| conserved hypothetical protein [Aedes aegypti]
          Length = 263

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL +G  + F     A  SPLA  +F I G+ SV+FG D
Sbjct: 55  MFIQTQDTPNPDSLKFLPGVAVLEKGQTMDFPTQAAALCSPLAKLLFRIEGVRSVFFGAD 114

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+   ++ +W  ++P V  +IM+ F SG P++ +          MG     E D   V
Sbjct: 115 FVTISKHEEAEWRLIKPEVFAVIMDFFASGLPVVTDAKP-------MGDTQINEDDDETV 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IKE+LD+++RP V  DGGDI+F  + DG+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 168 QMIKELLDSKIRPTVQEDGGDIIFMAFEDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 227

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 228 YIPEVVAVEQV 238


>gi|66543732|ref|XP_395826.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Apis mellifera]
          Length = 275

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 86/192 (44%), Positives = 121/192 (63%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  +L +G    F NA +   SPLA  +F I G+ SV+FG D
Sbjct: 64  MFIQTQDTPNPNSLKFLPGVKILEQGQTKDFPNAIDGYCSPLAKMLFRIDGVKSVFFGPD 123

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  +  +W+ L+P +  +IM+ F SG P++ +                 + DS +
Sbjct: 124 FITITKADEDVEWKLLKPEIFAVIMDFFASGLPVLTDEQPA-------ADTQISDDDSEI 176

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TLK GV N++ 
Sbjct: 177 VQMIKELLDTRIRPTVQEDGGDIVFMGFEEGIVKLKMQGSCTSCPSSVITLKNGVQNMMQ 236

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 237 FYIPEVLGVVQV 248


>gi|4680705|gb|AAD27742.1|AF132967_1 CGI-33 protein [Homo sapiens]
          Length = 231

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 84/192 (43%), Positives = 115/192 (59%), Gaps = 11/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD- 59
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+F    
Sbjct: 35  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFWDQI 94

Query: 60  FITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K+    DW  L+P +   IM+ F SG P++                   E D  V
Sbjct: 95  FITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPGEAGS--------EEDDEV 146

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L 
Sbjct: 147 VAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQ 206

Query: 178 HFVPEVKDIRTV 189
            ++PEV+ +  V
Sbjct: 207 FYIPEVEGVEQV 218


>gi|90420546|ref|ZP_01228453.1| putative nitrogen-fixing NifU domain protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335274|gb|EAS49027.1| putative nitrogen-fixing NifU domain protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 191

 Score =  188 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 98/180 (54%), Positives = 129/180 (71%), Gaps = 3/180 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPNPATLKF+PG+VVL  G   F + ++A   SPLA+R+  +PG+  V+FGYD
Sbjct: 1   MFIQTEVTPNPATLKFLPGRVVLESGTEEFLSKEDAANRSPLAARLMDVPGVTGVFFGYD 60

Query: 60  FITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           F+TV KD  DW+HL+P +L  +MEHF+  +P++   G      D  G   F   D   V 
Sbjct: 61  FVTVSKDGPDWQHLKPAILAGLMEHFMGNEPVMTAQGSNAAMPD--GEEFFEPGDEGTVA 118

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+L+ RVRPAVA+DGGDI F+GYRDG V+L+MRGAC+GCPS++ TLK+G+ N+L HF
Sbjct: 119 TIKELLETRVRPAVAQDGGDITFRGYRDGTVYLNMRGACAGCPSSTATLKHGIQNLLRHF 178


>gi|296114423|ref|ZP_06833077.1| Scaffold protein Nfu/NifU [Gluconacetobacter hansenii ATCC 23769]
 gi|295979184|gb|EFG85908.1| Scaffold protein Nfu/NifU [Gluconacetobacter hansenii ATCC 23769]
          Length = 187

 Score =  188 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 91/192 (47%), Positives = 126/192 (65%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++  G    F +A   A  S LA  +F + G++ V+FG 
Sbjct: 1   MFIETEDTPNPATLKFLPGRELMPNGATADFIDADSVAGRSRLAEVLFDLEGVSRVFFGG 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF+ V K D   W+ L+P VL ++ ++  +G   + +  +       +        D  +
Sbjct: 61  DFVAVTKADTVAWDELKPQVLSVVADYLATGQAPVEHEAV-------VIEDAIAPGDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V++IKE+LD RVRPAVA DGGDIVF+GYRDGIV L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VKQIKELLDTRVRPAVAGDGGDIVFRGYRDGIVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|312384995|gb|EFR29592.1| hypothetical protein AND_01304 [Anopheles darlingi]
          Length = 214

 Score =  188 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 87/191 (45%), Positives = 117/191 (61%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKF+PG  VL  G  + F N   A+ SPLA  +F I G+ SV+FG D
Sbjct: 1   MFIQTQDTPNPHSLKFLPGVTVLDAGQTMDFPNVSSAQCSPLAKLLFRIEGVRSVFFGAD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+T+ K +  +W  ++P    +IM+ F SG P++              S    E D   V
Sbjct: 61  FVTISKVEDAEWSIIKPETFAVIMDFFASGLPVVTGANPN-------NSTQINEDDDETV 113

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q IKE+LD R+RP V  DGGDI+F G+ DG+V L M+G+CS CPS+  TLK GV N+L  
Sbjct: 114 QMIKELLDTRIRPTVQEDGGDIIFMGFDDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF 173

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 174 YIPEVVSVEQV 184


>gi|302773942|ref|XP_002970388.1| hypothetical protein SELMODRAFT_93100 [Selaginella moellendorffii]
 gi|300161904|gb|EFJ28518.1| hypothetical protein SELMODRAFT_93100 [Selaginella moellendorffii]
          Length = 210

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 85/187 (45%), Positives = 119/187 (63%), Gaps = 8/187 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ + TPNPA+L F PG+ V+  G+  F NA+ A  SPLA  +F I G+  V+FG DF
Sbjct: 10  LFIQVQTTPNPASLIFSPGKPVMEIGSSDFPNARTAMKSPLAKSLFGIDGVTRVFFGSDF 69

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+ L+P V   IM+ + SG P+ ++      +++        E D   V 
Sbjct: 70  VTVTKSDDTEWDVLKPEVFAAIMDFYASGQPLFYSA-----QVEAPKDTAIEEGDDETVV 124

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+     IV L M+GACSGCPS++ TLK G+ N+L 
Sbjct: 125 MIKELLETRIRPAVKDDGGDIEYRGFDRESGIVELKMQGACSGCPSSAVTLKSGIENMLM 184

Query: 178 HFVPEVK 184
           H+VPEVK
Sbjct: 185 HYVPEVK 191


>gi|302769472|ref|XP_002968155.1| hypothetical protein SELMODRAFT_67451 [Selaginella moellendorffii]
 gi|300163799|gb|EFJ30409.1| hypothetical protein SELMODRAFT_67451 [Selaginella moellendorffii]
          Length = 187

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/187 (45%), Positives = 117/187 (62%), Gaps = 8/187 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ + TPNPA+L F PG+ V+  G+  F NA+ A  SPLA  +F I G+  V+FG DF
Sbjct: 6   LFIQVQTTPNPASLIFSPGKPVMEIGSSDFPNARTAMKSPLAKSLFGIDGVTRVFFGSDF 65

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D  +W+ L+P V   IM+ + SG P+ ++      K          E D   V 
Sbjct: 66  VTVTKSDDTEWDVLKPEVFAAIMDFYASGQPLFYSAQAAAPK-----DTAIEEGDDETVV 120

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAV  DGGDI ++G+     IV L M+GACSGCPS++ TLK G+ N+L 
Sbjct: 121 MIKELLETRIRPAVKDDGGDIEYRGFDRESGIVELKMQGACSGCPSSAVTLKSGIENMLM 180

Query: 178 HFVPEVK 184
           H+VPEVK
Sbjct: 181 HYVPEVK 187


>gi|255088633|ref|XP_002506239.1| predicted protein [Micromonas sp. RCC299]
 gi|226521510|gb|ACO67497.1| predicted protein [Micromonas sp. RCC299]
          Length = 298

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 9/189 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT+ TPNPA+L F+PG+ V  EG   +F+N +E   SPLA ++F I G+ SV+FG D
Sbjct: 94  IFIQTQTTPNPASLMFMPGKPVYEEGGTKNFANPREGMASPLAKKLFLIDGVTSVFFGQD 153

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+TV K ++++W  L+P V   IM+++ SG+PII +                 E D  +V
Sbjct: 154 FVTVTKSEEHEWGTLKPEVFAAIMDYYASGEPIITDEAELAN-----AGTAITEDDDEIV 208

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ R+RPAVA DGGDIVFKG+      V + M+GAC GCPS+S TLK G+ N+L
Sbjct: 209 AMIKELLETRIRPAVAEDGGDIVFKGWNADTGVVTVKMQGACDGCPSSSVTLKSGIENML 268

Query: 177 NHFVPEVKD 185
            H+VPEV  
Sbjct: 269 RHYVPEVNS 277


>gi|320170179|gb|EFW47078.1| TO42 [Capsaspora owczarzaki ATCC 30864]
          Length = 280

 Score =  186 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/190 (41%), Positives = 115/190 (60%), Gaps = 10/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKF+PG  V+  G   F++++ A  SPLA ++  I G+  V+F   F
Sbjct: 65  MFIQTQDTPNPNSLKFMPGVTVVDAGTYDFADSRAAATSPLARQLLRIQGVNRVFFAQKF 124

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I++ K D+ +W  L+P +   IM+ F SG P++      +    +             V 
Sbjct: 125 ISINKADEAEWPVLKPEIYATIMDFFASGLPVVEAPKTTEEAATEENET---------VS 175

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD+R+RP V  DGGDI FK + +G+V L + G+CS CPS+  TL  GV+N+L H+
Sbjct: 176 MIKELLDSRIRPMVQEDGGDIEFKSFENGVVKLKLIGSCSTCPSSKATLYDGVSNMLMHY 235

Query: 180 VPEVKDIRTV 189
           VPE++ I  V
Sbjct: 236 VPEIEKIEQV 245


>gi|254295433|ref|YP_003061456.1| Scaffold protein Nfu/NifU [Hirschia baltica ATCC 49814]
 gi|254043964|gb|ACT60759.1| Scaffold protein Nfu/NifU [Hirschia baltica ATCC 49814]
          Length = 190

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 122/191 (63%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP TLKF+PG+ V  +    F N KEA  SPLA+ +F++ G+ +V+ G DF
Sbjct: 1   MFIQTEATPNPETLKFLPGREVSPKTPYEFLNEKEAGSSPLAAFLFTLKGVKTVFLGADF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           + + K  + DW  L+P  L  IM+HF+SG P++ +        +      +   ++ +V 
Sbjct: 61  VALTKTQETDWAILKPQALAAIMDHFVSGMPVMADYSDPAPVEE----VIYEGENAEIVA 116

Query: 120 RIKEVLDNRVRPAVARDGGDIVFK--GYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+++ RVRPAVA DGGDI+F+      G+V L MRGAC+GCPS++ TLK G+ N+L 
Sbjct: 117 EIKELIETRVRPAVANDGGDIIFEKFDVDTGVVTLQMRGACAGCPSSTMTLKSGIENMLR 176

Query: 178 HFVPEVKDIRT 188
           H+VPEV  +  
Sbjct: 177 HYVPEVTAVEA 187


>gi|239799267|dbj|BAH70563.1| ACYPI005854 [Acyrthosiphon pisum]
          Length = 254

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 87/192 (45%), Positives = 118/192 (61%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP ++KF+PG  VL +G  + F NA  A  SPLA  +F I G+ SV+FG D
Sbjct: 43  MFIQTQDTPNPNSVKFLPGVQVLEKGHTMDFPNATAAYCSPLAKVLFRIEGVKSVFFGSD 102

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +IT+ K  D  +W  L+P +   IM+ F SG PI+ +                 E D+  
Sbjct: 103 YITLTKTDDDIEWMVLKPEIYATIMDFFASGLPILTDAKP-------TSDTQIHEDDNET 155

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD+R+RP V  DGGDI+F GY  GIV L ++G+C+ CPS+  TLK GV N+L 
Sbjct: 156 VMMIKELLDSRIRPTVQEDGGDILFIGYDAGIVKLKLQGSCTSCPSSVVTLKGGVQNMLQ 215

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 216 FYIPEVIAVEQV 227


>gi|315497209|ref|YP_004086013.1| scaffold protein nfu/nifu [Asticcacaulis excentricus CB 48]
 gi|315415221|gb|ADU11862.1| Scaffold protein Nfu/NifU [Asticcacaulis excentricus CB 48]
          Length = 188

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/194 (46%), Positives = 123/194 (63%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKFIPG+ VL +G++ F    +AE SPLA  +F I G++ VYFG DF
Sbjct: 1   MFIQTEATPNPDVLKFIPGREVLGKGSMEFRTETDAEKSPLALSLFQIDGVSGVYFGSDF 60

Query: 61  ITVGKDQYD---WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV +D      W  ++ P+L  IM+ + SG  I++  G        +    +    + +
Sbjct: 61  LTVKRDAEAGLIWAQIKAPILAAIMDFYASGRAILNEEGA-------VNERTYEGEVAQI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFK--GYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IK++LD RVRPAVA+DGGDI F+      G ++L MRGACSGCPS+S TL+ GV ++
Sbjct: 114 VLEIKDLLDTRVRPAVAQDGGDIEFEHFDIESGTLYLHMRGACSGCPSSSATLRQGVESL 173

Query: 176 LNHFVPEVKDIRTV 189
           + H+VPEVK I  V
Sbjct: 174 MKHYVPEVKTIEQV 187


>gi|302409492|ref|XP_003002580.1| HIRA-interacting protein [Verticillium albo-atrum VaMs.102]
 gi|261358613|gb|EEY21041.1| HIRA-interacting protein [Verticillium albo-atrum VaMs.102]
          Length = 292

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/198 (40%), Positives = 115/198 (58%), Gaps = 9/198 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL EG     I + N +     P  S    ++ +I G+ 
Sbjct: 66  IFIQTEPTPNPDALKFLPNHRVLPEGISVPYIEYLNPRATIAPPHPSPLAAQLLAIDGVT 125

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           +V++G DFITV K    +W H+R  +  +I E   SG P++      +    +  S  + 
Sbjct: 126 AVFYGADFITVTKAADANWAHVRAEIFALITEAITSGAPLVVVKEGAEAAPAEEDSLAYN 185

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG+V L +RGAC  C S++ TLK G
Sbjct: 186 EDDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGVVLLKLRGACRTCDSSTVTLKNG 245

Query: 172 VANILNHFVPEVKDIRTV 189
           +  +L H++ EVK +  V
Sbjct: 246 IEGMLMHYIEEVKSVNQV 263


>gi|326403969|ref|YP_004284051.1| hypothetical protein ACMV_18220 [Acidiphilium multivorum AIU301]
 gi|325050831|dbj|BAJ81169.1| hypothetical protein ACMV_18220 [Acidiphilium multivorum AIU301]
          Length = 185

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 133/190 (70%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNPATLKF+PG+ VL +G+  F +A  A  SPLA  +F++PG+  V+ G DF
Sbjct: 1   MFIETDVTPNPATLKFLPGREVLGQGSADFDSADAAAASPLAEALFALPGVVRVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V +D+  +W  L+P VLG IMEH++SG P++                D   +D  +  
Sbjct: 61  VSVTRDEGTEWTSLKPQVLGAIMEHYLSGRPVMAGAQA-------EVDEDVDPADREIAD 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDMRVRPAVAGDGGDIVFRGFRDGIVSLHMQGACSGCPSSTATLKMGIENLLKHY 173

Query: 180 VPEVKDIRTV 189
           VPEVK +R V
Sbjct: 174 VPEVKSVRQV 183


>gi|308802059|ref|XP_003078343.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
 gi|116056795|emb|CAL53084.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
          Length = 244

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 89/191 (46%), Positives = 123/191 (64%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MF+QT+ TPNP +L F PG+ V  EG+ +F +A+EA +SPLA R+F+I G+ +V+ G DF
Sbjct: 40  MFVQTQATPNPESLMFQPGRDVYAEGSRNFGSAREAMVSPLARRLFAIDGVTNVFLGVDF 99

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV KD  +DWE ++P     IM+ + SG+ ++    L      +       E D  VV 
Sbjct: 100 ITVTKDADHDWETVKPRTFEAIMDFYASGEAVVDEASL------EGHGTAIEEDDDEVVA 153

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAVA DGGDIVFK Y      V + + GAC GCPS+S TLK G+ N+L 
Sbjct: 154 MIKELLETRIRPAVAEDGGDIVFKAYDQETGVVSVQLMGACDGCPSSSVTLKSGIENMLM 213

Query: 178 HFVPEVKDIRT 188
           H+VPEVK ++ 
Sbjct: 214 HYVPEVKGVQQ 224


>gi|148260770|ref|YP_001234897.1| NifU domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146402451|gb|ABQ30978.1| nitrogen-fixing NifU domain protein [Acidiphilium cryptum JF-5]
          Length = 185

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 98/190 (51%), Positives = 132/190 (69%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+T+ TPNPATLKF+PG+ VL +G+  F +A  A  SPLA  +F++PG+  V+ G DF
Sbjct: 1   MFIETDVTPNPATLKFLPGREVLGQGSADFDSADAAAASPLAEALFALPGVVRVFLGADF 60

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V +D   +W  L+P VLG IMEH++SG P++                D   +D  +  
Sbjct: 61  VSVTRDDGTEWTSLKPQVLGAIMEHYLSGRPVMAGAQA-------EVDEDVDPADREIAD 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE+LD RVRPAVA DGGDIVF+G+RDGIV L M+GACSGCPS++ TLK G+ N+L H+
Sbjct: 114 QIKELLDMRVRPAVAGDGGDIVFRGFRDGIVSLHMQGACSGCPSSTATLKMGIENLLKHY 173

Query: 180 VPEVKDIRTV 189
           VPEVK +R V
Sbjct: 174 VPEVKSVRQV 183


>gi|189200054|ref|XP_001936364.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187983463|gb|EDU48951.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 312

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 84/202 (41%), Positives = 118/202 (58%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           MFIQTE TPN   LKF P Q VL E      + + N +     P  S    ++ +I GI 
Sbjct: 70  MFIQTEPTPNADALKFNPNQRVLPENISSPFLEYLNPRSTLAPPHPSPLAAQLMNIDGIT 129

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL----DDMGS 107
           SV+FG D+ITV KD    W H++P V  +I E+  SG PI++       +      +  S
Sbjct: 130 SVFFGADYITVTKDSSTPWAHIKPEVFALINEYMTSGQPIVNTVAAKAGEQGQGGQENDS 189

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E+D  VV  IKE+L+ RVRPA+  DGGDI F+G+ DG V+L +RGAC  C S++ T
Sbjct: 190 LAYDENDDEVVGMIKELLETRVRPAIQEDGGDIEFRGFNDGQVWLKLRGACRTCDSSTVT 249

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK ++ V
Sbjct: 250 LKNGIESMLMHYIEEVKGVQQV 271


>gi|329891163|ref|ZP_08269506.1| scaffold protein Nfu/NifU family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328846464|gb|EGF96028.1| scaffold protein Nfu/NifU family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 185

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 81/193 (41%), Positives = 120/193 (62%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V V+  + +    EA  SPLA  +F + G+  V+FG D+
Sbjct: 1   MFIQTEATPNPNALKFLPGRDVAVQDVLEYRTIDEAAASPLAEALFELEGVEGVFFGADY 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +++ +     DW  ++ P+L +IM+HF+SG P++  G        +         D+ +V
Sbjct: 61  VSITRAAHGPDWTEMKAPILSVIMDHFVSGAPLVREGETATEDAGE---------DTEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +    + L MRGAC+GCPS+S TLK GV  ++
Sbjct: 112 AEIKSLLDSRIRPAVAQDGGDILFDHFDEETGVLRLRMRGACAGCPSSSATLKAGVEQMM 171

Query: 177 NHFVPEVKDIRTV 189
            H+VPEV  +  V
Sbjct: 172 RHYVPEVTSVEQV 184


>gi|328862177|gb|EGG11278.1| hypothetical protein MELLADRAFT_41822 [Melampsora larici-populina
           98AG31]
          Length = 292

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 83/194 (42%), Positives = 123/194 (63%), Gaps = 8/194 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQTE TPNP  LKFIPG  V+    G + F +      SPLA  +F IPGI S++FG 
Sbjct: 74  IFIQTETTPNPDALKFIPGVPVMGKSNGTLEFLSNSNPNSSPLAKSLFKIPGIKSLFFGP 133

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFI++ KD+  +W  ++P +  ++ME F SG PI+ +   G+   +D      +ESDS V
Sbjct: 134 DFISINKDEETNWSIIKPEIYSLMMEFFSSGQPILTDESEGNQGPEDT---RVLESDSEV 190

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
           +  IKE+LD RVRP++  DGGD+ +KG+ +    V L ++G+C GC S++ TLK G+  +
Sbjct: 191 IAMIKELLDTRVRPSIQEDGGDLEYKGFDEETGVVTLMLKGSCRGCDSSTVTLKSGIERM 250

Query: 176 LNHFVPEVKDIRTV 189
           L H++PEV+ +  V
Sbjct: 251 LMHYIPEVQAVEQV 264


>gi|254420655|ref|ZP_05034379.1| Scaffold protein Nfu/NifU N terminal [Brevundimonas sp. BAL3]
 gi|196186832|gb|EDX81808.1| Scaffold protein Nfu/NifU N terminal [Brevundimonas sp. BAL3]
          Length = 185

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 83/192 (43%), Positives = 118/192 (61%), Gaps = 13/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF+PG+ V     + +     A  SPLA  +F + G+  V+FG D+
Sbjct: 1   MFIQTEPTPNPNVLKFLPGREVSPLAVLDYRTIDAATASPLAEALFELEGVDGVFFGADY 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ++V + +   DW  ++ P+LG+IM+HF+SG P+   G   +            E DS +V
Sbjct: 61  VSVTRQERGPDWSEMKAPILGVIMDHFVSGRPLTVAGSETETHA---------EDDSEIV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             IK +LD+R+RPAVA+DGGDI+F  + +    + L MRGACSGCPS+S TLK GV  ++
Sbjct: 112 AEIKALLDSRIRPAVAQDGGDILFDAFDEATGVLSLRMRGACSGCPSSSATLKAGVEQMM 171

Query: 177 NHFVPEVKDIRT 188
            H+VPEV  +  
Sbjct: 172 RHYVPEVTRVEQ 183


>gi|156389173|ref|XP_001634866.1| predicted protein [Nematostella vectensis]
 gi|156221954|gb|EDO42803.1| predicted protein [Nematostella vectensis]
          Length = 186

 Score =  185 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 10/191 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ ++TPNP +LKF+PG +VL  G ++F ++  A  SPLA  +F I G+  V FG +F
Sbjct: 1   MFIQVQETPNPNSLKFVPGVLVLESGTVNFDSSSSAHRSPLARNLFRINGVKGVMFGPEF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  ++  W  L+P +   IM+ F S  PI+      +    D GS     +D   V
Sbjct: 61  ITVTKSDEEVQWSVLKPEIFATIMDFFSSNLPIMTE----EEPPQDTGSC----NDDDTV 112

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+LD R+RP V  DGGDI+FKG++DGIV L M+GAC+ CPS+  TLK G+ N++  
Sbjct: 113 LMIKELLDTRIRPTVQEDGGDIIFKGFKDGIVKLKMQGACASCPSSIVTLKNGIENMMQF 172

Query: 179 FVPEVKDIRTV 189
           ++PEV  +  V
Sbjct: 173 YIPEVVSVEQV 183


>gi|225707158|gb|ACO09425.1| HIRA-interacting protein 5 [Osmerus mordax]
          Length = 268

 Score =  185 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 83/189 (43%), Positives = 115/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           IQT+DTPNP +LKF+PG+ VL  G + F   + AE S LA  +F I G+ SV+FG DFIT
Sbjct: 66  IQTQDTPNPRSLKFLPGKPVLGTGTLDFPTPQNAECSSLAKDLFEIEGVKSVFFGPDFIT 125

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           V K  D  +W +++   +  I + F SG PI       +            E D  +V  
Sbjct: 126 VTKADDDVEWTNIKRHAVEAITKFFDSGAPITTGVSHHESSHS--------EDDDEIVSI 177

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS+S TL+ G+ N+L  ++
Sbjct: 178 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSSVTLRNGIQNMLQFYI 237

Query: 181 PEVKDIRTV 189
           PEV D+  V
Sbjct: 238 PEVDDVEQV 246


>gi|330991171|ref|ZP_08315124.1| NFU1 iron-sulfur cluster scaffold-like protein [Gluconacetobacter
           sp. SXCC-1]
 gi|329761757|gb|EGG78248.1| NFU1 iron-sulfur cluster scaffold-like protein [Gluconacetobacter
           sp. SXCC-1]
          Length = 187

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 92/192 (47%), Positives = 126/192 (65%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKE-AEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ ++  G    F +    A  S LA  +F + G+A V+FG 
Sbjct: 1   MFIETEDTPNPATLKFLPGREIMANGATADFISPDSVAGRSRLAELLFDLDGVARVFFGA 60

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF+ V + D  +WE LRP VL ++ ++  +G  ++ +          +        D  +
Sbjct: 61  DFVAVTRSDSVEWEGLRPQVLAVLADYLATGQAVVESDA-------QVVEDLIAPGDEEI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ+IKE+LD RVRPAVA DGGDIVF+GYRDG+V L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 114 VQQIKELLDTRVRPAVAGDGGDIVFRGYRDGVVRLTMQGACSGCPSSRATLKHGVENMLR 173

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 174 HYVPEVVSVEQV 185


>gi|70990736|ref|XP_750217.1| NifU-related protein [Aspergillus fumigatus Af293]
 gi|66847849|gb|EAL88179.1| NifU-related protein [Aspergillus fumigatus Af293]
 gi|159130693|gb|EDP55806.1| NifU-related protein [Aspergillus fumigatus A1163]
          Length = 326

 Score =  184 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 78/201 (38%), Positives = 117/201 (58%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL EG     + + + +     P  S     +F++ G+ 
Sbjct: 85  IFIQTENTPNPDALKFIPNHRVLPEGFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 144

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGD-- 109
           SV++G DFITV K    +W H++P V  +I +   SG+ I++          + G  +  
Sbjct: 145 SVFYGPDFITVNKSSDANWAHIKPEVFSLITQAVTSGEAIVNTVEKTGEHAQESGEQESL 204

Query: 110 -FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 205 SFSEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 264

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 265 KNGIESMLMHYIEEVQGVEQV 285


>gi|296421235|ref|XP_002840171.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636384|emb|CAZ84362.1| unnamed protein product [Tuber melanosporum]
          Length = 279

 Score =  184 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 81/192 (42%), Positives = 123/192 (64%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQTE TPNP+ LKFIPG  VL EG  +  + + +E   SPLA ++F++ G+ SV++G 
Sbjct: 48  LFIQTESTPNPSALKFIPGLPVLPEGCQSQEYIDGRETHNSPLARKLFAVDGVRSVFYGP 107

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFIT+ KD+   W  L+  V  +I E   SG+P+I  G +      +       E DS V
Sbjct: 108 DFITITKDEETQWAFLKAEVYSLITEALNSGEPVILEGTM------ESSDTQREEGDSEV 161

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+L+ R+RPA+  DGGDI ++G+ +G+V L +RGAC  C S++ TLK G+ ++L 
Sbjct: 162 VGMIKELLETRIRPAIQEDGGDIEYRGFENGVVKLKLRGACRTCDSSTVTLKNGIESMLM 221

Query: 178 HFVPEVKDIRTV 189
           H++ EV+ ++ +
Sbjct: 222 HYIEEVQSVQQI 233


>gi|58039243|ref|YP_191207.1| NifU protein [Gluconobacter oxydans 621H]
 gi|58001657|gb|AAW60551.1| NifU protein [Gluconobacter oxydans 621H]
          Length = 212

 Score =  184 bits (466), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 94/192 (48%), Positives = 123/192 (64%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAK-EAEISPLASRIFSIPGIASVYFGY 58
           MFI+TEDTPNPATLKF+PG+ V  +   + F +A   A  S LAS +F  P +  V+ G 
Sbjct: 26  MFIETEDTPNPATLKFLPGRSVTGDARPVDFGDADVAAGRSELASALFDQPNVRRVFLGG 85

Query: 59  DFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DF++V K D   W  L+P VLG I   F SG P++                D    D+ V
Sbjct: 86  DFVSVTKSDDISWGDLKPVVLGTITTFFESGRPVLSGTQAAPEH-------DVSPEDAEV 138

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V RI+++LD RVRPAVA DGGDI F+GY+DG+V+L+M+GACSGCPS+  TLK+GV N+L 
Sbjct: 139 VSRIQDLLDTRVRPAVAGDGGDIAFRGYKDGVVYLAMQGACSGCPSSRATLKHGVENMLR 198

Query: 178 HFVPEVKDIRTV 189
           H+VPEV  +  V
Sbjct: 199 HYVPEVASVEQV 210


>gi|329847368|ref|ZP_08262396.1| scaffold protein Nfu/NifU [Asticcacaulis biprosthecum C19]
 gi|328842431|gb|EGF92000.1| scaffold protein Nfu/NifU [Asticcacaulis biprosthecum C19]
          Length = 188

 Score =  183 bits (464), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 86/194 (44%), Positives = 123/194 (63%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  +KF+PGQVVL +G   F +  EA++SPLA  +F I G+++++FG DF
Sbjct: 1   MFIQTEATPNPDVIKFLPGQVVLAQGTKQFVSEDEAKVSPLAEALFKIDGVSALFFGSDF 60

Query: 61  ITVGKDQYD---WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +TV +D      W  L+PP+L  IM+ + SG PI+    +            +      +
Sbjct: 61  LTVRRDPDATLIWAQLKPPILAAIMDFYTSGQPILRETEVK-------TETVYEGELGQI 113

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           +  IK++LD RVRPAVA+DGGDI F  +      ++L MRGAC+GCPS+S TL+ GV ++
Sbjct: 114 IAEIKDLLDTRVRPAVAQDGGDIEFDSFDMESGTLYLHMRGACAGCPSSSATLRQGVESL 173

Query: 176 LNHFVPEVKDIRTV 189
           + H+VPEV+ I  V
Sbjct: 174 MKHYVPEVRHIEAV 187


>gi|193599106|ref|XP_001949519.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Acyrthosiphon pisum]
          Length = 254

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 86/192 (44%), Positives = 117/192 (60%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP ++KF+PG  VL +G  + F NA  A  SPLA  +F I G+ SV+FG D
Sbjct: 43  MFIQTQDTPNPNSVKFLPGVQVLEKGHTMDFPNATAAYCSPLAKVLFRIEGVKSVFFGSD 102

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           +IT+ K  D  +W  L+P +   IM+ F SG PI+ +                 E D+  
Sbjct: 103 YITLTKTDDDIEWMVLKPEIYATIMDFFASGLPILTDAKP-------TSDTQIHEDDNET 155

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD+R+RP V  DGGDI+F GY  GIV L ++G+C+ CPS+  TLK GV  +L 
Sbjct: 156 VMMIKELLDSRIRPTVQEDGGDILFIGYDAGIVKLKLQGSCTSCPSSVVTLKGGVQYMLQ 215

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 216 FYIPEVIAVEQV 227


>gi|170747078|ref|YP_001753338.1| scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831]
 gi|170653600|gb|ACB22655.1| Scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831]
          Length = 188

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 100/191 (52%), Positives = 142/191 (74%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+VVL E      +A+ A  SPLA+ +F++PG+A VYFG+DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRVVLAESTFEARDAEAAARSPLAAALFTVPGVAGVYFGHDF 60

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           I+V K  D  +W  ++P VLG IMEHF SG P++  GG G++   + G   + E+D   V
Sbjct: 61  ISVTKAEDGSEWAQVKPAVLGAIMEHFQSGAPVMAEGGHGEI---EPGDEFYDEADHDTV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IK++L+ RVRPAVA DGGDI F+GY++G+V+L M+GACSGCPS++ TL++GV N+  H
Sbjct: 118 VTIKDLLETRVRPAVAGDGGDITFRGYKEGVVYLEMKGACSGCPSSTATLRHGVQNLFRH 177

Query: 179 FVPEVKDIRTV 189
           F+PE+++++ +
Sbjct: 178 FLPEIREVQAI 188


>gi|322798976|gb|EFZ20436.1| hypothetical protein SINV_01605 [Solenopsis invicta]
          Length = 226

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 88/192 (45%), Positives = 120/192 (62%), Gaps = 9/192 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  SPLA  +F I G+ +++FG D
Sbjct: 15  MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPSAKDAYCSPLAKMLFRIEGVKAIFFGPD 74

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P V   IM+ F +G P++      D              D  +
Sbjct: 75  FITVTKIDEDVEWKLLKPEVFATIMDFFATGLPVM------DETSQPAADTQINAEDDEI 128

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGDIVF G+ +GIV L M+G+C+ CPS+  TL+ GV N++ 
Sbjct: 129 VQMIKELLDTRIRPTVQEDGGDIVFVGFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNMMQ 188

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 189 FYIPEVLGVIQV 200


>gi|71083083|ref|YP_265802.1| NifU-like domain-containing protein [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762490|ref|ZP_01264455.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062196|gb|AAZ21199.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718292|gb|EAS84942.1| NifU-like domain protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 180

 Score =  183 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 73/190 (38%), Positives = 118/190 (62%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP +LKF+PG+ V   G+      +E   + L   I SI G+  V+ G DF
Sbjct: 1   MFIQTEVTPNPNSLKFLPGKTVSNNGSFEVIKKEET-DNELVRNILSINGVTGVFLGEDF 59

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I++ K++  +WE ++   + +I + + +G   +    L   K          E  + + +
Sbjct: 60  ISINKNEEVNWEDIKHIAISLINDFYSTGKEFVIANELLGEKK---------EEHTEIEK 110

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I  +L++++RPAVA+DGGDI FK ++DGIV + ++G+CSGCPS++ TLK GV N+L H+
Sbjct: 111 QIISILESKIRPAVAKDGGDIKFKEFKDGIVKVELQGSCSGCPSSTMTLKQGVQNLLCHY 170

Query: 180 VPEVKDIRTV 189
           +PEVK++  +
Sbjct: 171 LPEVKEVVAI 180


>gi|225629714|ref|ZP_03787679.1| NifU domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591431|gb|EEH12506.1| NifU domain protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 194

 Score =  183 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/189 (48%), Positives = 130/189 (68%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFAILNEGETADFSNADEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F E+D  +V
Sbjct: 65  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNISDEE--FFDENDIEIV 122

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 123 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 182

Query: 179 FVPEVKDIR 187
            +PEV  I 
Sbjct: 183 HIPEVAGIE 191


>gi|325187609|emb|CCA22145.1| ironsulfur cluster scaffold protein Nfulike protein putative
           [Albugo laibachii Nc14]
          Length = 287

 Score =  183 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 82/196 (41%), Positives = 118/196 (60%), Gaps = 14/196 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLASRIFSIPGIASVYF 56
           MF+QTE TPNP +LKF+PG+ VL +    G      A E   SPLA ++F I GI+ V+F
Sbjct: 71  MFVQTEPTPNPNSLKFLPGKPVLDDRFTTGVDFVPGAAEIRQSPLAKKLFQIDGISRVFF 130

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           G DFI+V K D   W+ LR  +   I++ + +G+  + +  +       +     +  D 
Sbjct: 131 GKDFISVTKADDMHWDALRAEIFATIIDFYGTGEATMSDEPI-------VTDTTILPEDD 183

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE+L+ R+RP+V  DGGDI +K +    GIV L + GAC+GCPS+S TLK GV 
Sbjct: 184 EVVAMIKELLEQRIRPSVQDDGGDIFYKDFDVERGIVKLQLAGACAGCPSSSVTLKSGVE 243

Query: 174 NILNHFVPEVKDIRTV 189
           N+L +++PEV+ I  V
Sbjct: 244 NMLKYYIPEVQGIEEV 259


>gi|307189950|gb|EFN74186.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Camponotus floridanus]
          Length = 289

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 83/192 (43%), Positives = 117/192 (60%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  S LA  +F I G+ +++FG D
Sbjct: 81  MFIQTQDTPNPNSLKFIPGVPVLGEGCTKDFPSAKDAYCSSLAKMLFRIEGVKAIFFGPD 140

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P +   IM+ F SG PI++                    D  +
Sbjct: 141 FITVTKLDEDVEWKLLKPEIFATIMDFFASGLPIMNETS------QPATDTQINADDDEI 194

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+L+ R+RP V  DGGD    G+ +GIV L M+G+C+ CPS++ TL+ GV N++ 
Sbjct: 195 VQMIKELLETRIRPTVQEDGGD---IGFEEGIVKLKMQGSCTNCPSSAVTLRNGVQNMMR 251

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 252 FYIPEVLGVVQV 263


>gi|145505407|ref|XP_001438670.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124405842|emb|CAK71273.1| unnamed protein product [Paramecium tetraurelia]
          Length = 207

 Score =  182 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 81/192 (42%), Positives = 119/192 (61%), Gaps = 5/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQ + TPNP  LKFIPG + V++ G   F+  +EA+ SPLA ++F I G+  V++G D
Sbjct: 10  LFIQAKPTPNPNFLKFIPGGKQVMLNGTYDFTRPREAKCSPLAQKLFLIDGVTRVFYGKD 69

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +I++  K++  WE ++P +   IMEH+   D       L      +       E DS VV
Sbjct: 70  YISIAKKEESRWEEIKPQIFEHIMEHYQ-LDSDGQEKKLIIDGYQENQDTQINEDDSEVV 128

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
           Q IKE++D R+RP V  DGGDIVF+ + +   IV L M+G+C+GCPS+S TLK G+  +L
Sbjct: 129 QLIKEIIDTRIRPTVQEDGGDIVFRDFDEKSGIVQLYMKGSCAGCPSSSVTLKNGIERML 188

Query: 177 NHFVPEVKDIRT 188
            H+V EVK++  
Sbjct: 189 CHYVAEVKEVVA 200


>gi|225707504|gb|ACO09598.1| HIRA-interacting protein 5 [Osmerus mordax]
          Length = 263

 Score =  182 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 82/189 (43%), Positives = 115/189 (60%), Gaps = 11/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           IQT+DTPNP +LKF+PG+ VL  G + F   + AE S LA  +F I G+ SV+FG DFIT
Sbjct: 62  IQTQDTPNPRSLKFLPGKPVLGTGTLDFPTPQNAECSSLAKDLFEIEGVKSVFFGPDFIT 121

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           V K  D  +W +++   +  I + F SG PI       +    +         D  +V  
Sbjct: 122 VTKADDDVEWTNIKRHAVEAITKFFDSGAPITTGVSHHESSHSE---------DDEIVSI 172

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS+S TL+ G+ N+L  ++
Sbjct: 173 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSSVTLRNGIQNMLQFYI 232

Query: 181 PEVKDIRTV 189
           PEV D+  V
Sbjct: 233 PEVDDVEQV 241


>gi|302695957|ref|XP_003037657.1| hypothetical protein SCHCODRAFT_48637 [Schizophyllum commune H4-8]
 gi|300111354|gb|EFJ02755.1| hypothetical protein SCHCODRAFT_48637 [Schizophyllum commune H4-8]
          Length = 220

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 77/193 (39%), Positives = 120/193 (62%), Gaps = 5/193 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQTE TPN  ++KFIPG  V+ E G   F + + A  SPLA R+  I G+ +V++G D
Sbjct: 1   MFIQTESTPNEDSIKFIPGVPVMGESGTAEFLDTRSALTSPLAVRLMGIEGVRAVFYGPD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+TV K  ++ W  ++P +  ++ME F S +  +      D +         +++DS VV
Sbjct: 61  FVTVSKSSEHPWSVIKPEIYSVLMEFFTSNNQPLFRSKE-DRENAGPQDTRILDTDSDVV 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+L+ RVRPA+  DGGDI ++G+ +   +V + ++G+C GC S++ TLK G+ N+L
Sbjct: 120 AMIKELLETRVRPAIMEDGGDIEYRGFDEESGVVQVKLKGSCRGCSSSTVTLKTGIENML 179

Query: 177 NHFVPEVKDIRTV 189
            H++PEVK +  V
Sbjct: 180 MHYIPEVKGVEQV 192


>gi|58584670|ref|YP_198243.1| NifU family protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418986|gb|AAW71001.1| NifU family protein containing thioredoxin-like domain [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 190

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 91/189 (48%), Positives = 127/189 (67%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L E     FSN  E + S LA+ +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFAILNERETADFSNPDEIKNSKLAADLFQIEHVIRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D   W+ L+  +L  +M+HF SG   +   G+ D  + D     F E+D  +V
Sbjct: 61  FISVTKSDGISWDILKVEILTTVMDHFTSGGKALDRKGVNDNNIPDEE--FFDENDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE+++N ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L +
Sbjct: 119 NRIKELMENYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLCY 178

Query: 179 FVPEVKDIR 187
            +PEV  I 
Sbjct: 179 HIPEVSGIE 187


>gi|308492754|ref|XP_003108567.1| CRE-LPD-8 protein [Caenorhabditis remanei]
 gi|308248307|gb|EFO92259.1| CRE-LPD-8 protein [Caenorhabditis remanei]
          Length = 223

 Score =  181 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 81/193 (41%), Positives = 121/193 (62%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L +      F++A  A+ SPLA ++  + G+  V+FG 
Sbjct: 16  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFNSAAAAKQSPLAVKLLRVDGVKRVFFGE 75

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+TV K  +  DW  LRP +   I +H  +G P+I+     D + +          D+ 
Sbjct: 76  DFVTVTKADEHVDWALLRPEIFSTIADHLQTGKPVINEVAATDGEAEV--------EDNE 127

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 128 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 187

Query: 177 NHFVPEVKDIRTV 189
             +VPEVK++  V
Sbjct: 188 TFYVPEVKEVIEV 200


>gi|225711062|gb|ACO11377.1| NFU1 iron-sulfur cluster scaffold homolog [Caligus rogercresseyi]
          Length = 237

 Score =  181 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 79/194 (40%), Positives = 117/194 (60%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      + F     A  SPLA  +F + G+  V+FG 
Sbjct: 27  MYIRTQETPNPQSLKFLPGVRVLETAGSTLDFPTPSAAYCSPLAKLLFRVDGVKGVFFGQ 86

Query: 59  DFITVGKDQ---YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K++    +W+ ++P V   +M+ F SG PI++               +  E D 
Sbjct: 87  DFITITKEEDSEVEWKVIKPEVYATLMDFFASGLPIVNEDA------KPHSDTEIHEDDD 140

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDI+F G+ DGIV L M+G+C+ CPS+  TLK GV N+
Sbjct: 141 DTVAMIKELLDSRIRPTVQEDGGDIIFMGFEDGIVKLKMQGSCTSCPSSIVTLKNGVQNM 200

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 201 LQFYIPEVIEVEQI 214


>gi|119496847|ref|XP_001265197.1| NifU-related protein [Neosartorya fischeri NRRL 181]
 gi|119413359|gb|EAW23300.1| NifU-related protein [Neosartorya fischeri NRRL 181]
          Length = 326

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 77/201 (38%), Positives = 115/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S     +F++ G+ 
Sbjct: 85  IFIQTENTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 144

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD---MGSG 108
           SV++G DFITV K    +W H++P V  +I +   SG+ I++          +     S 
Sbjct: 145 SVFYGPDFITVSKSSDANWAHIKPEVFSLITQAVTSGEAIVNTVEKTGEHAQEGGEEESL 204

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 205 SFNEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 264

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 265 KNGIESMLMHYIEEVQGVEQV 285


>gi|145344446|ref|XP_001416743.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144576969|gb|ABO95036.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 206

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 9/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +L F PG+ V  EG+ +FSNA+EA  SPLA R+F+I G+ +V+FG DF
Sbjct: 1   MFIQTQTTPNPMSLMFQPGREVYAEGSKNFSNAREAMASPLAKRLFAIEGVTNVFFGIDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  +WE ++P     I   + SG+ ++    L              E D  +V 
Sbjct: 61  VTVTKGEDAEWETVKPQTFEAITNFYASGETVMDEEKLAA------SGTAIAEDDDEIVA 114

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ R+RPAVA DGGDIVFK +      V + ++G+C GCPS+S TLK G+ N+L 
Sbjct: 115 MIKELLETRIRPAVAEDGGDIVFKAFDPESGLVTVQLQGSCDGCPSSSVTLKSGIENMLM 174

Query: 178 HFVPEVKDIRT 188
           H+VPEVK +  
Sbjct: 175 HYVPEVKGVVQ 185


>gi|85083846|ref|XP_957202.1| HIRA-interacting protein 5 [Neurospora crassa OR74A]
 gi|18376131|emb|CAD21196.1| conserved hypothetical protein [Neurospora crassa]
 gi|28918289|gb|EAA27966.1| HIRA-interacting protein 5 [Neurospora crassa OR74A]
          Length = 326

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 83/203 (40%), Positives = 120/203 (59%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP +LKF+P Q V+ +      I + NA+     P  S    ++ +I G+ 
Sbjct: 83  IFIQTENTPNPDSLKFLPNQKVIPDSIKTPFIEYMNARSTIAPPYPSPLAAQLMNIEGVT 142

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDP-----IIHNGGLGDMKLDDMG 106
           SV++G DFITV K    +W H+RP V  +I E   SG         + G     + D+  
Sbjct: 143 SVFYGTDFITVTKSADANWAHIRPEVFALITETITSGQTIVNVVERNEGEESTQESDEKD 202

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ 
Sbjct: 203 SLAYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVKLKLRGACRTCDSSTV 262

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+  +L H++ EV+ +  V
Sbjct: 263 TLKNGIEGMLMHYIEEVQGVEQV 285


>gi|156044806|ref|XP_001588959.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980]
 gi|154694895|gb|EDN94633.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 372

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 79/201 (39%), Positives = 113/201 (56%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG----AIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTEDTPNP  LKF+P   +L        I + N +     P  S     + +I G+ 
Sbjct: 76  IFIQTEDTPNPDALKFLPNHPILPPSLNAPFIEYLNPRSTLAPPHPSPLAASLMNIDGVK 135

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGD---PIIHNGGLGDMKLDDMGSG 108
           SV++G DFITV K D  +W H++P +  +I E   SG     I    G      ++  S 
Sbjct: 136 SVFYGVDFITVTKADDANWAHIKPEIFSLITEAVTSGAQIVNITEKTGASGEAPEEEDSL 195

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+L+ R+RPA+  DGGDI ++G+ DG+V L +RGAC  C S++ TL
Sbjct: 196 AYNEDDPEVVGMIKELLETRIRPAIQEDGGDIDYRGFEDGMVKLKLRGACRTCDSSTVTL 255

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+  +L H++ EVK +  V
Sbjct: 256 KNGIEGMLMHYIEEVKGVVQV 276


>gi|190571129|ref|YP_001975487.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018533|ref|ZP_03334341.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357401|emb|CAQ54835.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995484|gb|EEB56124.1| NifU domain protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 190

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 92/189 (48%), Positives = 131/189 (69%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA  +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFEILSEGETADFSNADEIKNSKLAVNLFQIEHVVRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D+ +W+ ++  +L  IM+HF SG       G+ D K+ +     F E+D  +V
Sbjct: 61  FISVTKSDRMNWDIVKVEILTTIMDHFTSGGKAFDKEGVSDNKMLEEE--FFNENDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 119 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 178

Query: 179 FVPEVKDIR 187
            +PEV  I 
Sbjct: 179 HIPEVSGIE 187


>gi|268570156|ref|XP_002648431.1| C. briggsae CBR-LPD-8 protein [Caenorhabditis briggsae]
 gi|187039912|emb|CAP21246.1| CBR-LPD-8 protein [Caenorhabditis briggsae AF16]
          Length = 228

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 82/193 (42%), Positives = 120/193 (62%), Gaps = 12/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L +      FS+A  A+ SPLA ++  + G+  V+FG 
Sbjct: 21  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAIKLLRVDGVKRVFFGE 80

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DFITV K  +  DW  LRP +   I +H  +G  +I+       + +        E D+ 
Sbjct: 81  DFITVTKSDETVDWALLRPEIFSTIADHLQTGKSVINEASATAGEAE--------EDDNE 132

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 133 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 192

Query: 177 NHFVPEVKDIRTV 189
             +VPEVK++  V
Sbjct: 193 TFYVPEVKEVIEV 205


>gi|58697437|ref|ZP_00372735.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536136|gb|EAL59746.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans]
          Length = 190

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 90/189 (47%), Positives = 130/189 (68%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 1   MFIQIEETPNPNTLKFLPGFEILNEGETTDFSNANEIKNSKLAANLFQIEHVVRVFFGHD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F ++D  +V
Sbjct: 61  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNIPDEE--FFDKNDIEIV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 119 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 178

Query: 179 FVPEVKDIR 187
            +PE+  I 
Sbjct: 179 HIPEIAGIE 187


>gi|328773127|gb|EGF83164.1| hypothetical protein BATDEDRAFT_9276 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 225

 Score =  180 bits (456), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 113/193 (58%), Gaps = 10/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA---IHFSNAKEAEISPLASRIFSIPGIASVYFG 57
           MFIQTE TPN  +LKF PG++VL EG      F +A+EA  SPLAS +F I G+ SV FG
Sbjct: 9   MFIQTESTPNLDSLKFKPGKLVLPEGTTSTREFISAREAMQSPLASTLFRIDGVKSVLFG 68

Query: 58  YDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            D ITV K     W  ++P + G IM+ + SG P+        +  +       +  DS 
Sbjct: 69  KDVITVNKSPDVAWSIIKPDIFGAIMDFYSSGVPLF------KVAFEGPTDTMILPEDSE 122

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+LD R+RP +  DGGDI + G+ +G V L +RGAC  C S+  TLK G+ N+L
Sbjct: 123 TVAMIKELLDTRIRPTIQEDGGDIEYMGFVNGAVRLKLRGACRTCDSSVVTLKNGIENML 182

Query: 177 NHFVPEVKDIRTV 189
            H++PEV  +  V
Sbjct: 183 MHYIPEVTAVEQV 195


>gi|62202252|gb|AAH92870.1| Zgc:110319 [Danio rerio]
 gi|182890178|gb|AAI64833.1| Zgc:110319 [Danio rerio]
          Length = 256

 Score =  180 bits (456), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 78/189 (41%), Positives = 114/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT
Sbjct: 54  ILTQDTPNPRSLKFLPGKPVLGSGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFIT 113

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V  
Sbjct: 114 LTKTDDDVEWTDIKRHAIEVIRKFFEGGEAITTGAAHAESSVT--------EDDDEIVSL 165

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++
Sbjct: 166 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYI 225

Query: 181 PEVKDIRTV 189
           PEV ++  V
Sbjct: 226 PEVDNVEQV 234


>gi|171689560|ref|XP_001909720.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944742|emb|CAP70853.1| unnamed protein product [Podospora anserina S mat+]
          Length = 323

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/207 (36%), Positives = 115/207 (55%), Gaps = 18/207 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN  +LKF+P   VL E      + + + +     P  S     + ++ G+ 
Sbjct: 77  IFIQTEPTPNANSLKFLPNHPVLPESISTPFVEYLSPRSTISPPYPSPLAANLMNVDGVT 136

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDP---------IIHNGGLGDMKL 102
           SV++G DFITV K     W H+RP +  +I E   SG P            +    + + 
Sbjct: 137 SVFYGQDFITVTKSADAVWAHIRPEIFSLITEAITSGQPLVNISQQSASSPSTAEQEQES 196

Query: 103 DDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCP 162
            +  S ++ E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C 
Sbjct: 197 GERDSLEYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCD 256

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S++ TLK G+  +L H++ EV+ +  V
Sbjct: 257 SSTVTLKNGIEGMLMHYIEEVQGVEQV 283


>gi|322710719|gb|EFZ02293.1| NifU-like protein [Metarhizium anisopliae ARSEF 23]
          Length = 297

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 81/199 (40%), Positives = 117/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +     P  S    ++ +I GI 
Sbjct: 73  IFIQTENTPNPDALKFLPNHRVVPEEINTPFIEYLNPRSTISPPYPSPLAAKLMNIDGIT 132

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD-DMGSGDF 110
           SV++G DFITV K    +W H+RP +  +I E   SG+ I+      +   D +  S  +
Sbjct: 133 SVFYGADFITVTKAGDANWAHVRPEIFALITEAITSGETIVSIAERKEGDEDIEEDSLAY 192

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC  C S++ TLK 
Sbjct: 193 NENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFDDGYVKLKLRGACRTCDSSTVTLKN 252

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+  +L H++ EVK +  +
Sbjct: 253 GIEGMLMHYIEEVKGVHQI 271


>gi|321470871|gb|EFX81846.1| hypothetical protein DAPPUDRAFT_49825 [Daphnia pulex]
          Length = 206

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 86/192 (44%), Positives = 123/192 (64%), Gaps = 11/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MF+QT+DTPNP +LKF+PG QVVL    + F     A+ SPLA  +F I G+ SV+ G D
Sbjct: 1   MFVQTQDTPNPNSLKFLPGVQVVLESETMDFPTLSSAQCSPLAKLLFRIEGVKSVFLGPD 60

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  ++ DW+ ++  V   IM+ F SG P+++ G       +        E D+  
Sbjct: 61  FITITKIDEETDWKTIKAEVFATIMDFFTSGLPVVNEGINQPDNGN--------EEDNDT 112

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           V  IKE+LD+R+RP V  DGGD+VFKG++DGIV+L ++G+C+ CPS+  TLK GV N+L 
Sbjct: 113 VLMIKELLDSRIRPTVQEDGGDLVFKGFKDGIVYLKLQGSCTSCPSSMVTLKNGVQNMLQ 172

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 173 FYIPEVIAVEQV 184


>gi|299469630|emb|CBN76484.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 282

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 77/195 (39%), Positives = 107/195 (54%), Gaps = 14/195 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLV----EGAIHFSNAKEAEISPLASRIFSIPGIASVYFG 57
           FIQTE TPNP +LKF+PG+ VL      G     + +E   SPLA  + S+ G+A V+ G
Sbjct: 66  FIQTEPTPNPNSLKFLPGRPVLPAEHGTGVYFTPDDREKSQSPLAVALLSLEGVAGVFLG 125

Query: 58  YDFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            DFIT+   D+  W  ++P V G IM+ F  G P++    +                   
Sbjct: 126 TDFITISKHDEGGWTLMKPVVFGEIMDFFAEGKPVMLAEPVVTDTTILDDDD-------E 178

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVAN 174
           VV  IKE+L  RVRPAV  DGGDI ++G+      V + + G+C GCPS++ TLK GV  
Sbjct: 179 VVAMIKELLQERVRPAVQEDGGDIFYRGFDPNTGTVNVQLAGSCVGCPSSTVTLKNGVEK 238

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++PEV  +  V
Sbjct: 239 MLMHYIPEVTAVNAV 253


>gi|121702857|ref|XP_001269693.1| NifU-related protein [Aspergillus clavatus NRRL 1]
 gi|119397836|gb|EAW08267.1| NifU-related protein [Aspergillus clavatus NRRL 1]
          Length = 320

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/201 (37%), Positives = 115/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S     +F++ G+ 
Sbjct: 79  IFIQTENTPNPDALKFIPNHRVLPEEFPTSFLEYLSPRSTLAPPHPSPLAANLFNVEGVT 138

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD---MGSG 108
           SV++G DFITV K    +W H++P V  +I +   SG+ I++          +     S 
Sbjct: 139 SVFYGPDFITVTKSSDANWAHIKPEVFSLITQAVTSGETIVNTVEKSGEHAQEGGEQDSL 198

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            F E D  V+  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 199 SFNEEDDEVIGMIKELLETRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTL 258

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 259 KNGIESMLMHYIEEVQGVEQV 279


>gi|330922033|ref|XP_003299669.1| hypothetical protein PTT_10711 [Pyrenophora teres f. teres 0-1]
 gi|311326592|gb|EFQ92266.1| hypothetical protein PTT_10711 [Pyrenophora teres f. teres 0-1]
          Length = 243

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 82/202 (40%), Positives = 117/202 (57%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           MFIQTE TPN   LKF P Q VL E      + + N +     P  S    ++ +I G+ 
Sbjct: 1   MFIQTEPTPNADALKFNPNQRVLPENISSPFLEYLNPRSTLAPPHPSPLAAQLMNIDGVT 60

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL----DDMGS 107
           SV+FG D+ITV KD    W H++P V  +I E+  SG PI++       +      +  S
Sbjct: 61  SVFFGADYITVTKDSSTPWAHVKPEVFALINEYMTSGQPIVNTVAAKAGEQGQGGQENDS 120

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E+D  V+  IKE+L+ RVRPA+  DGGDI F+G+ DG V L +RGAC  C S++ T
Sbjct: 121 LAYDENDDEVIGMIKELLETRVRPAIQEDGGDIEFRGFNDGQVLLKLRGACRTCDSSTVT 180

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK ++ V
Sbjct: 181 LKNGIESMLMHYIEEVKGVQQV 202


>gi|213624625|gb|AAI71359.1| Zgc:110319 [Danio rerio]
          Length = 256

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 78/189 (41%), Positives = 114/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT
Sbjct: 54  ILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFIT 113

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V  
Sbjct: 114 LTKTDDDVEWTDIKRHAIEVIRKFFEGGEAITTGAAHAESSVT--------EDDDEIVSL 165

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++
Sbjct: 166 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYI 225

Query: 181 PEVKDIRTV 189
           PEV ++  V
Sbjct: 226 PEVDNVEQV 234


>gi|242802633|ref|XP_002484010.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
 gi|218717355|gb|EED16776.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
          Length = 321

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 118/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 81  IFIQTESTPNPDALKFLPNHRVLPENFPTPFLEYLSPRSTLAPPHPSPLAAKLLNVEGVS 140

Query: 53  SVYFGYDFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-----MG 106
           SV++G DFITV  +   +W H++P V  +I E   SG+PI++         D        
Sbjct: 141 SVFYGPDFITVTKQSDVNWAHIKPEVFSLITEVVTSGEPIVNTVERTSGAQDAQEGGGED 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLSYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EV+ ++ V
Sbjct: 261 TLKNGIESMLMHYIEEVQGVQQV 283


>gi|67516331|ref|XP_658051.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4]
 gi|40747390|gb|EAA66546.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4]
 gi|259489306|tpe|CBF89467.1| TPA: NifU-related protein (AFU_orthologue; AFUA_1G04680)
           [Aspergillus nidulans FGSC A4]
          Length = 326

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 79/201 (39%), Positives = 116/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKFIP   VL E      + + + +     P  S     +F++ G+ 
Sbjct: 89  IFIQTESTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSTLAANLFNVEGVQ 148

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP---IIHNGGLGDMKLDDMGSG 108
           SV+FG DFITV K    +W H++P V  +I +   SG+P    +   G    K  +  S 
Sbjct: 149 SVFFGTDFITVTKASDTNWAHIKPEVFSLITQAVTSGEPIVNTVEKSGASGQKGGEEDSL 208

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 209 SYNEEDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCDSSTVTL 268

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 269 RNGIESMLMHYIEEVQGVEQV 289


>gi|42520881|ref|NP_966796.1| NifU domain-containing protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410621|gb|AAS14730.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 191

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 90/189 (47%), Positives = 128/189 (67%), Gaps = 7/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFEILNEGETADFSNANEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D  +W+ L+  VL  IM HF S         L   +++D     F ++D  +V
Sbjct: 65  FISVTKLDGINWDILKVEVLTTIMNHFTS-----GGKALDKEEVNDPDEEFFDKNDIEIV 119

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 120 NRIKELMESHIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 179

Query: 179 FVPEVKDIR 187
            +PE+  I 
Sbjct: 180 HIPEIAGIE 188


>gi|145507614|ref|XP_001439762.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124406957|emb|CAK72365.1| unnamed protein product [Paramecium tetraurelia]
          Length = 207

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 79/192 (41%), Positives = 118/192 (61%), Gaps = 5/192 (2%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQ + TPNP  LKFIP G+ V++ G   FS  +EA+ SPLA ++F I G+  V++G D
Sbjct: 10  LFIQAKPTPNPNFLKFIPDGKQVMLNGTYDFSRPREAKCSPLAQKLFMIDGVNRVFYGKD 69

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +I++   ++  WE L+P +   IMEH+           + D   ++       E DS  +
Sbjct: 70  YISISKNEESKWEELKPQIFEQIMEHYQLDAEGKEKQLIIDGYSEN-QDTQIKEEDSEAI 128

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
           Q IKE++D R+RP V  DGGDIVF+ + +   IV L M+G+C+GCPS+S TLK G+  +L
Sbjct: 129 QLIKEIIDTRIRPTVQEDGGDIVFRDFDEQNGIVHLYMKGSCAGCPSSSITLKNGIERML 188

Query: 177 NHFVPEVKDIRT 188
            H+V EVK++  
Sbjct: 189 CHYVAEVKEVVA 200


>gi|58699011|ref|ZP_00373859.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630807|ref|YP_002727598.1| NifU domain protein [Wolbachia sp. wRi]
 gi|58534475|gb|EAL58626.1| NifU domain protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592788|gb|ACN95807.1| NifU domain protein [Wolbachia sp. wRi]
          Length = 194

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 90/189 (47%), Positives = 130/189 (68%), Gaps = 4/189 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP TLKF+PG  +L EG    FSNA E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIEETPNPNTLKFLPGFEILNEGETTDFSNANEIKNSKLAANLFQIEHVVRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    +W+ L+  +L  IM+HF SG   +   G+ D  + D     F ++D  +V
Sbjct: 65  FISVTKLGGINWDTLKVEILTTIMDHFTSGGKALDKEGVNDNNIPDEE--FFDKNDIEIV 122

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RIKE++++ ++PAVA+DGGDI F+GY+DGIV++ ++GACSGCPSA+ TLK GV N+L++
Sbjct: 123 NRIKELMESYIKPAVAQDGGDIKFRGYKDGIVYVELQGACSGCPSAAITLKQGVQNMLSY 182

Query: 179 FVPEVKDIR 187
            +PE+  I 
Sbjct: 183 HIPEIAGIE 191


>gi|198427432|ref|XP_002130447.1| PREDICTED: similar to NFU1 iron-sulfur cluster scaffold homolog (S.
           cerevisiae) [Ciona intestinalis]
          Length = 284

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/193 (39%), Positives = 113/193 (58%), Gaps = 10/193 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT +TPNP  LKF+PG  VL  G   F + K +  SPLA R+F I G+ +V+ G DF
Sbjct: 72  MFIQTFETPNPNCLKFVPGVPVLGTGTADFPDWKNSYKSPLAKRLFGIEGVKAVFLGPDF 131

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV +  ++  W+ L+P +  ++M+ F +G+  +                D       +V
Sbjct: 132 LTVTRQDEEVQWKVLKPEIYSLVMDFFTAGNIPVLTDEGPSADTVVDEDDDE------IV 185

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             +KE+LD R+RP V  DGGDI+FKG+      V L ++G+CS CPS+S TLK G+ N+L
Sbjct: 186 AMVKELLDTRIRPTVMEDGGDIIFKGFDPETGSVKLKLQGSCSNCPSSSVTLKSGIENML 245

Query: 177 NHFVPEVKDIRTV 189
             ++PEV ++  V
Sbjct: 246 KFYIPEVMEVEEV 258


>gi|325303172|tpg|DAA34414.1| TPA_inf: NifU-like domain-containing protein [Amblyomma variegatum]
          Length = 217

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/175 (43%), Positives = 111/175 (63%), Gaps = 5/175 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP  LKF+P   VL +G   F N   A+ SPLA  +F + G+ +V+ G DF
Sbjct: 46  MFIQTQDTPNPNCLKFLPNAKVLEQGTRDFPNIGSAKNSPLARHLFRVEGVKAVFLGPDF 105

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K  D+ +W+ ++P +   IM+ F +G P++ +G       +D       E DS  V
Sbjct: 106 ITVTKVDDETEWKVIKPHIFAAIMDFFTTGLPVLDDGSASTQVSEDTQPR---EGDSETV 162

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
             IKE+++ R+RP V  DGGDI++ G+ DG+V L ++G+C+GCPS+S TLK G+ 
Sbjct: 163 LAIKELIETRIRPTVQEDGGDILYMGFEDGVVKLKLQGSCTGCPSSSVTLKAGIQ 217


>gi|322696539|gb|EFY88330.1| NifU-like protein [Metarhizium acridum CQMa 102]
          Length = 297

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/199 (40%), Positives = 117/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +     P  S    ++ +I GI 
Sbjct: 73  IFIQTENTPNPDALKFLPNHRVVPEEINTPFIEYLNPRSTISPPYPSPLAAKLMNIDGIT 132

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD-DMGSGDF 110
           SV++G DFITV K    +W H+RP +  +I E   SG+ I+      +   D +  S  +
Sbjct: 133 SVFYGADFITVTKAGDANWAHIRPEIFALITEAITSGETIVSVAERKEGDEDIEEDSLAY 192

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E+DS VV  IKE+L+ R+RPA+  DGGDI ++G+ DG V L +RGAC  C S++ TLK 
Sbjct: 193 NENDSEVVGMIKELLETRIRPAIQEDGGDIEYRGFDDGYVKLKLRGACRTCDSSTVTLKN 252

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+  +L H++ EVK +  +
Sbjct: 253 GIEGMLMHYIEEVKGVHQI 271


>gi|302927119|ref|XP_003054431.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735372|gb|EEU48718.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 309

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 117/202 (57%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   V+ EG     I + N +     P  S    ++ +I G+ 
Sbjct: 76  IFIQTEGTPNPDALKFLPNHRVVPEGISTPFIEYLNPRATISPPHPSPLAAKLMNIDGVT 135

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLD---DMGSG 108
           SV++G DFITV K    +W H+RP +  +I E   SG+ +++     + +     +  S 
Sbjct: 136 SVFYGADFITVTKAADANWAHIRPEIFALITEAITSGETLVNVAERREGETHPEAEEDSL 195

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASET 167
            + E DS VV  IKE+L+ R+RPA+  DGGDI F+G+ D   V L +RGAC  C S++ T
Sbjct: 196 AYNEDDSEVVGMIKELLETRIRPAIQEDGGDIDFRGFDDEGYVHLRLRGACRTCDSSTVT 255

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK ++ V
Sbjct: 256 LKNGIEGMLMHYIEEVKGVKQV 277


>gi|307215410|gb|EFN90079.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 265

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 89/192 (46%), Positives = 117/192 (60%), Gaps = 13/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F NAK+A  SPLA  +F I G+ +++FG D
Sbjct: 56  MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPNAKDAYCSPLAKMLFRIEGVKAIFFGPD 115

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P +   IM+ F SG PI+    L                D  V
Sbjct: 116 FITVTKLDEDIEWKLLKPEIFATIMDFFASGLPIMDESQLA-------ADTQISTDDDEV 168

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGD    G+ +GIV L M+G+C+ CPS+  TL+ GV N++ 
Sbjct: 169 VQMIKELLDTRIRPTVQEDGGD---IGFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNMMQ 225

Query: 178 HFVPEVKDIRTV 189
            ++PEV  I  V
Sbjct: 226 FYIPEVLGIIQV 237


>gi|4836948|gb|AAD30650.1|AC006085_23 Similar to human CGI-33 protein [Arabidopsis thaliana]
          Length = 304

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 83/220 (37%), Positives = 117/220 (53%), Gaps = 37/220 (16%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIP----------- 49
           MFIQT+ TPNP++L F PG+ V+  G+  F N++ A  SPLA  IF+I            
Sbjct: 75  MFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIFAIDGIPRLLLQHTI 134

Query: 50  ------------------GIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP 90
                             G+  V++G DF+TV K D   W+ L+P +  ++M+ + SG P
Sbjct: 135 VSSSYNPCFVTKIVSVDAGVVRVFYGSDFVTVTKSDDVTWDILKPDIFAVVMDFYSSGQP 194

Query: 91  IIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI- 149
           +  +      K          E DS  V  IKE+L+ R+RP+V  DGGDI + G+     
Sbjct: 195 LFLDSQATAAK-----DTAIHEDDSETVAMIKELLETRIRPSVQDDGGDIEYCGFDTETG 249

Query: 150 -VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
            V L M+GACSGCPS+S TLK G+ N+L H+V EVK +  
Sbjct: 250 IVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVEQ 289


>gi|225711844|gb|ACO11768.1| NFU1 iron-sulfur cluster scaffold homolog [Lepeophtheirus salmonis]
          Length = 238

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/194 (41%), Positives = 116/194 (59%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      I F     A  SPLA  +F + G+  V+FG 
Sbjct: 29  MYIRTQETPNPQSLKFLPGVPVLETAGSTIDFPQPSAAFCSPLAKLLFRVEGVKGVFFGP 88

Query: 59  DFITVGKD---QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K+     +W+ ++P +   IM+ F SG PI++               +  E D 
Sbjct: 89  DFITITKEEEVNAEWKLMKPLIYATIMDFFASGLPIVNEDA------KPHSDTEIHEDDD 142

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDIVF G+ DG+V L M+G+C+ CPS+  TLK GV N+
Sbjct: 143 DTVAMIKELLDSRIRPTVQEDGGDIVFMGFDDGVVKLKMQGSCTSCPSSIVTLKNGVQNM 202

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 203 LQFYIPEVLEVEQI 216


>gi|17541876|ref|NP_501917.1| LiPid Depleted family member (lpd-8) [Caenorhabditis elegans]
 gi|3879150|emb|CAA94609.1| C. elegans protein R10H10.1, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 222

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 82/193 (42%), Positives = 120/193 (62%), Gaps = 13/193 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+IQ ++TPNP +LKF+PGQ +L +      FS+A  A+ SPLA ++  + G+  V+FG 
Sbjct: 16  MYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAIKLLRVDGVKRVFFGE 75

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DF+TV K  +  DW  LRP +   I +H  +G P+I+       ++         E D  
Sbjct: 76  DFVTVTKSDETVDWALLRPEIFSTIADHIQTGKPVINEAATVSDQV---------EEDDE 126

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+L+ R+RP V  DGGDI + G+ DG+V L M+G+C+GCPS+  TLK G+ N+L
Sbjct: 127 VVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKNGIENML 186

Query: 177 NHFVPEVKDIRTV 189
             +VPEVK++  V
Sbjct: 187 TFYVPEVKEVIEV 199


>gi|225710000|gb|ACO10846.1| NFU1 iron-sulfur cluster scaffold homolog [Caligus rogercresseyi]
          Length = 237

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/194 (40%), Positives = 116/194 (59%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           M+I+T++TPNP +LKF+PG  VL      + F     A  SPLA  +F + G+  V+FG 
Sbjct: 27  MYIRTQETPNPQSLKFLPGVRVLETAGSTLDFPTPSAAYCSPLAKLLFRVDGVKGVFFGQ 86

Query: 59  DFITVGKDQ---YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           DFIT+ K++    +W+ ++P V   +M+ F SG PI++               +  E   
Sbjct: 87  DFITITKEEDSEVEWKVIKPEVYATLMDFFASGLPIVNEDA------KPHSDTEIHEDGD 140

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V  IKE+LD+R+RP V  DGGDI+F G+ DGIV L M+G+C+ CPS+  TLK GV N+
Sbjct: 141 DTVAMIKELLDSRIRPTVQEDGGDIIFMGFEDGIVKLKMQGSCTSCPSSIVTLKNGVQNM 200

Query: 176 LNHFVPEVKDIRTV 189
           L  ++PEV ++  +
Sbjct: 201 LQFYIPEVIEVEQI 214


>gi|41351250|gb|AAH65889.1| Zgc:110319 protein [Danio rerio]
          Length = 255

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/189 (41%), Positives = 114/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT
Sbjct: 53  ILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFIT 112

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V  
Sbjct: 113 LTKTDDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSVT--------EDDDEIVSL 164

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++
Sbjct: 165 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYI 224

Query: 181 PEVKDIRTV 189
           PEV ++  V
Sbjct: 225 PEVDNVEQV 233


>gi|328872467|gb|EGG20834.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium fasciculatum]
          Length = 313

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 75/190 (39%), Positives = 116/190 (61%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE TPNP +LKF+PG  V+ +G + F + K ++ISPLA+ IF + G+  V+FG  F
Sbjct: 104 IFIQTETTPNPDSLKFLPGVEVMEQGTVDFPDFKSSQISPLANAIFKLDGVNRVFFGPSF 163

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K  + +W  L+P V G I+  + SG P++      +           +  D  VV 
Sbjct: 164 ISVNKFTETEWSILKPQVYGAIINFYHSGQPLLLEKPSAEN-----NDTLILPEDDEVVA 218

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+++ R+RP +  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H+
Sbjct: 219 MIKELIETRIRPTLLDDGGNIQYLGFKDGIVLVKLQGTCSSCSSSQATLKGGIERMLMHW 278

Query: 180 VPEVKDIRTV 189
           + EV+ I  V
Sbjct: 279 ISEVRGIMAV 288


>gi|238486392|ref|XP_002374434.1| NifU-related protein [Aspergillus flavus NRRL3357]
 gi|317144282|ref|XP_003189583.1| nifU-related protein [Aspergillus oryzae RIB40]
 gi|220699313|gb|EED55652.1| NifU-related protein [Aspergillus flavus NRRL3357]
          Length = 329

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 116/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S     +F++ G+ 
Sbjct: 88  IFIQTENTPNPDALKFIPNHRVLPEDFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVT 147

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD---MGSG 108
           S++FG +FITV K    +W H++P +  +I +   SG+PI++          +     S 
Sbjct: 148 SIFFGPEFITVTKASDANWAHIKPEIFSLITQAVTSGEPIVNTVAKSGENAQEGGEEESL 207

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+L+ R+RPA+  DGGDI  +G+ +GIV L +RGAC  C S++ TL
Sbjct: 208 SYNEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGFENGIVMLKLRGACRTCDSSTVTL 267

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+ ++L H++ EV+ +  V
Sbjct: 268 KNGIESMLMHYIEEVQGVEQV 288


>gi|88608783|ref|YP_506689.1| NifU-like domain-containing protein [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600952|gb|ABD46420.1| NifU-like domain protein [Neorickettsia sennetsu str. Miyayama]
          Length = 180

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 77/190 (40%), Positives = 118/190 (62%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF PG  +L  G   F    +A    L   ++ I G+  V  G DF
Sbjct: 1   MFIQTEHTPNPNVLKFFPGVKILDSGTADFVTFSDASGHKLPEMLWEIQGVCGVMLGVDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K +  +W+ L+P + G+++E+F +G   +      +            E    V +
Sbjct: 61  VSVSKTEDAEWDVLKPQIFGVLVEYFTTGSDFVRPVTEDEEV----------ECTDEVSK 110

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D +VRP+V  DGG+IVFKGY+DGIV+L ++GAC+GCPSAS TLK G+ N+L ++
Sbjct: 111 KIQEIIDTKVRPSVIEDGGNIVFKGYKDGIVYLKLQGACAGCPSASVTLKDGIENLLQYY 170

Query: 180 VPEVKDIRTV 189
           +PEV++++ V
Sbjct: 171 IPEVREVQQV 180


>gi|324120927|ref|NP_001018093.2| NFU1 iron-sulfur cluster scaffold homolog [Danio rerio]
 gi|220678983|emb|CAX14770.1| novel protein similar to HIRA interacting protein 5 (hirip5,
           zgc:110319) [Danio rerio]
          Length = 256

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 78/189 (41%), Positives = 114/189 (60%), Gaps = 10/189 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I T+DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT
Sbjct: 54  ILTQDTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFIT 113

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + K  D  +W  ++   + +I + F  G+ I       +  +         E D  +V  
Sbjct: 114 LTKTDDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSVT--------EDDDEIVSL 165

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IKE+LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++
Sbjct: 166 IKELLDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYI 225

Query: 181 PEVKDIRTV 189
           PEV ++  V
Sbjct: 226 PEVDNVEQV 234


>gi|226292348|gb|EEH47768.1| HIRA interacting protein [Paracoccidioides brasiliensis Pb18]
          Length = 317

 Score =  178 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 118/199 (59%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI+  +      K  +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGSKAQEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 202 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVNLKLRGACRTCDSSTVTLKN 261

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 262 GIESMLMHYIEEVKGVNQV 280


>gi|212540194|ref|XP_002150252.1| NifU-related protein [Penicillium marneffei ATCC 18224]
 gi|210067551|gb|EEA21643.1| NifU-related protein [Penicillium marneffei ATCC 18224]
          Length = 321

 Score =  178 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 79/203 (38%), Positives = 118/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E      + + + +     P  S    ++ +I GI+
Sbjct: 81  IFIQTESTPNPDALKFLPNNRVLPENFSTPFLEYLSPRSTLAPPHPSPLAAKLLNIEGIS 140

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-----MG 106
           SV++G DFITV K    +W H++P V  +I E   SG+PI++         D        
Sbjct: 141 SVFYGPDFITVTKSSDVNWAHVKPEVFSLITEVVTSGEPIVNTVEHTSGAQDAQEGGGED 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLGYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EV+ ++ V
Sbjct: 261 TLKNGIESMLMHYIEEVQGVQQV 283


>gi|154291187|ref|XP_001546179.1| NifU-like protein [Botryotinia fuckeliana B05.10]
 gi|150847081|gb|EDN22274.1| NifU-like protein [Botryotinia fuckeliana B05.10]
          Length = 313

 Score =  178 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 76/200 (38%), Positives = 113/200 (56%), Gaps = 11/200 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVV----LVEGAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTEDTPNP  LKF+P   +    +    I + N +     P  S     + +I G+ 
Sbjct: 76  IFIQTEDTPNPDALKFLPNHPIIPQDVNSPFIEYLNPRSTLAPPYPSPLAASLMNIDGVK 135

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP--IIHNGGLGDMKLDDMGSGD 109
           SV++G +FITV K +  +W H++P V  +I E   SG     I        + ++  S  
Sbjct: 136 SVFYGANFITVTKVEDANWAHIKPEVFSLITEAVTSGAQIVNITERTGASGEPEEEDSLA 195

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           + E D  VV  IKE+L+ R+RPA+  DGGDI ++G+ DG+V L +RGAC  C S++ TLK
Sbjct: 196 YNEDDPEVVGMIKELLETRIRPAIQEDGGDIDYRGFEDGLVKLKLRGACRTCDSSTVTLK 255

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+  +L H++ EVK +  V
Sbjct: 256 NGIEGMLMHYIEEVKGVVQV 275


>gi|225680672|gb|EEH18956.1| HIRA-interacting protein [Paracoccidioides brasiliensis Pb03]
          Length = 317

 Score =  178 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 118/199 (59%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI+  +      K  +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGSKAQEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 202 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVNLKLRGACRTCDSSTVTLKN 261

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 262 GIESMLMHYIEEVKGVNQV 280


>gi|254797154|ref|YP_003081992.1| hira-interacting protein 5 [Neorickettsia risticii str. Illinois]
 gi|254590399|gb|ACT69761.1| hira-interacting protein 5 [Neorickettsia risticii str. Illinois]
          Length = 180

 Score =  177 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 77/190 (40%), Positives = 120/190 (63%), Gaps = 11/190 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP  LKF PG  +L  G   F  A +A  + L   ++ I G++ V  G DF
Sbjct: 1   MFIQTEHTPNPNVLKFFPGVNILDSGIADFVTASDASGNKLPEMLWEIQGVSGVMLGVDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K +  +W+ L+P +  +++E+F +G   +      +            E    V +
Sbjct: 61  VSVSKTEDAEWDVLKPQIFSVLVEYFTTGSDFVRPVTEDEEV----------ECTDEVSK 110

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I+E++D +VRP+V  DGG++VFKGY+DGIV+L ++GAC+GCPSAS TLK G+ N+L ++
Sbjct: 111 KIREIIDTKVRPSVIEDGGNVVFKGYKDGIVYLKLQGACAGCPSASVTLKDGIENLLQYY 170

Query: 180 VPEVKDIRTV 189
           VPEV++++ V
Sbjct: 171 VPEVREVQQV 180


>gi|115390869|ref|XP_001212939.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624]
 gi|114193863|gb|EAU35563.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624]
          Length = 323

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 115/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S     + ++ G+ 
Sbjct: 86  IFIQTENTPNPDALKFIPNHRVLPEDFPTTFLEYLSPRSTLAPPHPSPLAANLLNVEGVT 145

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD---MGSG 108
           SV++G DFITV K    +W H++P V  +I +   SG+ +++          +     S 
Sbjct: 146 SVFYGPDFITVTKASDANWAHIKPEVFSLITQAVTSGEALVNTVAKTGEHAQEGGEEESL 205

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E D  VV  IKE+LD R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 206 GYNEEDDEVVSMIKELLDTRIRPAIQEDGGDIEFRGFENGIVMLKLRGACRTCDSSTVTL 265

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 266 RNGIESMLMHYIEEVQGVEQV 286


>gi|324510498|gb|ADY44390.1| NFU1 iron-sulfur cluster scaffold [Ascaris suum]
          Length = 213

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 126/193 (65%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ ++TPNP TLKF+PG+ VL  G   + F++   A+ SPLA ++F + G+ S++FG 
Sbjct: 1   MFIQVQETPNPLTLKFLPGEPVLGPGRGTMDFTSVSAAKRSPLALQLFRVDGVKSIFFGE 60

Query: 59  DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           DFITV K  ++ DW  ++P +   IM+   +G  I+++G + D  +D          D  
Sbjct: 61  DFITVTKADEETDWAVMKPEIFATIMDFLQTGKAIVNDGEVPDGPMD----TMIHPEDDD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L++RV+P V  DGGDI++KG+ DGIV L ++G+C+GCPS+  TLK G+ N+L
Sbjct: 117 TVAMIKELLESRVKPMVQEDGGDIIYKGFHDGIVHLKLKGSCTGCPSSLVTLKSGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEV D+  V
Sbjct: 177 QFYVPEVVDVIEV 189


>gi|255940800|ref|XP_002561169.1| Pc16g08500 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211585792|emb|CAP93520.1| Pc16g08500 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 320

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 79/200 (39%), Positives = 115/200 (57%), Gaps = 11/200 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S    ++  + G+ 
Sbjct: 84  IFIQTENTPNPDALKFIPNHRVLPEDFPSTFLEYMSPRSTLAPPHPSPLAAKLLDVEGVT 143

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH--NGGLGDMKLDDMGSGD 109
           SV++G DFITV K    +W H++P V  +I +   SG+ I+    G +   +     S  
Sbjct: 144 SVFYGTDFITVTKGSDANWAHIKPEVFSIITQAVTSGETIVTTIEGAVDGEQESGEDSLS 203

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169
           F E D  VV  IKE+L+ R+RPA+  DGGDI  KG+ +GIV L +RGAC  C S++ TLK
Sbjct: 204 FNEDDDEVVSMIKELLETRIRPAIQEDGGDIELKGFENGIVMLKLRGACRTCDSSTVTLK 263

Query: 170 YGVANILNHFVPEVKDIRTV 189
            G+ ++L H++ EVK +  V
Sbjct: 264 NGIESMLMHYIEEVKGVEQV 283


>gi|312070286|ref|XP_003138076.1| hypothetical protein LOAG_02490 [Loa loa]
 gi|307766755|gb|EFO25989.1| hypothetical protein LOAG_02490 [Loa loa]
          Length = 220

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ  +TPNPATLKFIPG++++ +G   + F N   A+ SPLA  +F I G+ SV+FG 
Sbjct: 1   MFIQVHETPNPATLKFIPGRMIMGKGRGTLDFGNFLSAKRSPLAMELFRINGVKSVFFGE 60

Query: 59  DFITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           D++T+    +  DW  L+P +  ++M++  S  PII  G +     D          DS 
Sbjct: 61  DYVTITKQNEVDDWALLKPEIFAVLMDYLQSEKPIISEGEMPKGPEDTE----IHPEDSD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L+ R++P V  DGGD+++KG+ DG+V L M+G+C+GCPS+S TL++G+ N+L
Sbjct: 117 TVAMIKELLECRIKPMVQEDGGDVIYKGFHDGVVHLKMQGSCTGCPSSSVTLQFGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEVKD+  V
Sbjct: 177 QFYVPEVKDVLEV 189


>gi|145228927|ref|XP_001388772.1| nifU-related protein [Aspergillus niger CBS 513.88]
 gi|134054866|emb|CAK36880.1| unnamed protein product [Aspergillus niger]
          Length = 330

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 115/201 (57%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKFIP   VL E      + + + +     P  S     + ++ G+ 
Sbjct: 89  IFIQTENTPNPDALKFIPNHRVLPENFPTTFLEYLSPRSTLAPPHPSPLAASLLNVDGVT 148

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGD---PIIHNGGLGDMKLDDMGSG 108
           SV++G DFITV K    +W H++P +  +I +   SG+     +   G    +  +  S 
Sbjct: 149 SVFYGPDFITVTKATDSNWAHIKPEIFSLITQAVTSGEAIVNTVAKTGESGQEGGESESL 208

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
            + E +  V+  IKE+LD R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ TL
Sbjct: 209 AYEEEEDEVIGMIKELLDTRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTVTL 268

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           + G+ ++L H++ EV+ +  V
Sbjct: 269 RNGIESMLMHYIEEVQGVEQV 289


>gi|210075172|ref|XP_500339.2| YALI0B00264p [Yarrowia lipolytica]
 gi|199425114|emb|CAG82553.2| YALI0B00264p [Yarrowia lipolytica]
          Length = 263

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/192 (40%), Positives = 110/192 (57%), Gaps = 10/192 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT  TPN   LKF+P   +L EG  + F++ +EA  SPLA ++F + G+ SV FG D
Sbjct: 46  MFIQTASTPNEDALKFLPSVQILPEGHTVEFTSGREAHSSPLAKKLFGVDGVRSVMFGSD 105

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K     W  L+P V  ++ EH  +G PI+  G                + DS VV
Sbjct: 106 FITVEKAQDTHWNTLKPEVFSILTEHITAGAPIVMEGTTAA------EDTAPCDDDSEVV 159

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
             IKE+++ R+RPA+  DGGDI F+G+ +    V L + GAC  C S++ TLK G+ ++L
Sbjct: 160 SMIKELIETRIRPAIQEDGGDIAFRGFDEDTGVVHLKLLGACRSCDSSAVTLKNGIESML 219

Query: 177 NHFVPEVKDIRT 188
            H+V EV  +  
Sbjct: 220 MHYVEEVTGVEQ 231


>gi|145605625|ref|XP_370496.2| NifU-related protein [Magnaporthe oryzae 70-15]
 gi|145013431|gb|EDJ98072.1| NifU-related protein [Magnaporthe oryzae 70-15]
          Length = 319

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 114/205 (55%), Gaps = 16/205 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF+P   VL E      I + N +     P  S    ++ +I G+ 
Sbjct: 74  IFIQTEPTPNSDALKFLPNHRVLPEDISTPFIEYLNPRSTIAPPYPSPLAAQLMNIDGVQ 133

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP-------IIHNGGLGDMKLDD 104
           SV++G DFITV K    +W H+RP +  +I E   SG            +G  G     +
Sbjct: 134 SVFYGADFITVTKASDANWAHIRPEIFSLITEAITSGQKIVNIVERTDASGEDGQETSGE 193

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
           + S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC  C S+
Sbjct: 194 VDSLSYNENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGNVLLKLRGACRTCDSS 253

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
           + TLK G+  +L H++ EV+ +  V
Sbjct: 254 TVTLKNGIEGMLMHYIEEVQGVIQV 278


>gi|332028326|gb|EGI68373.1| NFU1 iron-sulfur cluster scaffold-like protein, mitochondrial
           [Acromyrmex echinatior]
          Length = 211

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 12/192 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL EG    F +AK+A  SPLA  +F I G+ +++FG D
Sbjct: 1   MFIQTQDTPNPNSLKFIPGVSVLGEGCTKDFPSAKDAYCSPLAKMLFRIEGVKAIFFGPD 60

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FITV K  +  +W+ L+P +   IM+ F SG P++                     D  V
Sbjct: 61  FITVTKVDEDVEWKLLKPEIFATIMDFFASGLPVMDEAS------QPAADTQINAEDDEV 114

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           VQ IKE+LD R+RP V  DGGD    G+ +GIV L M+G+C+ CPS+  TL+ GV N++ 
Sbjct: 115 VQMIKELLDTRIRPTVQEDGGD---IGFEEGIVKLKMQGSCTNCPSSVVTLRNGVQNMMQ 171

Query: 178 HFVPEVKDIRTV 189
            ++PEV  +  V
Sbjct: 172 FYIPEVLGVIQV 183


>gi|330799706|ref|XP_003287883.1| hypothetical protein DICPUDRAFT_20344 [Dictyostelium purpureum]
 gi|325082086|gb|EGC35580.1| hypothetical protein DICPUDRAFT_20344 [Dictyostelium purpureum]
          Length = 203

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 79/191 (41%), Positives = 117/191 (61%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE TPNP +LKFIPG  VL +G  + F + K +++SPLA+ +F I G+  V+F  D
Sbjct: 4   IFIQTETTPNPDSLKFIPGVEVLSDGQIMDFPDFKSSQVSPLANSLFKIEGVNRVFFSSD 63

Query: 60  FITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V    + DW  L+P + G I++ + SG PI     L +   D       +  DS VV
Sbjct: 64  FISVNKYPEQDWAALKPEIYGAIIDFYNSGSPI-----LSEHSSDINTDTTILPEDSEVV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGG+I + G+ DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 119 AMIKELIETRIRPTVLEDGGNIKYMGFADGIVLVQLQGTCSSCSSSQATLKGGIERMLMH 178

Query: 179 FVPEVKDIRTV 189
           ++ EVK +  +
Sbjct: 179 WIAEVKGVVAI 189


>gi|327348799|gb|EGE77656.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis ATCC 18188]
          Length = 318

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 202 NEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 261

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK++  V
Sbjct: 262 GIESMLMHYIEEVKEVNHV 280


>gi|111035797|emb|CAL29424.1| NifU-related protein [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 194

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 86/191 (45%), Positives = 130/191 (68%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ ++TPN  TLKF+PG ++L EG  + FS+A E + S LA+ +F I  +  V+FG+D
Sbjct: 5   MFIQIKETPNLNTLKFLPGFMILNEGETVDFSSANETKNSKLAANLFRIEHVIRVFFGHD 64

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K D  +W  L+  VL  IM+HF S    +   G  D   D +    F +SD+ +V
Sbjct: 65  FISVTKSDDINWNTLKVEVLTTIMDHFASSGKALDREGTNDN--DILEEEFFDKSDTEIV 122

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
            RI+E++++ ++PAV +DGGDI F+GY++GIV++ ++GACSGCPSA+ TLK G+ N+L +
Sbjct: 123 SRIRELMESYIKPAVVQDGGDIKFRGYKNGIVYVELQGACSGCPSATITLKQGIQNMLCY 182

Query: 179 FVPEVKDIRTV 189
            +PE+  I T+
Sbjct: 183 HIPEILGIDTI 193


>gi|242011992|ref|XP_002426727.1| HIRA-interacting protein, putative [Pediculus humanus corporis]
 gi|212510898|gb|EEB13989.1| HIRA-interacting protein, putative [Pediculus humanus corporis]
          Length = 216

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 79/192 (41%), Positives = 110/192 (57%), Gaps = 20/192 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQT+DTPNP +LKFIPG  VL  G    F NA  A  SPL   +F I G+ SV+FG D
Sbjct: 14  MFIQTQDTPNPNSLKFIPGVKVLENGKTKDFPNAASALCSPLGKSLFRINGVKSVFFGPD 73

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  +   W+ + P +   IM+ F SG PI+         + +             
Sbjct: 74  FITITKQDEDVSWKLINPEIFATIMDFFSSGLPILTENESKSDFVKE------------- 120

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
                E+L+ R+RP V  DGGD+VFKG+ +GIV L + G+C+ CPS+  TLK G+ N+L 
Sbjct: 121 ----NELLETRIRPTVQEDGGDVVFKGFENGIVKLKLLGSCTTCPSSIVTLKNGIQNMLQ 176

Query: 178 HFVPEVKDIRTV 189
            ++PEV ++  +
Sbjct: 177 FYIPEVLEVEQI 188


>gi|261194942|ref|XP_002623875.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis SLH14081]
 gi|239587747|gb|EEQ70390.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis SLH14081]
          Length = 318

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 202 NEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 261

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK++  V
Sbjct: 262 GIESMLMHYIEEVKEVNHV 280


>gi|239610759|gb|EEQ87746.1| HIRA-interacting protein 5 [Ajellomyces dermatitidis ER-3]
          Length = 318

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGGPPPEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 202 NEDDDEVVSMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 261

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK++  V
Sbjct: 262 GIESMLMHYIEEVKEVNHV 280


>gi|148284929|ref|YP_001249019.1| hypothetical protein OTBS_1710 [Orientia tsutsugamushi str.
           Boryong]
 gi|189184851|ref|YP_001938636.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda]
 gi|146740368|emb|CAM80805.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
 gi|189181622|dbj|BAG41402.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda]
          Length = 182

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 80/190 (42%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP +LKF P Q +     +HFS  +E   S LA ++FSI  +  V+FG DF
Sbjct: 1   MFIQTQQTPNPNSLKFFPDQKISPGNPVHFSTREECTHSILARKLFSIENVKEVFFGEDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K     WE ++P +L M+M+HF++G P+  +                  + S + +
Sbjct: 61  ITVTKVSDGSWEVIKPEILTMLMDHFVAGLPVFESEAEKKNIEQA--------NLSEIEK 112

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I E+++ +VRPAVA DGGDI +  ++DGIV L MRGAC GCPS++ TLK G+ ++L ++
Sbjct: 113 QIIEIINTKVRPAVAMDGGDIEYHSFKDGIVKLQMRGACVGCPSSTMTLKQGIESLLKYY 172

Query: 180 VPEVKDIRTV 189
           +PEV  +  V
Sbjct: 173 IPEVVSVEQV 182


>gi|170593029|ref|XP_001901267.1| r10h10-like protein TO42 [Brugia malayi]
 gi|158591334|gb|EDP29947.1| r10h10-like protein TO42, putative [Brugia malayi]
          Length = 220

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 84/193 (43%), Positives = 126/193 (65%), Gaps = 8/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG--AIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           MFIQ ++TPNPATLKFIPG++++ +G   + F N   A+ SPLA  +F I GI SV+FG 
Sbjct: 1   MFIQVQETPNPATLKFIPGKMIMGKGKGTLDFGNFMSAKKSPLAMELFRINGIKSVFFGE 60

Query: 59  DFITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
           D++T+   K+  DW  L+P +  ++M++  S  PI++   +     D          DS 
Sbjct: 61  DYVTITKQKEIDDWTLLKPEIFAVLMDYLQSEKPIVNESEMLKGPEDTE----IHPEDSD 116

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            V  IKE+L+ R++P V  DGGD+++KG+ DG+V L M+G+C+GCPS+S TL+ G+ N+L
Sbjct: 117 TVAMIKELLECRIKPMVQEDGGDVIYKGFLDGVVHLKMQGSCTGCPSSSVTLQSGIKNML 176

Query: 177 NHFVPEVKDIRTV 189
             +VPEVKD+  V
Sbjct: 177 QFYVPEVKDVMEV 189


>gi|281208054|gb|EFA82232.1| NIF system FeS cluster assembly domain-containing protein
           [Polysphondylium pallidum PN500]
          Length = 307

 Score =  173 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE+TPNP +LKF+PG  V+  G  I F + K ++ISPLA+ IF + G+  V++G D
Sbjct: 96  LFIQTENTPNPDSLKFVPGIEVMPPGKTIDFPDFKSSQISPLANAIFKLDGVNRVFYGPD 155

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K  +++W  L+P V G I++ + S  P+     L +   ++      +  D   V
Sbjct: 156 FISVNKFPEHEWAILKPQVFGAIIDFYHSDKPL-----LSETPTNENSDTLILPEDDETV 210

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ RVRP +  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 211 AMIKELIETRVRPTLLDDGGNIQYLGFKDGIVLVKLQGTCSSCSSSQATLKGGIERMLMH 270

Query: 179 FVPEVKDIRTV 189
           ++ EV+ I  V
Sbjct: 271 WISEVRGIMAV 281


>gi|46107542|ref|XP_380830.1| hypothetical protein FG00654.1 [Gibberella zeae PH-1]
          Length = 304

 Score =  173 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/202 (38%), Positives = 117/202 (57%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPNP  LKF+P   V+ E      I + N +     P  S    ++ +I G+ 
Sbjct: 74  IFIQTENTPNPDALKFLPNHRVVPEEFSTPFIEYLNPRATISPPHPSPLAAKLMNIDGVT 133

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK---LDDMGSG 108
           SV++G DFITV K    +W H+RP +  +I E   +G+ I+      + +     +  S 
Sbjct: 134 SVFYGADFITVTKAADANWAHIRPEIFALITEAITAGEQIVTISERREGEAGAPVEEDSL 193

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASET 167
            + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ D   V L +RGAC  C S++ T
Sbjct: 194 AYNENDSEVVGMIKELLETRIRPAIQEDGGDIDFRGFDDEGYVHLRLRGACRTCDSSTVT 253

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+  +L H++ EVK ++ V
Sbjct: 254 LKNGIEGMLMHYIEEVKGVKQV 275


>gi|182678037|ref|YP_001832183.1| scaffold protein Nfu/NifU [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633920|gb|ACB94694.1| Scaffold protein Nfu/NifU [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 187

 Score =  173 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 92/189 (48%), Positives = 139/189 (73%), Gaps = 2/189 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PG+ V+  G +    A  A+ SPLA  +F++ G++ V+FG DF
Sbjct: 1   MFIQTEATPNPATLKFLPGRPVMRLGTLDIREADGAKKSPLAEALFALEGVSGVFFGSDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I+V + Q DW+ ++P VLG IMEH++SG P++ +    D++  + G   + E+D+  V  
Sbjct: 61  ISVTRQQGDWQDIKPAVLGAIMEHYLSGAPLLTDEA--DLQPQNDGEEFYAEADAHTVAT 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           IK+++++ VRPAVA+DGGDI F+G+R+G V+L+M+G+CSGCPS+S TL++GV N+L H+V
Sbjct: 119 IKQLIESHVRPAVAKDGGDIKFRGFREGTVYLAMKGSCSGCPSSSATLRHGVQNLLKHYV 178

Query: 181 PEVKDIRTV 189
           PEV  +  +
Sbjct: 179 PEVVSVEQI 187


>gi|66808847|ref|XP_638146.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium discoideum AX4]
 gi|60466582|gb|EAL64634.1| NIF system FeS cluster assembly domain-containing protein
           [Dictyostelium discoideum AX4]
          Length = 314

 Score =  173 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 80/191 (41%), Positives = 121/191 (63%), Gaps = 6/191 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQTE TPNP +LKFIPG  VL EG  I FS+ K ++ SPLA+ +F + G+  V+F  D
Sbjct: 98  IFIQTETTPNPDSLKFIPGVQVLEEGQIIDFSDFKTSQQSPLANNLFKLDGVNRVFFSSD 157

Query: 60  FITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V    +++W  L+P + G I++ + SG PI+ +  LG++  D       +  D  VV
Sbjct: 158 FISVNKYPEHEWSILKPQIYGTIIDFYHSGLPILSDPSLGNINAD----TMILPEDDEVV 213

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
             IKE+++ R+RP V  DGG+I + G++DGIV + ++G CS C S+  TLK G+  +L H
Sbjct: 214 AMIKELIETRIRPTVLEDGGNIKYMGFKDGIVMVQLQGTCSSCSSSQATLKGGIERMLMH 273

Query: 179 FVPEVKDIRTV 189
           ++ EV  +  V
Sbjct: 274 WISEVTGVIAV 284


>gi|58617525|ref|YP_196724.1| hypothetical protein ERGA_CDS_07980 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417137|emb|CAI28250.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 185

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 82/190 (43%), Positives = 122/190 (64%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ EDTPNP TLKF+PG  V       F+++  AE SP A  +F I  I  V+FG DF
Sbjct: 1   MFIQIEDTPNPNTLKFMPGIPVNNGKIGEFTDSITAESSPFAKALFEIEHIVGVFFGGDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K    +W+ L+P +L +IM+        ++     +   ++     F   D  +V 
Sbjct: 61  VSVTKSSDIEWDVLKPEILTVIMDFLT-----LNPNDSVENHDEEDLQEFFDAKDEEIVS 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++D+ ++PAVA+DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L ++
Sbjct: 116 KIKELIDDYIKPAVAQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLTYY 175

Query: 180 VPEVKDIRTV 189
           +P+++ + +V
Sbjct: 176 LPDIQSVESV 185


>gi|241761631|ref|ZP_04759718.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753996|ref|YP_003226889.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241373939|gb|EER63472.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258553359|gb|ACV76305.1| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 183

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 125/190 (65%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+  + V+   + +F N +EA  SPLA  +F +  + +V++G DF
Sbjct: 1   MLIETEKTPNPATLKFLLHRPVMERESRYFVNKEEAADSPLAVALFDLQHVTAVFYGRDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V  D    W +L   ++ +I +HF +  P++      +   D        + +  V+ 
Sbjct: 61  ISVTLDSPSLWSNLESKIIMIISDHFDNDIPLLVENSEKNETKD-------HDEEDDVIL 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK+++D+RVRPAVARDGGDIVF+ + DGIV+LSMRGAC+GCPS+  TLK GV  +L HF
Sbjct: 114 QIKDLIDSRVRPAVARDGGDIVFQKFEDGIVYLSMRGACAGCPSSVATLKQGVETLLKHF 173

Query: 180 VPEVKDIRTV 189
           VPE+K++R +
Sbjct: 174 VPEIKEVRAI 183


>gi|260951229|ref|XP_002619911.1| hypothetical protein CLUG_01070 [Clavispora lusitaniae ATCC 42720]
 gi|238847483|gb|EEQ36947.1| hypothetical protein CLUG_01070 [Clavispora lusitaniae ATCC 42720]
          Length = 243

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/194 (37%), Positives = 113/194 (58%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA ISPLA ++FS+ G+ S+  G +
Sbjct: 23  LFIQTAETPNENALKFLPSTKLLQENETREFLSGREAVISPLAMKLFSVDGVKSIMLGSN 82

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  D  +W  L+P +  ++ E   +G PII +               F E D  +
Sbjct: 83  FITIEKSTDDIEWAVLKPEIFSILTEFLTNGTPIISDDAQL------TNDMQFSEDDDEI 136

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 137 VSMIKELIFTRIRPAIQDDGGDIEFVSFEENTGVVYLRLKGACRSCDSSSVTLKNGIESM 196

Query: 176 LNHFVPEVKDIRTV 189
           L +++ EV+++R V
Sbjct: 197 LKYYIEEVQEVRPV 210


>gi|15604511|ref|NP_221029.1| hypothetical protein RP667 [Rickettsia prowazekii str. Madrid E]
 gi|3861205|emb|CAA15105.1| unknown [Rickettsia prowazekii]
 gi|292572295|gb|ADE30210.1| NifU-like protein [Rickettsia prowazekii Rp22]
          Length = 190

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 82/191 (42%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTE+TPNP  +KF PGQ + V+  + FS   E +  S LA  +F I  + SV+ G D
Sbjct: 1   MFIQTEETPNPDAIKFFPGQEISVDQPVFFSELAEVKGRSALAESLFHINNVKSVFLGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HFISG P+ +     D +  ++         S + 
Sbjct: 61  FITVTKQARGNWQVIKPEILMVIMDHFISGFPVFNENTKIDDEKHNLD------MLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E ++ RVRP V +DGGDI++KG+  G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIETIETRVRPFVTQDGGDIIYKGFESGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 175 FIPEVQEVKAV 185


>gi|57239492|ref|YP_180628.1| hypothetical protein Erum7660 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579471|ref|YP_197683.1| hypothetical protein ERWE_CDS_08070 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161571|emb|CAH58499.1| putative NifU-related protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418097|emb|CAI27301.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 185

 Score =  171 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 123/190 (64%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ EDTPNP TLKF+PG  V       F+++  AE SP A  +F I  I SV+FG DF
Sbjct: 1   MFIQIEDTPNPNTLKFMPGIPVNNGKIGEFTDSITAESSPFAKALFEIEHIVSVFFGGDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V K    +W+ L+P +L +IM+        ++     +   ++     F   D  +V 
Sbjct: 61  ISVTKSSDIEWDVLKPEILTVIMDFLT-----LNPNDSVENNDEEDLQEFFDAKDEEIVS 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++D+ ++PAVA+DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L ++
Sbjct: 116 KIKELIDDYIKPAVAQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLTYY 175

Query: 180 VPEVKDIRTV 189
           +P+++ + +V
Sbjct: 176 LPDIQSVESV 185


>gi|283856470|ref|YP_163150.2| scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775474|gb|AAV90039.2| Scaffold protein Nfu/NifU [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 183

 Score =  171 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 84/190 (44%), Positives = 125/190 (65%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M I+TE TPNPATLKF+  + V+   + +F N +EA  SPLA  +F +  + +V++G DF
Sbjct: 1   MLIETEKTPNPATLKFLLHRPVMERESRYFVNKEEAADSPLAVALFDLQHVTAVFYGRDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           I+V  D    W +L   ++ +I +HF +  P++      +   D        + +  V+ 
Sbjct: 61  ISVTLDSPSLWSNLESKIIMIISDHFDNDIPLLVENFEKNEIKD-------HDEEDDVIL 113

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK+++D+RVRPAVARDGGDIVF+ + DGIV+LSMRGAC+GCPS+  TLK GV  +L HF
Sbjct: 114 QIKDLIDSRVRPAVARDGGDIVFQKFEDGIVYLSMRGACAGCPSSVATLKQGVETLLKHF 173

Query: 180 VPEVKDIRTV 189
           VPE+K++R +
Sbjct: 174 VPEIKEVRAI 183


>gi|73667413|ref|YP_303429.1| nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake]
 gi|72394554|gb|AAZ68831.1| Nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake]
          Length = 186

 Score =  171 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 83/190 (43%), Positives = 127/190 (66%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ E+TPNP TLKF+PG  V       F++   AE SPLA+ +F +  +  V+FG DF
Sbjct: 1   MFIQIEETPNPNTLKFMPGVPVNNGKVSEFADNIAAESSPLAAALFKVEHVKGVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +++ K D+ +W+ L+P VL +IME        ++ G   +   ++     F E D  +V 
Sbjct: 61  VSITKSDEIEWDVLKPEVLTVIMEFLT-----LNPGDSTEDFNEEETDEFFDEKDVEMVD 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++++ V+PAV +DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L+++
Sbjct: 116 KIKELINDYVKPAVMQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLSYY 175

Query: 180 VPEVKDIRTV 189
           +P+++ + +V
Sbjct: 176 IPDIQGVESV 185


>gi|240279904|gb|EER43409.1| HIRA-interacting protein [Ajellomyces capsulatus H143]
 gi|325093032|gb|EGC46342.1| HIRA-interacting protein [Ajellomyces capsulatus H88]
          Length = 314

 Score =  171 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 115/199 (57%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 79  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 138

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 139 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 198

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 199 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 258

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 259 GIESMLMHYIEEVKGVNHV 277


>gi|225563079|gb|EEH11358.1| HIRA-interacting protein [Ajellomyces capsulatus G186AR]
          Length = 314

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 115/199 (57%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 79  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 138

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 139 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 198

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 199 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 258

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 259 GIESMLMHYIEEVKGVNHV 277


>gi|220678984|emb|CAX14771.1| novel protein similar to HIRA interacting protein 5 (hirip5,
           zgc:110319) [Danio rerio]
          Length = 233

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 10/185 (5%)

Query: 7   DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK- 65
           DTPNP +LKF+PG+ VL  G   F  +  AE SPLA  +F I GI SV++G DFIT+ K 
Sbjct: 35  DTPNPRSLKFLPGKPVLGTGTQDFPTSASAESSPLARDLFQISGIKSVFYGPDFITLTKT 94

Query: 66  -DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
            D  +W  ++   + +I + F  G+ I       +  +         E D  +V  IKE+
Sbjct: 95  DDDVEWTDIKRHAIEVISKFFEGGEAITTGAAHAESSVT--------EDDDEIVSLIKEL 146

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           LD R+RP V  DGGD++FKG+ DG V L + G+C+GCPS++ TLK G+ N++  ++PEV 
Sbjct: 147 LDTRIRPTVQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYIPEVD 206

Query: 185 DIRTV 189
           ++  V
Sbjct: 207 NVEQV 211


>gi|116199405|ref|XP_001225514.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51]
 gi|88179137|gb|EAQ86605.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51]
          Length = 337

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 79/211 (37%), Positives = 114/211 (54%), Gaps = 22/211 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG----AIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF+P   +L  G     I + N +     P  S    ++ +I G+ 
Sbjct: 86  IFIQTESTPNADALKFLPNHQILPAGLTTPFIEYLNPRATIAPPHPSPLAAQLMNIDGVT 145

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD------- 104
           +V++G DFITV K    +W H+RP V  +I E   SG PI++     +            
Sbjct: 146 AVFYGADFITVTKAADANWAHVRPEVFALITEAITSGQPIVNVAERKEGGGGVGGAAGEG 205

Query: 105 ------MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGAC 158
                   S  + E+DS VV  IKE+L+ RVRPA+  DGGDI F+G+ +G V L +RGAC
Sbjct: 206 EGAAEEKDSLAYDENDSEVVGMIKELLETRVRPAIQEDGGDIEFRGFENGYVMLKLRGAC 265

Query: 159 SGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             C S++ TLK G+  +L H++ EV+ +  V
Sbjct: 266 RTCDSSTVTLKNGIEGMLMHYIEEVQGVHQV 296


>gi|254995338|ref|ZP_05277528.1| hypothetical protein AmarM_05319 [Anaplasma marginale str.
           Mississippi]
 gi|255003523|ref|ZP_05278487.1| hypothetical protein AmarPR_04754 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004646|ref|ZP_05279447.1| hypothetical protein AmarV_05119 [Anaplasma marginale str.
           Virginia]
          Length = 189

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 125/191 (65%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP  L+F+    +   G+ I FS+A  A+ S LA  +F I G++ V+FG D
Sbjct: 1   MFIQIEVTPNPDALRFLLSAEIGAIGSGIEFSDATTAQGSTLARLLFEIQGVSKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F++V K    DW+ LRP +L ++ ++F   +    +        +      F   DS VV
Sbjct: 61  FVSVTKLPDADWDTLRPEILVVMTDYFSLHNAY--SDAAPQAHEESDEREFFDTKDSEVV 118

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           QR+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +L++
Sbjct: 119 QRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVYGMLSY 178

Query: 179 FVPEVKDIRTV 189
           +VPEVK + +V
Sbjct: 179 YVPEVKAVESV 189


>gi|56417173|ref|YP_154247.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries]
 gi|222475537|ref|YP_002563954.1| hypothetical protein AMF_868 [Anaplasma marginale str. Florida]
 gi|56388405|gb|AAV86992.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries]
 gi|222419675|gb|ACM49698.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 194

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 85/191 (44%), Positives = 125/191 (65%), Gaps = 4/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP  L+F+    +   G+ I FS+A  A+ S LA  +F I G++ V+FG D
Sbjct: 6   MFIQIEVTPNPDALRFLLSAEIGAIGSGIEFSDATTAQGSTLARLLFEIQGVSKVFFGGD 65

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F++V K    DW+ LRP +L ++ ++F   +    +        +      F   DS VV
Sbjct: 66  FVSVTKLPDADWDTLRPEILVVMTDYFSLHNAY--SDAAPQAHEESDEREFFDTKDSEVV 123

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           QR+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +L++
Sbjct: 124 QRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVYGMLSY 183

Query: 179 FVPEVKDIRTV 189
           +VPEVK + +V
Sbjct: 184 YVPEVKAVESV 194


>gi|119189821|ref|XP_001245517.1| hypothetical protein CIMG_04958 [Coccidioides immitis RS]
          Length = 325

 Score =  170 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 118/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL E      + + + +    +P  S    ++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-----MKLDDMG 106
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +      +     
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAQAGQEGSGEE 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           + ++ E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|303322791|ref|XP_003071387.1| NifU-like domain containing protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|240111089|gb|EER29242.1| NifU-like domain containing protein [Coccidioides posadasii C735
           delta SOWgp]
          Length = 325

 Score =  170 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 118/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL E      + + + +    +P  S    ++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-----MKLDDMG 106
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +      +     
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAHAGQEGSGEE 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           + ++ E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|51473845|ref|YP_067602.1| hypothetical protein RT0659 [Rickettsia typhi str. Wilmington]
 gi|51460157|gb|AAU04120.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 190

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ + ++  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISIDQPVFFSELAEVKGRSTLAESLFHINNVKSVFFGSD 60

Query: 60  FITVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K    +W+ ++P +L +IM+HFISG P+ +     D +  ++         S + 
Sbjct: 61  FITVTKHAGGNWQVIKPEILMVIMDHFISGFPVFNENTKIDNEKHNID------MLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E ++ RVRP V +DGGDI++KG+  G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIETIETRVRPFVTQDGGDIIYKGFESGVVKLALRGACLGCPSSTITLKNGIESMLRH 174

Query: 179 FVPEVKDIRTV 189
           F+PEV++++ V
Sbjct: 175 FIPEVQEVQAV 185


>gi|320032859|gb|EFW14809.1| NifU family protein [Coccidioides posadasii str. Silveira]
          Length = 325

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 118/203 (58%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL E      + + + +    +P  S    ++ ++ G++
Sbjct: 81  IFIQTEVTPNADALKFIPNYPVLPENFPAPFLEYLSPRSTLAAPHPSPLAAKLLNVDGVS 140

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD-----MKLDDMG 106
           SV++G DFIT+ K    +W H++P V  +I E   SG+ +++   + +      +     
Sbjct: 141 SVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTSGEQLVNTVAVAEGAHAGQEGSGEE 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           + ++ E D  VV  I E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 201 AVEYNEEDEEVVGMINELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 261 TLKNGIESMLMHYIEEVKSVTQV 283


>gi|242802638|ref|XP_002484011.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
 gi|218717356|gb|EED16777.1| NifU-related protein [Talaromyces stipitatus ATCC 10500]
          Length = 290

 Score =  169 bits (428), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/194 (38%), Positives = 112/194 (57%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 81  IFIQTESTPNPDALKFLPNHRVLPENFPTPFLEYLSPRSTLAPPHPSPLAAKLLNVEGVS 140

Query: 53  SVYFGYDFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-----MG 106
           SV++G DFITV  +   +W H++P V  +I E   SG+PI++         D        
Sbjct: 141 SVFYGPDFITVTKQSDVNWAHIKPEVFSLITEVVTSGEPIVNTVERTSGAQDAQEGGGED 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLSYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFV 180
           TLK G+ ++L H+V
Sbjct: 261 TLKNGIESMLMHYV 274


>gi|165933598|ref|YP_001650387.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia
           rickettsii str. Iowa]
 gi|165908685|gb|ABY72981.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia
           rickettsii str. Iowa]
          Length = 190

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 81/191 (42%), Positives = 125/191 (65%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTADTPNPDAITFFPGQKISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEENTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TL+ G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLRNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+++  V
Sbjct: 175 FVPEVQEVEAV 185


>gi|310796741|gb|EFQ32202.1| hypothetical protein GLRG_07346 [Glomerella graminicola M1.001]
          Length = 316

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/207 (37%), Positives = 116/207 (56%), Gaps = 18/207 (8%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   +KF+P   +L E      I + N +     P  S    ++ +I G+ 
Sbjct: 80  IFIQTEQTPNADAIKFLPNHRILPENISTPFIEYLNPRSTIAPPYPSPLAAQLMNIDGVT 139

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD--------MKLD 103
           SV++G DFITV K    +W H+RP V  +I E   SG  I++     +         +  
Sbjct: 140 SVFYGADFITVSKAADANWAHIRPEVFALITEAITSGQSIVNVAEKKEGGVAGEEQQQHG 199

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCP 162
           +  S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ D  IV L +RGAC  C 
Sbjct: 200 EEDSLAYDENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFTDDGIVLLKLRGACRTCD 259

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S++ TLK G+  +L H++ EVK ++ +
Sbjct: 260 SSTVTLKNGIEGMLMHYIEEVKGVQQI 286


>gi|149238520|ref|XP_001525136.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450629|gb|EDK44885.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 292

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/193 (40%), Positives = 114/193 (59%), Gaps = 9/193 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA  SPLA R+FSI GI S+ FG +
Sbjct: 68  LFIQTAETPNDHALKFLPSLQILGENETREFLSGREAHSSPLAVRLFSIDGIKSIMFGSN 127

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K  QY+W  L+P +  ++ E+   G PI++                F E D  VV
Sbjct: 128 FITIEKLPQYEWALLKPEIFSILTEYLNQGLPIMNEEEGALA-----DDVAFNEDDDEVV 182

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
           Q IKE++  R+RPA+  DGGDI F  +R+    VFL ++GAC  C S+S TLK G+ ++L
Sbjct: 183 QMIKELIFTRIRPAIQDDGGDIEFVEFRESDGTVFLRLKGACRSCDSSSVTLKNGIESML 242

Query: 177 NHFVPEVKDIRTV 189
            H++ EV+ +  +
Sbjct: 243 KHYIEEVQSVEPI 255


>gi|162312172|ref|NP_595452.2| NifU-like protein [Schizosaccharomyces pombe 972h-]
 gi|46397296|sp|Q9UUB8|YH9J_SCHPO RecName: Full=NifU-like protein C1709.19c
 gi|157310401|emb|CAA21258.2| NifU-like protein [Schizosaccharomyces pombe]
          Length = 260

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 73/194 (37%), Positives = 116/194 (59%), Gaps = 10/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           ++I++E+TPN   LKF+PG  +L    G+  F   +    SPLA ++F I G+ S++FG 
Sbjct: 43  IWIRSEETPNENALKFLPGLDILPPTIGSCEFMRGQGTVNSPLAQKLFDIDGVDSIFFGK 102

Query: 59  DFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           DFITV K    +W  ++P V  +IMEH  +G P++    L             +ESDS +
Sbjct: 103 DFITVSKGAGTEWAQMKPEVFSVIMEHLSNGSPVLSEEPLKGA-----SDTQILESDSQI 157

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+++  +RP++  DGGD+ F+G+ +    V L +RGAC  C S++ TLK G+  +
Sbjct: 158 VAMIKELIETSIRPSIQEDGGDVEFRGFDEKTGTVSLKLRGACRTCSSSAVTLKNGIQQM 217

Query: 176 LNHFVPEVKDIRTV 189
           L H++PEV+++  V
Sbjct: 218 LKHYIPEVENVVQV 231


>gi|157828872|ref|YP_001495114.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157801353|gb|ABV76606.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 190

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 81/191 (42%), Positives = 125/191 (65%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTADTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEENTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TL+ G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLRNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+++  V
Sbjct: 175 FVPEVQEVEAV 185


>gi|301107396|ref|XP_002902780.1| iron-sulfur cluster scaffold protein Nfu-like protein [Phytophthora
           infestans T30-4]
 gi|262097898|gb|EEY55950.1| iron-sulfur cluster scaffold protein Nfu-like protein [Phytophthora
           infestans T30-4]
          Length = 217

 Score =  168 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 79/195 (40%), Positives = 120/195 (61%), Gaps = 14/195 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLASRIFSIPGIASVYF 56
           MFIQTE TPNP ++KF+PG+ VL E    G     +++E   SPLA ++F I G+  V+F
Sbjct: 1   MFIQTEPTPNPLSVKFLPGRSVLDERFTTGVDFTPSSEEVRRSPLAKKLFQIEGVTRVFF 60

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
           G DFI+V K ++ DW+ L   +   IM+ F S + ++ +  +       +     +  D 
Sbjct: 61  GKDFISVTKTEEEDWDALNAEIFATIMDFFASDEQVMSDEPI-------VTDTTILPDDD 113

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVA 173
            VV  IKE+L+ R+RP+V  DGGDI +KG+ +    V + + G+C+GCPS+S TLK+GV 
Sbjct: 114 EVVAMIKELLEQRIRPSVQDDGGDIFYKGFDEKTGTVSVQLAGSCAGCPSSSVTLKHGVE 173

Query: 174 NILNHFVPEVKDIRT 188
           N+L H++PEV+ I  
Sbjct: 174 NMLKHYIPEVRGIEE 188


>gi|154281411|ref|XP_001541518.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150411697|gb|EDN07085.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 279

 Score =  168 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 115/199 (57%), Gaps = 10/199 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKF P   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 44  IFIQTETTPNADALKFNPNHPVLPENFPTSFVEYLSPRSTLTPPYPSPLAAKLLNVDGVS 103

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +G+PII+           +  S  +
Sbjct: 104 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTTGEPIINVAEAGAGAGPAEEDSLSY 163

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK 
Sbjct: 164 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVSLKLRGACRTCDSSTVTLKN 223

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H++ EVK +  V
Sbjct: 224 GIESMLMHYIEEVKGVNHV 242


>gi|118356024|ref|XP_001011271.1| NifU-like domain containing protein [Tetrahymena thermophila]
 gi|89293038|gb|EAR91026.1| NifU-like domain containing protein [Tetrahymena thermophila SB210]
          Length = 225

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 74/194 (38%), Positives = 118/194 (60%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           +FIQ + TPNP  LKF+P G+ V+ +G  + F  A+ A +SPLA ++F+I G+  V++G 
Sbjct: 25  LFIQAKSTPNPNFLKFVPSGKTVMNDGTTLDFIAARYAHVSPLAKKLFTIDGVNRVFYGK 84

Query: 59  DFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           D+I++  K+  DW  L+P +  +I E F    P+  +    +            + DS  
Sbjct: 85  DYISISKKEDADWNELKPQIFSLITEQFTGTTPLFTDEPERE-------DTKIKDDDSEA 137

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           VQ IKE++D R+RP V  DGGD++++ + +   IV L+M G+CSGCPS+  TLK G+  +
Sbjct: 138 VQMIKEIIDTRIRPLVQDDGGDVIYRNFDEPSGIVTLTMMGSCSGCPSSQVTLKQGIEKM 197

Query: 176 LNHFVPEVKDIRTV 189
           + H+VPEV  + +V
Sbjct: 198 IMHYVPEVNGVESV 211


>gi|157804045|ref|YP_001492594.1| NifU-like domain-containing protein [Rickettsia canadensis str.
           McKiel]
 gi|157785308|gb|ABV73809.1| NifU-like domain [Rickettsia canadensis str. McKiel]
          Length = 189

 Score =  167 bits (422), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 84/191 (43%), Positives = 120/191 (62%), Gaps = 8/191 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  EG I FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEINSEGPIFFSELAEVKGKSKLAESLFHINNVKSVFFGSD 60

Query: 60  FITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV  + + +W+ ++P +L +IM+HF+SG P+       D    ++     IE     +
Sbjct: 61  FITVTKQPESNWQVIKPEILMVIMDHFVSGFPVFEESTKADNVQHNLDGLLEIEKQIIEI 120

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
                  + RVRP+VA+DGGDI++K + +G+V L +RGAC GCPS++ TLK G+ ++L H
Sbjct: 121 I------ETRVRPSVAQDGGDIIYKCFENGVVKLVLRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 FVPEVKDIRTV 189
           FVPEV+ +  V
Sbjct: 175 FVPEVQAVEAV 185


>gi|212540196|ref|XP_002150253.1| NifU-related protein [Penicillium marneffei ATCC 18224]
 gi|210067552|gb|EEA21644.1| NifU-related protein [Penicillium marneffei ATCC 18224]
          Length = 285

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 77/194 (39%), Positives = 112/194 (57%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPNP  LKF+P   VL E      + + + +     P  S    ++ +I GI+
Sbjct: 81  IFIQTESTPNPDALKFLPNNRVLPENFSTPFLEYLSPRSTLAPPHPSPLAAKLLNIEGIS 140

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-----MG 106
           SV++G DFITV K    +W H++P V  +I E   SG+PI++         D        
Sbjct: 141 SVFYGPDFITVTKSSDVNWAHVKPEVFSLITEVVTSGEPIVNTVEHTSGAQDAQEGGGED 200

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ +GIV L +RGAC  C S++ 
Sbjct: 201 TLGYNEEDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTV 260

Query: 167 TLKYGVANILNHFV 180
           TLK G+ ++L H+V
Sbjct: 261 TLKNGIESMLMHYV 274


>gi|296817809|ref|XP_002849241.1| HIRA-interacting protein 5 [Arthroderma otae CBS 113480]
 gi|238839694|gb|EEQ29356.1| HIRA-interacting protein 5 [Arthroderma otae CBS 113480]
          Length = 304

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 116/203 (57%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + +   +     P  S    ++ ++ G+ 
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGVV 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P V  +I E   +G+ +I+      G  G  + +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEVFSLITEAITTGEALINIVDVRPGKEGAEEAEMEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  +V  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVMLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|88606830|ref|YP_504700.1| NifU domain-containing protein [Anaplasma phagocytophilum HZ]
 gi|88597893|gb|ABD43363.1| NifU domain protein [Anaplasma phagocytophilum HZ]
          Length = 188

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 79/191 (41%), Positives = 124/191 (64%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E TPNP TLKF+    V+   +   F +A +A+ SPLA  +F + G+  V+FG D
Sbjct: 1   MFIQIESTPNPDTLKFLLSAEVVGINSGAEFLSADDAQASPLARLLFEVEGVEKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           F+++ K +   WE L+P VL ++ ++         +        +D     F E DS +V
Sbjct: 61  FVSITKAENILWEVLKPEVLVVMTDY---CLLQGTDKEHVQASAEDEEKEFFDEKDSEIV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           Q++KE+++N V+PAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +L++
Sbjct: 118 QQVKELIENYVKPAVAQDGGDIKFRGYKEGVVFVKLRGACSGCPSAAVTLKDGVYGMLSY 177

Query: 179 FVPEVKDIRTV 189
           ++P +K + ++
Sbjct: 178 YIPAIKAVESI 188


>gi|148697451|gb|EDL29398.1| mCG14627 [Mus musculus]
          Length = 181

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 79/174 (45%), Positives = 105/174 (60%), Gaps = 8/174 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + FS    A  SPLA ++F I G+ SV+FG DF
Sbjct: 1   MFIQTQDTPNPNSLKFIPGKRVLETRTMDFSTPAAAFRSPLARQLFRIEGVKSVFFGPDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 61  ITVTKENGELDWNLLKPDIHATIMDFFASGLPLVTEETPPPPGEAGS------EEDDGVV 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
             IKE+LD R+RP V  DGGD++++ + DGIV L ++G+C  CPS+  TLK G+
Sbjct: 115 AMIKELLDTRIRPTVQEDGGDVIYRAFEDGIVRLKLQGSCPSCPSSIITLKSGI 168


>gi|315052166|ref|XP_003175457.1| hypothetical protein MGYG_02982 [Arthroderma gypseum CBS 118893]
 gi|311340772|gb|EFQ99974.1| hypothetical protein MGYG_02982 [Arthroderma gypseum CBS 118893]
          Length = 301

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 111/202 (54%), Gaps = 13/202 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + + N +     P  S    ++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLNPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISG----DPIIHNGGLGDMKLDDMGS 107
           SV+FG DFITV KD   +W H++P +  +I E    G    + +    G    +     +
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRPGKEGAEEVGEEA 191

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASET 167
             + E D  +V  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ T
Sbjct: 192 VRYNEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTVT 251

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+ ++L H++ EVK +  V
Sbjct: 252 LKNGIESMLMHYIEEVKSVTQV 273


>gi|254566581|ref|XP_002490401.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|238030197|emb|CAY68120.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
          Length = 249

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 112/193 (58%), Gaps = 7/193 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT+ TPN   LKF+P   +L E   I F N ++A  SPLA ++F I G+ ++  G+D
Sbjct: 21  LFIQTQTTPNDDALKFLPSMKILPEQTTIEFLNGRQAFKSPLALKLFGIDGVKTIMIGHD 80

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  Q DW  L+P +  ++ E   +G P+++     D     +      + +  VV
Sbjct: 81  FITVEKKTQDDWSLLKPEIFAVLTESLNNGTPVLNEQHQSDANDQALLEE---DDEDEVV 137

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANIL 176
             +KE++  R+RPA+  DGGDI F  +    G V+L +RGAC  C S+S TLK G+ ++L
Sbjct: 138 SMVKELIFTRIRPAIQDDGGDIEFVRFEYETGTVYLRLRGACRSCSSSSITLKNGIESML 197

Query: 177 NHFVPEVKDIRTV 189
            H++ EV+ +  +
Sbjct: 198 KHYIEEVEAVEQI 210


>gi|88658493|ref|YP_507026.1| NifU domain-containing protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599950|gb|ABD45419.1| NifU domain protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 186

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 82/190 (43%), Positives = 125/190 (65%), Gaps = 6/190 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQ  +TPNP TLKF+PG  +       F+++  AE S LA+ +F I  + SV+FG DF
Sbjct: 1   MFIQIGETPNPNTLKFMPGMPINNGKVSEFADSVAAEGSSLATALFKIEYVKSVFFGGDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ++V K D  +W+ L+P +L +IME        +++    +    +     F E D  +V 
Sbjct: 61  VSVTKSDDIEWDVLKPEILTVIMEFLT-----LNSDNATESFDQEELEEFFDEKDIEMVG 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++DN V+PAV +DGGDI FKGY +GIVF+ +RGACSGCPSAS TLK G+ N+L+++
Sbjct: 116 KIKELIDNYVKPAVIQDGGDIKFKGYSNGIVFVKLRGACSGCPSASITLKEGIYNMLSYY 175

Query: 180 VPEVKDIRTV 189
           +P+++ + ++
Sbjct: 176 IPDIQGVESI 185


>gi|269959159|ref|YP_003328948.1| NifU domain containing protein [Anaplasma centrale str. Israel]
 gi|269848990|gb|ACZ49634.1| NifU domain containing protein [Anaplasma centrale str. Israel]
          Length = 188

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 122/191 (63%), Gaps = 5/191 (2%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           MFIQ E+TPNP  L+F+         + + FS+A  A  S LA  +F I G++ V+FG D
Sbjct: 1   MFIQIENTPNPDALRFLLSADAGNVESGVEFSDADAARSSALARLLFDIQGVSKVFFGGD 60

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FI+V K    DW+ LRP +L ++ ++         +        D      F E D+ VV
Sbjct: 61  FISVTKLPHADWDTLRPEILVVMTDYLSLRG---ADATPLPAHEDGGEQEFFDEVDTEVV 117

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           +R+KE++++ VRPAVA+DGGDI F+GY++G+VF+ +RGACSGCPSA+ TLK GV  +L++
Sbjct: 118 KRVKELIEHYVRPAVAQDGGDIKFRGYKEGVVFVHLRGACSGCPSAAVTLKDGVYGMLSY 177

Query: 179 FVPEVKDIRTV 189
           +VPEVK + +V
Sbjct: 178 YVPEVKAVESV 188


>gi|289620358|emb|CBI53216.1| unnamed protein product [Sordaria macrospora]
          Length = 290

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 77/195 (39%), Positives = 112/195 (57%), Gaps = 29/195 (14%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQTE+TPNP +LKF+P                        +++ +I G+ SV++G DF
Sbjct: 78  IFIQTENTPNPDSLKFLPN-----------------------TKLMNIDGVTSVFYGTDF 114

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMGSGDFIESD 114
           ITV K    +W H+RP V  +I E   SG  I++      G     + D+  S  + E+D
Sbjct: 115 ITVTKSADANWAHIRPEVFALITETITSGQTIVNVVERREGEENTQESDEKDSLAYDEND 174

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++ TLK G+  
Sbjct: 175 SEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGIVKLKLRGACRTCDSSTVTLKNGIEG 234

Query: 175 ILNHFVPEVKDIRTV 189
           +L H++ EV+ +  V
Sbjct: 235 MLMHYIEEVQGVEQV 249


>gi|169608792|ref|XP_001797815.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15]
 gi|111063827|gb|EAT84947.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15]
          Length = 263

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 13/198 (6%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIASVYF 56
           TE TPN   LKF P Q VL E      + + N +     P  S    ++ +I G+ SV+ 
Sbjct: 25  TEPTPNDDALKFNPNQRVLPESISSPFLEYLNPRSTLAPPHPSPLAAQLLNIDGVTSVFL 84

Query: 57  GYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH----NGGLGDMKLDDMGSGDFI 111
           G D ITV KD    W H++P V  +I E   SG P+++     G        ++ S  + 
Sbjct: 85  GLDHITVTKDTSTPWAHIKPEVFAIINEFMTSGQPLVNTIADKGNEQGQGNSEVDSLAYD 144

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+DS VVQ IKE+L+ R+RP++  DGGDI F+G+ DG V L +RGAC  C S++ TLK G
Sbjct: 145 ENDSEVVQMIKELLETRIRPSIQEDGGDIDFRGFNDGQVLLKLRGACRTCDSSTVTLKNG 204

Query: 172 VANILNHFVPEVKDIRTV 189
           + ++L H++ EVK ++ V
Sbjct: 205 IESMLMHYIEEVKGVQQV 222


>gi|68490038|ref|XP_711140.1| hypothetical protein CaO19.6283 [Candida albicans SC5314]
 gi|68490075|ref|XP_711122.1| hypothetical protein CaO19.13662 [Candida albicans SC5314]
 gi|46432400|gb|EAK91883.1| hypothetical protein CaO19.13662 [Candida albicans SC5314]
 gi|46432419|gb|EAK91901.1| hypothetical protein CaO19.6283 [Candida albicans SC5314]
          Length = 262

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 5/194 (2%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P  +++       F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-MGSGDFIESDSAV 117
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +             E D  V
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAINEDDDEV 151

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 152 VSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESM 211

Query: 176 LNHFVPEVKDIRTV 189
           L H++ EV  +  +
Sbjct: 212 LKHYIEEVNSVEPI 225


>gi|296448206|ref|ZP_06890103.1| Scaffold protein Nfu/NifU [Methylosinus trichosporium OB3b]
 gi|296254290|gb|EFH01420.1| Scaffold protein Nfu/NifU [Methylosinus trichosporium OB3b]
          Length = 183

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 100/189 (52%), Positives = 134/189 (70%), Gaps = 6/189 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNP+TLKF+PG+ VL  GA  F +A+ A  SPLA  + +I G+ +V FG DF
Sbjct: 1   MFIQTESTPNPSTLKFLPGRPVLAAGAREFRDAQAAAASPLAGALLAINGVEAVMFGPDF 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++V K   +W HL+P VLG IMEHF SG PI+ + G      +   +  F  +D+ +V  
Sbjct: 61  VSVTKADAEWAHLKPAVLGTIMEHFTSGAPIVLDEG------EAAPAEFFDPADAELVAT 114

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           +KE+L  RV PAVARDGGDI F+G+RDGIV+L+M+G+CSGCPS+S TLK GV N+L H+V
Sbjct: 115 LKELLVTRVTPAVARDGGDIAFRGFRDGIVYLAMKGSCSGCPSSSATLKNGVENLLRHYV 174

Query: 181 PEVKDIRTV 189
           P+V+ +  V
Sbjct: 175 PQVRSVEQV 183


>gi|68492023|ref|XP_710207.1| hypothetical protein CaO19.3485 [Candida albicans SC5314]
 gi|46431364|gb|EAK90941.1| hypothetical protein CaO19.3485 [Candida albicans SC5314]
          Length = 262

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 5/194 (2%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P  +++       F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-MGSGDFIESDSAV 117
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +             E D  V
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAINEDDDEV 151

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 152 VSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESM 211

Query: 176 LNHFVPEVKDIRTV 189
           L H++ EV  +  +
Sbjct: 212 LKHYIEEVNSVEPI 225


>gi|226480566|emb|CAX73380.1| HIRA interacting protein 5 [Schistosoma japonicum]
 gi|226480792|emb|CAX73493.1| HIRA interacting protein 5 [Schistosoma japonicum]
          Length = 233

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 8/190 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PGQ VL  G   F + K+A  SPLA ++F I G+  V+FG DF
Sbjct: 25  LFIQAQETPNPNSLKYFPGQAVLGSGTRDFPSRKQAGSSPLARQLFRIEGVEQVFFGPDF 84

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+   + ++W  ++P V   IM+ + SG P+I      +       S    E D   V 
Sbjct: 85  ITITKNNDFEWAVIKPDVYATIMDFYSSGQPVIDEEKSQE-------SDKPCEVDDETVL 137

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD R+RP V  DGGDI++KG++DGIV L ++G+CS CPS+  TLK GV N+L  +
Sbjct: 138 MIKELLDTRIRPTVQEDGGDIIYKGFKDGIVLLKLQGSCSSCPSSVVTLKNGVQNMLQFY 197

Query: 180 VPEVKDIRTV 189
           +P+V  +  V
Sbjct: 198 IPDVLGVEQV 207


>gi|302657114|ref|XP_003020287.1| hypothetical protein TRV_05641 [Trichophyton verrucosum HKI 0517]
 gi|291184105|gb|EFE39669.1| hypothetical protein TRV_05641 [Trichophyton verrucosum HKI 0517]
          Length = 304

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 113/203 (55%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + +   +     P  S    ++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|326475115|gb|EGD99124.1| NifU domain-containing protein [Trichophyton tonsurans CBS 112818]
 gi|326482250|gb|EGE06260.1| scaffold protein Nfu/NifU [Trichophyton equinum CBS 127.97]
          Length = 304

 Score =  163 bits (413), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 113/203 (55%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + +   +     P  S    ++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P V  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEVFSLITEAITRGEALVNVVDVRPGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 252 TLKNGIESMLMHYIEEVKSVTQV 274


>gi|58269446|ref|XP_571879.1| iron ion homeostasis-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57228115|gb|AAW44572.1| iron ion homeostasis-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 309

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 86/192 (44%), Positives = 118/192 (61%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN A+LKFIPG  V    A  F + + A  SPLA+R+ +I GI  V+FG DF
Sbjct: 80  MFIQTETTPNEASLKFIPGVQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPDF 139

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T  KD  Y W  L+P V  ++MEHF SG  +   G       D       +++DS +V 
Sbjct: 140 VTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGSGESQAED----TRILDTDSEIVG 195

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ RVRPA+  DGGDI ++G+ +    V L ++G+C GC S+S TLK G+  +L 
Sbjct: 196 MIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERMLT 255

Query: 178 HFVPEVKDIRTV 189
           H+VPEV+ +  V
Sbjct: 256 HYVPEVQSVEQV 267


>gi|134114121|ref|XP_774308.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256943|gb|EAL19661.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 309

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 86/192 (44%), Positives = 118/192 (61%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN A+LKFIPG  V    A  F + + A  SPLA+R+ +I GI  V+FG DF
Sbjct: 80  MFIQTETTPNEASLKFIPGVQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPDF 139

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T  KD  Y W  L+P V  ++MEHF SG  +   G       D       +++DS +V 
Sbjct: 140 VTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGSGESQAED----TRILDTDSEIVG 195

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ RVRPA+  DGGDI ++G+ +    V L ++G+C GC S+S TLK G+  +L 
Sbjct: 196 MIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERMLT 255

Query: 178 HFVPEVKDIRTV 189
           H+VPEV+ +  V
Sbjct: 256 HYVPEVQSVEQV 267


>gi|115376684|ref|ZP_01463912.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|310823922|ref|YP_003956280.1| NIF system FeS cluster assembly, NifU family protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115366301|gb|EAU65308.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396994|gb|ADO74453.1| NIF system FeS cluster assembly, NifU family protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 187

 Score =  163 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 75/189 (39%), Positives = 115/189 (60%), Gaps = 8/189 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYDFI 61
           IQ E TPNP+TLK++  + +L  GA++F+  +EAE   PLA ++  I G+ +V  G +F+
Sbjct: 5   IQLEWTPNPSTLKYVVDRRLLSSGAVNFTRREEAEQKSPLARKLMDIQGVTAVMLGLNFV 64

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K D+ +W+ L   V+  +  H  S +P      + D            E  S+V QR
Sbjct: 65  TVTKGDEGEWDELNDAVMSTLDAHLGSDEP------VVDEAAVAAARAAPAEGGSSVEQR 118

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+E+LD  +RPAVA+DGGDI    Y +G+V+L M+G+CSGCPS++ TLK G+   L   +
Sbjct: 119 IREILDAEIRPAVAQDGGDITLDRYENGVVYLHMQGSCSGCPSSTATLKMGIEGRLREAI 178

Query: 181 PEVKDIRTV 189
           PEV ++ ++
Sbjct: 179 PEVTEVVSI 187


>gi|150864668|ref|XP_001383601.2| hypothetical protein PICST_82838 [Scheffersomyces stipitis CBS
           6054]
 gi|149385924|gb|ABN65572.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 254

 Score =  163 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 76/194 (39%), Positives = 116/194 (59%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN + LKF+P   +L E   I F + +EA  SPLA ++FSI GI S+ FG +
Sbjct: 33  LFIQTVETPNESALKFLPSIKLLEENETIEFLSGREAARSPLAVKLFSIDGIKSIMFGSN 92

Query: 60  FITVGKD--QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K+     W  L+P +  ++ E+  +G PI+ +G      ++        + D  V
Sbjct: 93  FITIEKNSNDLHWSLLKPEIFSILTEYLTNGTPILIDGESLSKDME------INDDDDEV 146

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  +R+    VFL ++GAC  C S+S TLK G+ ++
Sbjct: 147 VSIIKELIFTRIRPAIQDDGGDIEFVSFREEDGTVFLRLKGACRSCDSSSVTLKNGIESM 206

Query: 176 LNHFVPEVKDIRTV 189
           L +++ EVK +  V
Sbjct: 207 LKYYIEEVKAVEQV 220


>gi|320585764|gb|EFW98443.1| NifU [Grosmannia clavigera kw1407]
          Length = 370

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 112/209 (53%), Gaps = 24/209 (11%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIASVYF 56
           TE TPN   +KF+P   VL EG     I + + +     P  S    ++ ++ G+ +V++
Sbjct: 121 TESTPNADAIKFLPNHQVLPEGIASPFIEYLSPRATIAPPYPSPLAAQLMNVDGVTAVFY 180

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDP---------------IIHNGGLGDM 100
           G DFITV K    +W H+RP V  +I E   SG                    +G   + 
Sbjct: 181 GSDFITVTKATDANWAHIRPEVFALITEAITSGQAIVRPSATGSAGAEGVDGTHGEGAEA 240

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSG 160
           +     S  + E+DS VV  IKE+L+ R+RPA+  DGGDI F+G+ DG V L +RGAC  
Sbjct: 241 EAVHEDSLQYNENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGFEDGEVLLKLRGACRT 300

Query: 161 CPSASETLKYGVANILNHFVPEVKDIRTV 189
           C S++ TLK G+ ++L H++ EVK +R V
Sbjct: 301 CDSSTVTLKNGIESMLMHYIEEVKVVRQV 329


>gi|258565761|ref|XP_002583625.1| HIRA-interacting protein 5 [Uncinocarpus reesii 1704]
 gi|237907326|gb|EEP81727.1| HIRA-interacting protein 5 [Uncinocarpus reesii 1704]
          Length = 316

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 115/203 (56%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE TPN   LKFIP   VL +      + + + +     P  S    ++F++ G++
Sbjct: 72  IFIQTETTPNADALKFIPNFTVLPKDFPTPFLEYLSPRSTLAPPHPSPLAAKLFNVDGVS 131

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMG----- 106
           SV++G DFIT+ K     W H++P V  +I E   SG+ +++     D            
Sbjct: 132 SVFYGPDFITITKAGDASWAHIKPEVFSLITEAVTSGEQLVNTVAAKDGAEPGQEGSAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           + ++ E D  +V  I+E+L+ R+RPA+  DGGDI F+G++DG V L +RGAC  C S++ 
Sbjct: 192 APEYAEEDEEIVGMIQELLETRIRPAIQEDGGDIEFRGFKDGNVMLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EV  +  V
Sbjct: 252 TLKNGIESMLMHYIEEVTSVTQV 274


>gi|224009450|ref|XP_002293683.1| nifu-like protein [Thalassiosira pseudonana CCMP1335]
 gi|220970355|gb|EED88692.1| nifu-like protein [Thalassiosira pseudonana CCMP1335]
          Length = 210

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 114/196 (58%), Gaps = 15/196 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHF----SNAKEAEISPLASRIFSIP-GIASVY 55
           +FIQT  TPNP +LKFIP   +       F     +      SPLA ++F++  GI S+Y
Sbjct: 15  LFIQTATTPNPESLKFIPNGRLNNTDTAGFYVTRKDHTLIARSPLAKQLFNLDIGIKSLY 74

Query: 56  FGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
            GYDFITV K  +  W+HL+ P+ G IM+ + SG P +           ++     +E D
Sbjct: 75  LGYDFITVTKFAEAHWQHLQTPIFGAIMDFYASGKPALRGEP-------EITDTTILEDD 127

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGV 172
             VV  IKE+L++R+RPAV  DGGDI + G+ +    V + + G+C GCPS+S TLK GV
Sbjct: 128 DEVVAMIKELLESRIRPAVQEDGGDIRYVGFEEETGLVTVQLAGSCVGCPSSSVTLKNGV 187

Query: 173 ANILNHFVPEVKDIRT 188
            N+L H++PEV  + +
Sbjct: 188 ENMLMHYIPEVTAVIS 203


>gi|327402876|ref|YP_004343714.1| nitrogen-fixing NifU domain-containing protein [Fluviicola
           taffensis DSM 16823]
 gi|327318384|gb|AEA42876.1| nitrogen-fixing NifU domain-containing protein [Fluviicola
           taffensis DSM 16823]
          Length = 201

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/191 (32%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYDF 60
           +  E TPNP T+KF+  + +L+ G ++ F +  EA+   PLA  +F+ P + +V+   +F
Sbjct: 8   VYVEMTPNPNTMKFVANKYLLINGESVEFHSGSEAKGYSPLAEELFNFPFVKTVFITANF 67

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD--SAV 117
           +TV   D   W+ +   +   I    + G  I+    +   K          +    S  
Sbjct: 68  VTVAKNDSISWDFVTMELREFIKSWIVDGKDILIQMPVAKPKAASGDDSKPAKEYAPSEY 127

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
              I+ +LD  VRPAV  DGG I F G+ +G V +++RGACSGCPS++ TLK G+ N+L 
Sbjct: 128 DDAIRSLLDEYVRPAVEGDGGAIDFVGFEEGTVTVALRGACSGCPSSTATLKGGIENLLK 187

Query: 178 HFVPEVKDIRT 188
             +P+VK++  
Sbjct: 188 QHLPDVKEVVA 198


>gi|321261141|ref|XP_003195290.1| iron homeostasis-related protein [Cryptococcus gattii WM276]
 gi|317461763|gb|ADV23503.1| Iron homeostasis-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 309

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 88/192 (45%), Positives = 120/192 (62%), Gaps = 7/192 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN A+LKFIPG  V    A  F + + A  SPLA+R+ +I GI  V+FG DF
Sbjct: 80  MFIQTETTPNEASLKFIPGVQVTNGAAHEFLDLRSALQSPLATRLLTIDGITGVFFGPDF 139

Query: 61  ITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +T  KD  Y W  L+P V  ++MEHF SG  +   G       D       +++DS +V 
Sbjct: 140 VTCSKDDSYSWSILKPEVFAVLMEHFSSGASLFKEGSGESQAED----TRILDTDSEIVG 195

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+L+ RVRPA+  DGGDI ++G+ +  GIV L ++G+C GC S+S TLK G+  +L 
Sbjct: 196 MIKELLETRVRPAIMEDGGDIEYRGFDEVTGIVKLKLKGSCRGCSSSSVTLKNGIERMLT 255

Query: 178 HFVPEVKDIRTV 189
           H+VPEV+ +  V
Sbjct: 256 HYVPEVQSVEQV 267


>gi|110636788|ref|YP_676995.1| thioredoxin-like protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110279469|gb|ABG57655.1| thioredoxin-related protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 191

 Score =  161 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 68/187 (36%), Positives = 105/187 (56%), Gaps = 7/187 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNP TLKFI  + ++ EG++ F  A  AE  PL   +F    +  V+   +FIT
Sbjct: 8   VYTEATPNPNTLKFITDKTLVEEGSVDFPMASSAESCPLVLDLFRFDFVKRVFMAANFIT 67

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K +  +WE +   +  +I  +   G P+             + +   +E +  VV +I
Sbjct: 68  VTKSEGMEWEEVSGMIKSLIKGYIEEGKPLFKE------THKPLSNTAPVEGEPEVVTKI 121

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           K VLD  +RPAV +DGG I F+ + DG+V + ++G+CSGCPS++ TLK G+ N+L   VP
Sbjct: 122 KVVLDEYIRPAVEQDGGAINFESFVDGVVKVQLQGSCSGCPSSTVTLKSGIENLLKRMVP 181

Query: 182 EVKDIRT 188
           EV ++  
Sbjct: 182 EVTEVVA 188


>gi|23006361|ref|ZP_00048716.1| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum
           magnetotacticum MS-1]
          Length = 184

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 91/179 (50%), Positives = 125/179 (69%), Gaps = 5/179 (2%)

Query: 13  TLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ--YDW 70
           TLKF+PG+VVL EG     +A  AE SPLAS +F++PG++ VYFG+DFI+V K     +W
Sbjct: 9   TLKFLPGRVVLTEGTFEARDASSAERSPLASALFAVPGVSGVYFGHDFISVTKADGVNEW 68

Query: 71  EHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVR 130
             ++P VLG IM+HF SG P++  G       +D     + E+D   V  IK++L+ RVR
Sbjct: 69  PQVKPAVLGAIMDHFQSGRPVLAEGTALA---EDDAEEFYDEADHDTVATIKDLLETRVR 125

Query: 131 PAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           PAVA DGGDI F+GYRDGIV+L M+GACSGCPS++ TL+ GV N+  HF+P V++++ V
Sbjct: 126 PAVAGDGGDITFRGYRDGIVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPSVREVQAV 184


>gi|67458659|ref|YP_246283.1| NifU-like domain-containing protein [Rickettsia felis URRWXCal2]
 gi|67004192|gb|AAY61118.1| NifU-like domain [Rickettsia felis URRWXCal2]
          Length = 190

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 81/181 (44%), Positives = 120/181 (66%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  E  + FS+  E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISSEQPVFFSDISEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P VL +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAESNWQVIKPEVLMVIMDHFVSGFPVFEESTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|302500846|ref|XP_003012416.1| hypothetical protein ARB_01375 [Arthroderma benhamiae CBS 112371]
 gi|291175974|gb|EFE31776.1| hypothetical protein ARB_01375 [Arthroderma benhamiae CBS 112371]
          Length = 264

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 112/203 (55%), Gaps = 14/203 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + +   +     P  S    ++ ++ G  
Sbjct: 32  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 91

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G        
Sbjct: 92  SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAGAEE 151

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 152 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 211

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+ ++L H++ EVK +  V
Sbjct: 212 TLKNGIESMLMHYIEEVKSVTQV 234


>gi|238880174|gb|EEQ43812.1| HIRA-interacting protein 5 [Candida albicans WO-1]
          Length = 262

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/188 (38%), Positives = 110/188 (58%), Gaps = 5/188 (2%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P  +++       F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 32  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-MGSGDFIESDSAV 117
           FIT+ K + +DW  L+P +  ++ E+  +G PI+    + +             E D  V
Sbjct: 92  FITIEKSNNFDWSLLKPEIFSILTEYLTNGTPILLEDNVDEYGNSLLTNDMAINEDDDEV 151

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 152 VSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESM 211

Query: 176 LNHFVPEV 183
           L H++ EV
Sbjct: 212 LKHYIEEV 219


>gi|323451223|gb|EGB07101.1| hypothetical protein AURANDRAFT_54041 [Aureococcus anophagefferens]
          Length = 232

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 77/197 (39%), Positives = 108/197 (54%), Gaps = 15/197 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIH-----FSNAK-EAEISPLASRIFSIPGIASVY 55
           FIQ E TPNP +LKF+P Q VL E         F     E   SPLA ++F+I G+  ++
Sbjct: 19  FIQVEKTPNPFSLKFVPSQAVLGEEHQDKSGFHFHRGDTEYLRSPLAKKLFAIDGVTGIF 78

Query: 56  FGYDFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
              DF+TV   +   W  ++P V G IM+ +  G P        +  L         + D
Sbjct: 79  LARDFVTVSKNEDGAWATIKPHVFGHIMDFYAEGLP------AVEDALPAASDTLITDDD 132

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGV 172
           S VV  IKE+++ R+RPAV  DGGDI F+G+ +    V + + G+C GCPS+S TL+ GV
Sbjct: 133 SEVVAMIKELVEARIRPAVQEDGGDIFFRGFDEATGVVKVELAGSCVGCPSSSVTLRNGV 192

Query: 173 ANILNHFVPEVKDIRTV 189
            N+L H++ EVK I  V
Sbjct: 193 ENMLMHYIAEVKAIENV 209


>gi|108761437|ref|YP_634156.1| NifU family protein [Myxococcus xanthus DK 1622]
 gi|108465317|gb|ABF90502.1| NifU family protein [Myxococcus xanthus DK 1622]
          Length = 188

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 73/189 (38%), Positives = 117/189 (61%), Gaps = 7/189 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAE-ISPLASRIFSIPGIASVYFGYDFI 61
           IQ E TPNP+TLK++  + +L  GA++F+N ++A+  SPLA ++  + G+ +V  G +F+
Sbjct: 5   IQLEWTPNPSTLKYVVDRRLLAGGAVNFTNPEDAQAKSPLARKLMDVRGVTAVMIGTNFV 64

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K ++ +W+ L   V+  +  H  + +P++    L   +     SG        V  R
Sbjct: 65  TVTKGEEGEWDELNDEVMSALDTHLTANEPVVDEAALAAAREAAGPSGG-----GTVEGR 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+++LDN +RPAVA DGGDI    + DGIV+L M+GAC+GCPS++ TLK G+   L   +
Sbjct: 120 IQDILDNEIRPAVAMDGGDITLDRFEDGIVYLHMKGACAGCPSSTATLKMGIEGRLREMI 179

Query: 181 PEVKDIRTV 189
           PEV ++ +V
Sbjct: 180 PEVLEVVSV 188


>gi|332291487|ref|YP_004430096.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332169573|gb|AEE18828.1| nitrogen-fixing NifU domain protein [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 300

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+TLKF+  + ++   A  F +  +   +P+A  +F +P +  V+F  ++I+
Sbjct: 109 VYAESTPNPSTLKFVANKKLVTT-AFEFKSIDDTANAPMAKALFHLPYVKEVFFDENYIS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   D  +W+ +       I ++   G  I+    L   +  +  + +  E+   + + I
Sbjct: 168 VQKYDVAEWDEVVTETREFIRDYIQDGKEIVTAAQLKTPQQAEAIAEEKFETLDDISKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNIIEEYVKPAVASDGGNIMFKNYDPKTQNVSVILQGACSGCPSSTFTLKNGIENMLKQM 287

Query: 180 VPE-VKDIRTV 189
           +P  +  +  +
Sbjct: 288 LPGKINMVEAI 298



 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NPA  KF   Q ++   +  F N  EA  SPLA ++F +P + +VY   +F+ 
Sbjct: 6   ISVEGTSNPAIKKFQADQFLVNHNSYEFKNIDEAANSPLAQQLFYLPFVKTVYITQNFVA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           +   +  +W  ++  V   I ++      +I        
Sbjct: 66  IEKYNIVEWIDVQQEVANQIEDYLNDNGLVIIEDVAAKK 104


>gi|256419768|ref|YP_003120421.1| nitrogen-fixing NifU domain protein [Chitinophaga pinensis DSM
           2588]
 gi|256034676|gb|ACU58220.1| nitrogen-fixing NifU domain protein [Chitinophaga pinensis DSM
           2588]
          Length = 198

 Score =  158 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 72/187 (38%), Positives = 105/187 (56%), Gaps = 3/187 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I TE TPNP T+KF+  +++     I F +   A+ SPLA  +FS P I  V+   +FIT
Sbjct: 11  IYTEMTPNPETMKFVANKLLYPGKHIDFPDEASAKPSPLAVELFSFPFIRGVFIMANFIT 70

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K    DW  + P +   + E+     P+I+   +   K            D+ VV+RI
Sbjct: 71  LTKTPDTDWNDIIPTIKAFLKEYLEDNRPVINEEEIVVTKAAATNEVSA--DDTDVVKRI 128

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           KE+L+N V+PAV  DGG I FK Y DG V L ++G+CSGCPS+  TLK G+  ++   +P
Sbjct: 129 KELLENYVKPAVEMDGGAIQFKDYDDGTVTLMLQGSCSGCPSSMITLKAGIEGMMKRMIP 188

Query: 182 EVKDIRT 188
           EVK++  
Sbjct: 189 EVKEVVA 195


>gi|221104801|ref|XP_002157169.1| PREDICTED: similar to HIRA interacting protein 5 [Hydra
           magnipapillata]
          Length = 267

 Score =  158 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 83/194 (42%), Positives = 114/194 (58%), Gaps = 12/194 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFI+ +DTPNP +LKFIPG  VL  G + F        SPLA ++F I G+ S++FG DF
Sbjct: 59  MFIRVQDTPNPNSLKFIPGCKVLESGTVDFPTPSHGYRSPLARQLFRIKGVRSIFFGKDF 118

Query: 61  ITVGK---DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           IT+ K   D   W  L+P +  +IM+ F S  P++ +                 E D+  
Sbjct: 119 ITISKSDDDDVSWVLLKPDIYAVIMDFFASNLPVLTDDVPA-------QDTIAAEDDNET 171

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+LD R+RP V  DGGDI+FKG+    GIV L ++G+CS CPS+S TLK GV N+
Sbjct: 172 VLLIKELLDTRIRPTVQEDGGDIIFKGFDSVSGIVKLKLQGSCSSCPSSSVTLKNGVQNM 231

Query: 176 LNHFVPEVKDIRTV 189
           +  ++PEV  +  V
Sbjct: 232 MQFYIPEVTGVEEV 245


>gi|50419691|ref|XP_458373.1| DEHA2C15796p [Debaryomyces hansenii CBS767]
 gi|49654039|emb|CAG86455.1| DEHA2C15796p [Debaryomyces hansenii]
          Length = 246

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 108/194 (55%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   ++ E     F + +EA  SPLA ++FSI GI S+ FG +
Sbjct: 29  LFIQTMETPNEHALKFLPSMQIMKENETREFLSGREAACSPLALKLFSIDGIKSIMFGSN 88

Query: 60  FITVG--KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+    +   W  L+P +  ++ E   +G PI++               +  E D   
Sbjct: 89  FITIEKANEDLHWSLLKPEIFSILTEFLNNGTPILNEESEL------TDDMEISEDDDET 142

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  +   +G V+L ++GAC  C S+S TLK G+ ++
Sbjct: 143 VTMIKELIFTRIRPAIQDDGGDIEFVSFAEDNGTVYLRLKGACRSCDSSSVTLKNGIESM 202

Query: 176 LNHFVPEVKDIRTV 189
           L +++ EV  +  V
Sbjct: 203 LKYYIEEVTTVEQV 216


>gi|241959110|ref|XP_002422274.1| nifU-like protein, mitochondrial precursor, putative; protein
           involved in iron metabolism in mitochondria, putative
           [Candida dubliniensis CD36]
 gi|223645619|emb|CAX40278.1| nifU-like protein, mitochondrial precursor, putative [Candida
           dubliniensis CD36]
          Length = 302

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 74/190 (38%), Positives = 111/190 (58%), Gaps = 5/190 (2%)

Query: 1   MFIQTEDTPNPATLKFIPG-QVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P  +++       F + +EA  SPLA ++FSI GI SV FG D
Sbjct: 77  LFIQTSETPNEQALKFLPSIKILQDNQTKEFLSGREAASSPLALKLFSIDGIRSVMFGSD 136

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD-MGSGDFIESDSAV 117
           FIT+ K + +DW  L+P +  ++ E+  +G PI+   G+ +             E D  V
Sbjct: 137 FITIEKLNNFDWSLLKPEIFSILTEYLTNGTPILLEDGVDEDGNSLLTNDMAINEDDDEV 196

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 197 VSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESM 256

Query: 176 LNHFVPEVKD 185
           L H++ EV  
Sbjct: 257 LKHYIEEVNS 266


>gi|219130127|ref|XP_002185224.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403403|gb|EEC43356.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 195

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 112/197 (56%), Gaps = 18/197 (9%)

Query: 1   MFIQTEDTPNPATLKFIP-GQVVLVEGA----IHFSNAKEAEI---SPLASRIFSIPGIA 52
           +FIQT DTPNP +LKF+P G  VL +       + +    A+    SPLA  +F + G+ 
Sbjct: 6   IFIQTADTPNPESLKFVPTGVAVLTDNPDGNGFYVTKNDPAKEILRSPLAKSLFDVEGVK 65

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI 111
           +VY G DF+TV K  ++ W+ LRP +  ++M    S  P +           ++     +
Sbjct: 66  AVYLGGDFVTVTKYAEHKWKILRPQLFDVLMNWADSEKPALLEMP-------EITDTTIM 118

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLK 169
           E D  +V  IKE++++R+RPAV  DGGDI +  + +    V + + G+C GCPS+S TLK
Sbjct: 119 EDDDEIVAMIKELIESRIRPAVQEDGGDIRYVSFEEETGIVTVELAGSCVGCPSSSVTLK 178

Query: 170 YGVANILNHFVPEVKDI 186
            GV N+L H++PEV  +
Sbjct: 179 QGVENMLMHYIPEVSSV 195


>gi|86130774|ref|ZP_01049373.1| NifU-like protein [Dokdonia donghaensis MED134]
 gi|85818185|gb|EAQ39345.1| NifU-like protein [Dokdonia donghaensis MED134]
          Length = 300

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/191 (29%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+T+KF+  + ++   +  F +  +   +P+A  +F  P +  V+F  ++I+
Sbjct: 109 VYAESTPNPSTIKFVANKKLVTT-SFEFKSIDDTANAPMAKALFHFPFVKEVFFDENYIS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   D  +W+ +       I ++   G  I+    L   +  D  + +  E+   V + I
Sbjct: 168 VQKYDMAEWDEVVTETREFIRDYIQDGKEIVTAEQLKTPQQVDAIAEEKFETLDDVSKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+IVFK Y +    V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNIIEEYVKPAVASDGGNIVFKHYDEKTQNVSVILQGACSGCPSSTFTLKNGIENMLKQM 287

Query: 180 VPE-VKDIRTV 189
           +P  +  +  +
Sbjct: 288 LPGKINMVEAI 298



 Score = 64.1 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NPA  KF   Q ++   +  F N  EA  SPLA ++F +P + +VY   +F+ 
Sbjct: 6   ISVEGTSNPAIKKFQADQFLVNHNSYEFKNIDEAANSPLAQQLFYLPFVKTVYIAQNFVA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           +   +  +W  ++  V   + ++      +I        
Sbjct: 66  IEKYNIVEWIDVQQEVANQVEDYLNDNGLVIIEDVAAKK 104


>gi|126131446|ref|XP_001382248.1| hypothetical protein PICST_76567 [Scheffersomyces stipitis CBS
           6054]
 gi|126094073|gb|ABN64219.1| nitrogen fixing protein [Scheffersomyces stipitis CBS 6054]
          Length = 242

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/192 (35%), Positives = 110/192 (57%), Gaps = 8/192 (4%)

Query: 4   QTEDTPNPATLKFI-PGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           QT  TPNP  LKFI P   +L        F++  ++  SPLA R+F IPG+ SV  G +F
Sbjct: 18  QTLPTPNPNALKFISPECNILPMAGKTFEFTSTLQSVHSPLALRLFKIPGVRSVMLGENF 77

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV  +D  +W +LRP V+ ++ +   +         L D    +  S      DS +V 
Sbjct: 78  LTVNKQDHINWANLRPEVVELMDDFLTTKQEPSITKELVDQSQQE--SEVAEAEDSEIVS 135

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+++ R+RPA+  DGGDI +K + +    VFL ++GAC  C S+ +TLK+G+ ++L 
Sbjct: 136 MIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSSSEDTLKHGIESMLM 195

Query: 178 HFVPEVKDIRTV 189
           H++ EV+++  +
Sbjct: 196 HYIEEVREVVQI 207


>gi|239946652|ref|ZP_04698405.1| type Fe-S cluster assembly protein NFU [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|241563470|ref|XP_002401717.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215501909|gb|EEC11403.1| conserved hypothetical protein [Ixodes scapularis]
 gi|239920928|gb|EER20952.1| type Fe-S cluster assembly protein NFU [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 190

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 78/181 (43%), Positives = 118/181 (65%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ ++ +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEIISDQPVFFSELAEVKGRSKLAESLFHINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF++G P+             +         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVAGFPVFEESTKAGNVNHSLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +GIV L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGIVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|255726880|ref|XP_002548366.1| hypothetical protein CTRG_02663 [Candida tropicalis MYA-3404]
 gi|240134290|gb|EER33845.1| hypothetical protein CTRG_02663 [Candida tropicalis MYA-3404]
          Length = 261

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 74/193 (38%), Positives = 110/193 (56%), Gaps = 7/193 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT +TPN   LKF+P   +L E     F + +EA  SPLA ++FSI GI SV +G D
Sbjct: 32  LFIQTSETPNEQALKFLPSIQILGENQTKEFLSGREAACSPLAVKLFSIDGIKSVMYGSD 91

Query: 60  FITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FIT+ K +   W  L+P +  ++ E+  +G PI+       +  DDM   +       VV
Sbjct: 92  FITIEKSENIAWPLLKPEIFSILTEYLTNGSPILLENDKNGIITDDMAFDEDD---DEVV 148

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANIL 176
             IKE++  R+RPA+  DGGDI F  +      V+L ++GAC  C S+S TLK G+ ++L
Sbjct: 149 SMIKELIFTRIRPAIQDDGGDIEFIKFEPDNGTVYLKLKGACRSCDSSSVTLKNGIESML 208

Query: 177 NHFVPEVKDIRTV 189
            H++ EV  +  +
Sbjct: 209 KHYIEEVNSVEPI 221


>gi|238650984|ref|YP_002916840.1| hypothetical protein RPR_06295 [Rickettsia peacockii str. Rustic]
 gi|238625082|gb|ACR47788.1| hypothetical protein RPR_06295 [Rickettsia peacockii str. Rustic]
          Length = 190

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 78/181 (43%), Positives = 118/181 (65%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGLPVFEENTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|260838224|ref|XP_002613749.1| hypothetical protein BRAFLDRAFT_84497 [Branchiostoma floridae]
 gi|229299138|gb|EEN69758.1| hypothetical protein BRAFLDRAFT_84497 [Branchiostoma floridae]
          Length = 263

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 76/191 (39%), Positives = 101/191 (52%), Gaps = 24/191 (12%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP +LKF+PG  VL  G   F N   A  SPLA  +  +            
Sbjct: 64  MFIQTQETPNPNSLKFLPGCEVLETGTFDFPNHSAAHASPLARLVHPLDD---------- 113

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
                D YDW+ L+P +   IM+ F SG PI+ +                   D   VQ 
Sbjct: 114 -----DTYDWQILKPDIFATIMDFFASGLPILTDEPP-------PSDTVIHPDDDETVQM 161

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+LD R+RP V  DGGDIV+ G+     IV L M+G+CS CPS+  TL+ GV N+L  
Sbjct: 162 IKELLDTRIRPTVQEDGGDIVYVGFDQESGIVKLKMQGSCSSCPSSVVTLRSGVQNMLQF 221

Query: 179 FVPEVKDIRTV 189
           ++PEV+ +  V
Sbjct: 222 YIPEVQGVEEV 232


>gi|146423384|ref|XP_001487621.1| hypothetical protein PGUG_00997 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 71/185 (38%), Positives = 108/185 (58%), Gaps = 11/185 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT DTPN   LKF+P   +L E   + F + +EA  SPLA ++FS+ GI SV FG +
Sbjct: 27  LFIQTADTPNEHALKFLPSMSILKENETLEFLSGREAARSPLAVKLFSVDGIKSVMFGSN 86

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  +   W  ++P +  ++ EH  +G P+I++              +  E D  V
Sbjct: 87  FITIEKLANSNQWAVMKPEIFLILTEHLTTGAPVINDEYELS------NDMEINEDDDEV 140

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 141 VAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIESM 200

Query: 176 LNHFV 180
           L H++
Sbjct: 201 LKHYI 205


>gi|15892941|ref|NP_360655.1| hypothetical protein RC1018 [Rickettsia conorii str. Malish 7]
 gi|15620134|gb|AAL03556.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 190

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 78/181 (43%), Positives = 118/181 (65%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEENTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|311745600|ref|ZP_07719385.1| NifU domain protein [Algoriphagus sp. PR1]
 gi|126578163|gb|EAZ82383.1| NifU domain protein [Algoriphagus sp. PR1]
          Length = 193

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 68/187 (36%), Positives = 108/187 (57%), Gaps = 10/187 (5%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
             E  PNP +LKF+   +++ EG +  F +A  AE SPLA  +F+   +  V+   +F+T
Sbjct: 12  YMEANPNPNSLKFVANFMLVDEGVSFDFPDAASAENSPLALELFNFSAVDRVFVASNFVT 71

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V  K+  +W  ++      I ++  SG  +        +K D      F E+DS  V++I
Sbjct: 72  VTKKEDVEWSEVQNIFRDHIKKYLESGQAV--------VKADFDKDPLFDENDSETVKKI 123

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           K +LD  +RPAV +DGG IVF  + DG+V + ++G+CSGCPS++ TLK G+ N+L   +P
Sbjct: 124 KGILDEYIRPAVEQDGGAIVFHSFHDGVVKVLLQGSCSGCPSSTVTLKAGIQNLLTRMLP 183

Query: 182 EVKDIRT 188
           EVK++  
Sbjct: 184 EVKEVEA 190


>gi|34581359|ref|ZP_00142839.1| hypothetical protein [Rickettsia sibirica 246]
 gi|229587020|ref|YP_002845521.1| NifU-like protein [Rickettsia africae ESF-5]
 gi|28262744|gb|EAA26248.1| unknown [Rickettsia sibirica 246]
 gi|228022070|gb|ACP53778.1| NifU-like protein [Rickettsia africae ESF-5]
          Length = 190

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 78/181 (43%), Positives = 118/181 (65%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 1   MFIQTEDTPNPDAITFFPGQEISSDQPVFFSELAEVKGRSKLAESLFYINNVKSVFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEENTKADNVNHNLD------GLSEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|190345080|gb|EDK36900.2| hypothetical protein PGUG_00997 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 236

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/185 (38%), Positives = 108/185 (58%), Gaps = 11/185 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FIQT DTPN   LKF+P   +L E   + F + +EA  SPLA ++FS+ GI SV FG +
Sbjct: 27  LFIQTADTPNEHALKFLPSMSILKENETLEFLSGREAARSPLAVKLFSVDGIKSVMFGSN 86

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           FIT+ K  +   W  ++P +  ++ EH  +G P+I++              +  E D  V
Sbjct: 87  FITIEKSANSNQWAVMKPEIFSILTEHLTTGAPVINDEYELS------NDMEINEDDDEV 140

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE++  R+RPA+  DGGDI F  + +    V+L ++GAC  C S+S TLK G+ ++
Sbjct: 141 VAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIESM 200

Query: 176 LNHFV 180
           L H++
Sbjct: 201 LKHYI 205


>gi|163753913|ref|ZP_02161036.1| thioredoxin-related protein [Kordia algicida OT-1]
 gi|161326127|gb|EDP97453.1| thioredoxin-related protein [Kordia algicida OT-1]
          Length = 301

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/191 (28%), Positives = 97/191 (50%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  + ++ +    F N  E + +PLA  +F  P +  ++   ++I+
Sbjct: 110 IYAESTPNPTVMKFVANKKIV-DRIFEFKNIDETKYAPLAQSLFHFPFVKEIFLDKNYIS 168

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +   D  +W  +   +   I  +   G  +I      + K     S +  E    + + I
Sbjct: 169 ITKYDMVEWNDITMEIREFIRNYIQEGREVISKDIPVEQKEKIQISDESFEELDDISKEI 228

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  ++PAVA DGG+I+F  Y     IV + ++GACSGCPS++ TLK G+ N L + 
Sbjct: 229 VNILEEYIKPAVASDGGNIMFDSYDPNSKIVKVVLQGACSGCPSSTMTLKSGIENTLKNL 288

Query: 180 VP-EVKDIRTV 189
           +  +V ++  +
Sbjct: 289 LKGQVSEVVAI 299



 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 1/128 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NPA +KF     +    +  F N  EA+ SPLA ++F +P + +++   +FI 
Sbjct: 6   ISIEKTSNPAIIKFEASTFLSRHNSYEFKNIDEAKDSPLAQQLFYLPFVKTIFISGNFIA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +   +   WE ++  V   I  +   G  +I         +      +   + + +    
Sbjct: 66  IERYNIVTWEDVQDEVAEQIQNYINEGKEVISESASPKKVVPVTIYAESTPNPTVMKFVA 125

Query: 122 KEVLDNRV 129
            + + +R+
Sbjct: 126 NKKIVDRI 133


>gi|255038627|ref|YP_003089248.1| nitrogen-fixing NifU domain-containing protein [Dyadobacter
           fermentans DSM 18053]
 gi|254951383|gb|ACT96083.1| nitrogen-fixing NifU domain protein [Dyadobacter fermentans DSM
           18053]
          Length = 198

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/195 (33%), Positives = 104/195 (53%), Gaps = 14/195 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEA----EISPLASRIFSIPGIASVYF 56
           F+ TE +PNP ++KF+    ++ +G +  + + + A    + SPLA+ +F  P +  V+ 
Sbjct: 7   FVYTELSPNPNSMKFVLNFELVPDGLSFDYPSLEAALEEGKASPLAADLFQFPHVKRVFI 66

Query: 57  GYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
             +FIT+ K D   WE +       I  +F    P+     +      D  +      DS
Sbjct: 67  ASNFITITKGDDIAWEEVLRDTKQFIKIYFEENHPVFEQKTI------DTNTLIVDARDS 120

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVA 173
             VQ+IK  LD  VRPAV  DGG I F  + +G  +V + ++G+CSGCPS++ TLK G+ 
Sbjct: 121 DTVQKIKAALDQYVRPAVESDGGAINFHSFDEGSGVVKVLLQGSCSGCPSSTLTLKAGIE 180

Query: 174 NILNHFVPEVKDIRT 188
           N+L   VP+VK++  
Sbjct: 181 NLLTRMVPDVKEVVA 195


>gi|326801010|ref|YP_004318829.1| Scaffold protein Nfu/NifU [Sphingobacterium sp. 21]
 gi|326551774|gb|ADZ80159.1| Scaffold protein Nfu/NifU [Sphingobacterium sp. 21]
          Length = 184

 Score =  152 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 106/187 (56%), Gaps = 12/187 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  + +L  G++ F + ++A+ SP A  +F    +  V+F  +F+T
Sbjct: 6   VYTESTPNPATMKFLVNK-LLYNGSLDFPDKEKAQSSPFARELFKFNFVNGVFFASNFVT 64

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  +WE + P +   +     S   I       ++  +           S   ++I
Sbjct: 65  ITKSEDSEWEDILPILKDFVKGAVESELLIHEVERDENVAFEG----------SETEKKI 114

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           ++VL + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+  +L   VP
Sbjct: 115 QQVLHDYVRPAVEQDGGAIAYKSFDEGVVTVELRGSCSGCPSSTITLKAGIEGLLKRMVP 174

Query: 182 EVKDIRT 188
           EV+++  
Sbjct: 175 EVQEVVA 181


>gi|296223650|ref|XP_002757718.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 235

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 74/182 (40%), Positives = 104/182 (57%), Gaps = 15/182 (8%)

Query: 10  NPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-- 67
           NP     +PG+ VL    + F     A  SPLA ++F I G+ SV+FG DFITV K+   
Sbjct: 54  NP-----VPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEE 108

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDN 127
            DW  L+P +   IM+ F SG P++                   E D  VV  IKE+LD 
Sbjct: 109 LDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVVAMIKELLDT 160

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           R+RP V  DGGD+++KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV+ + 
Sbjct: 161 RIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVE 220

Query: 188 TV 189
            V
Sbjct: 221 QV 222


>gi|332664007|ref|YP_004446795.1| nitrogen-fixing NifU domain-containing protein [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332332821|gb|AEE49922.1| nitrogen-fixing NifU domain-containing protein [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 212

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 66/189 (34%), Positives = 106/189 (56%), Gaps = 5/189 (2%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYDFIT 62
            TE TPNP +LKF+  ++ L  G   F     A E SPLA+ +F  P +  VY   +F+T
Sbjct: 22  YTEQTPNPESLKFVTNRM-LYRGTADFREVDLATEWSPLATALFDFPYVRGVYVSNNFVT 80

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG--DFIESDSAVVQ 119
           V K+  Y+W  +   +   I  +   G  ++  G    +   +       +   ++ +VQ
Sbjct: 81  VSKELNYEWPDIMLKLKDFIKNYIEEGGELVKEGFAEHISKIEADRAGVAYTGDEAELVQ 140

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IKE++D  V+PAV  DGG+I FK Y +G VF+ M+G+CSGCPS++ TLK G+  +L   
Sbjct: 141 KIKELIDTYVKPAVEMDGGNIEFKHYENGKVFVLMQGSCSGCPSSTVTLKAGIEGMLKRM 200

Query: 180 VPEVKDIRT 188
           +P+V+++  
Sbjct: 201 IPQVEEVVQ 209


>gi|68472639|ref|XP_719638.1| hypothetical protein CaO19.9614 [Candida albicans SC5314]
 gi|68472898|ref|XP_719514.1| hypothetical protein CaO19.2067 [Candida albicans SC5314]
 gi|46441335|gb|EAL00633.1| hypothetical protein CaO19.2067 [Candida albicans SC5314]
 gi|46441464|gb|EAL00761.1| hypothetical protein CaO19.9614 [Candida albicans SC5314]
          Length = 237

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 108/191 (56%), Gaps = 12/191 (6%)

Query: 5   TEDTPNPATLKFIP---GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPNP  LKFI      + + +    F+   +A  SPLA  +F IPG+ SV  G+DF+
Sbjct: 20  TLPTPNPNALKFISPECNILPMNDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGHDFL 79

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W +LRP ++  + E   S    +    L D    +       E +S ++  
Sbjct: 80  TVNKQDYINWANLRPEIVEQLDEFLTSKKHPVITKELVDEAQREA------EEESELISM 133

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI  KG+ +    VF+ ++GAC  C ++ +TLK+G+ ++L H
Sbjct: 134 IKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESMLMH 193

Query: 179 FVPEVKDIRTV 189
           +V EVK++  +
Sbjct: 194 YVEEVKEVIQI 204


>gi|255723790|ref|XP_002546824.1| hypothetical protein CTRG_01129 [Candida tropicalis MYA-3404]
 gi|240134715|gb|EER34269.1| hypothetical protein CTRG_01129 [Candida tropicalis MYA-3404]
          Length = 237

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 106/191 (55%), Gaps = 11/191 (5%)

Query: 5   TEDTPNPATLKFIPGQVV---LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPNP  LKFI  +     + +    F+   +A  SPLA  +F IPG+ SV  G+DF+
Sbjct: 19  TLPTPNPNALKFISEECNILPMEDKTFEFTTTMQAMHSPLALMLFKIPGVNSVMLGHDFL 78

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W +LRP ++  + E   S    +    L D   ++         DS ++  
Sbjct: 79  TVNKQDYINWANLRPEIVEHLDEFLTSKKQPVITKELIDKANEESE-----MDDSELMSM 133

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI  KG+ +    VF+ ++GAC  C ++ +TLK G+  +L H
Sbjct: 134 IKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKSGIEGMLMH 193

Query: 179 FVPEVKDIRTV 189
           ++ EVK++  V
Sbjct: 194 YIEEVKEVVQV 204


>gi|319953626|ref|YP_004164893.1| nitrogen-fixing nifu domain-containing protein [Cellulophaga
           algicola DSM 14237]
 gi|319422286|gb|ADV49395.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga
           algicola DSM 14237]
          Length = 300

 Score =  151 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  + ++   A  F N  EA+ S LA ++F  P +  V+F  ++ +
Sbjct: 109 VYAESTPNPAVMKFVSNKTIVPT-AFEFKNIDEAKDSELAKKLFHFPFVKEVFFDENYAS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   +  DW  +   +  +I      G  ++    +   K +   +     +     ++I
Sbjct: 168 VTKYEVADWNEVTFDIRELIRNFIADGLEVVSAESVVKKKAEAPKTQLQDANLDDTSKKI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ ++L + 
Sbjct: 228 IDILEEYVKPAVASDGGNIMFKSYDKETKTVNVILQGACSGCPSSTYTLKNGIESMLKNM 287

Query: 180 VPE-VKDIRTV 189
           + + V+++  +
Sbjct: 288 MADHVENVVAI 298



 Score = 65.2 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I   +T NPA LKF     +       + +  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 6   ITIVETNNPAILKFDTNHFITKSNNYEYKDIDEAKNSPLAQQLFYLPFVKTVYISANFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + +    +W+ ++  V   ++E+  SG+P+I          
Sbjct: 66  LERFSIVEWDDVKDEVAQQLVEYLNSGEPVIFEDKDPKKVP 106


>gi|327299030|ref|XP_003234208.1| NifU domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326463102|gb|EGD88555.1| NifU domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 288

 Score =  151 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 108/194 (55%), Gaps = 14/194 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FI+T+ TPN   LKF P   VL EG     + +   +     P  S    ++ ++ G  
Sbjct: 72  IFIETDTTPNADALKFRPNHPVLPEGFPVSFLEYLTPRSTLQPPYPSPLAAKLLNVDGAV 131

Query: 53  SVYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIH-----NGGLGDMKLDDMG 106
           SV+FG DFITV KD   +W H++P +  +I E    G+ +++      G  G    +   
Sbjct: 132 SVFFGSDFITVTKDSDANWAHIKPEIFSLITEAITRGEALVNVVDVRQGKEGAEGAEAEE 191

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
           +  + E D  VV  I+E+L+ R+RPA+  DGGDI F+G+ +G V L +RGAC  C S++ 
Sbjct: 192 AVRYNEEDEEVVGMIQELLETRIRPAIQEDGGDIEFRGFENGNVLLKLRGACRTCDSSTV 251

Query: 167 TLKYGVANILNHFV 180
           TLK G+ ++L H+V
Sbjct: 252 TLKNGIESMLMHYV 265


>gi|260949769|ref|XP_002619181.1| hypothetical protein CLUG_00340 [Clavispora lusitaniae ATCC 42720]
 gi|238846753|gb|EEQ36217.1| hypothetical protein CLUG_00340 [Clavispora lusitaniae ATCC 42720]
          Length = 237

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 72/191 (37%), Positives = 109/191 (57%), Gaps = 8/191 (4%)

Query: 5   TEDTPNPATLKFI-PGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPN   LKF+ P   +         FS + +A  SPLA ++F + G+ SV  G+DF+
Sbjct: 18  TYPTPNENALKFVSPEAEISPLKNKTFEFSTSLQAVHSPLALKLFKLNGVKSVMIGHDFL 77

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K D  +W HLRP V+ ++     S D  +    L     +D  S    E+DS VV  
Sbjct: 78  TVNKLDHVNWAHLRPEVVKLLDSFLTSKDEPVITKELIQQGEND--SLSASENDSEVVSM 135

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE++D R+RPA+  DGGDI +K + +    VFL ++GAC  C ++ +TLK G+ ++L H
Sbjct: 136 IKELIDTRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKGGIESMLMH 195

Query: 179 FVPEVKDIRTV 189
           ++ EVK++  +
Sbjct: 196 YIEEVKEVVQI 206


>gi|157964815|ref|YP_001499639.1| NifU-like protein [Rickettsia massiliae MTU5]
 gi|157844591|gb|ABV85092.1| NifU-like protein [Rickettsia massiliae MTU5]
          Length = 191

 Score =  150 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 77/181 (42%), Positives = 117/181 (64%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQT DTPNP  + F PGQ +  +  + FS   E +  S LA  +F I  + SV+FG D
Sbjct: 2   MFIQTADTPNPDAITFFPGQEISSDQPVFFSELAEVQGRSKLAESLFHINNVKSVFFGSD 61

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P +L +IM+HF+SG P+       D    ++         S + 
Sbjct: 62  FITVTKQAEGNWQVIKPEILMVIMDHFVSGFPVFEENTKADNVNHNLD------GLSEIE 115

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 116 KQIVEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKH 175

Query: 179 F 179
           F
Sbjct: 176 F 176


>gi|298206804|ref|YP_003714983.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559]
 gi|83849436|gb|EAP87304.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559]
          Length = 305

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 99/196 (50%), Gaps = 10/196 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP+ LKF+  + ++V+ +  F +  +   +PLA  +F+ P +  ++   ++++
Sbjct: 109 IYAESTPNPSVLKFVANKKLVVQ-SEEFKSIDDTANAPLAQALFNFPFVKEIFIDENYVS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE-----SDSA 116
           +   D  +W  +   +   I +H +SG P++       +     G               
Sbjct: 168 IQKYDMAEWGDITTELRDFISQHIMSGKPVVTEHRANKLAPQTNGGTTEKPQLDLSHLDD 227

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVAN 174
             + I E+LD  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK G+  
Sbjct: 228 TSKAIVEILDEYIKPAVASDGGNIMFDSYDEETKSVKVILQGACSGCPSSTMTLKNGIET 287

Query: 175 ILNHFVPE-VKDIRTV 189
           +L   +   V+ +  +
Sbjct: 288 MLRDMLNGKVEHVVAI 303



 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  + T NP+ LKF   + +    +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 5   IDIQSTSNPSILKFETNKFLSRHDSFEFHNIDEAKPSPLAQKLFYLPFVKTVYIAQNFIA 64

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           +   D  +W  ++  V   I+E+  SG+ +I +       +
Sbjct: 65  IQKYDIAEWSDVQDEVKSQILEYLNSGEDVIIDKTPQKKSV 105


>gi|42523787|ref|NP_969167.1| nifU related protein [Bdellovibrio bacteriovorus HD100]
 gi|39575994|emb|CAE80160.1| nifU related protein [Bdellovibrio bacteriovorus HD100]
          Length = 186

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 77/188 (40%), Positives = 112/188 (59%), Gaps = 11/188 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPAT+KF+  + V  +G       +EAE SPLA++IF  P  +SVY G DFIT
Sbjct: 9   VSFEPTPNPATMKFLLHKKVTDQG-FDCPTVQEAERSPLAAKIFGFPWTSSVYVGPDFIT 67

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V  +D  DWE L  P+ G+I EH    +P++      +            E+DS +V+ I
Sbjct: 68  VTKQDWVDWELLAHPLSGLIQEHLDRDEPVVVTFVEAEED---------NENDSPMVRNI 118

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           K VL+  +RP VA DGGDIVF  Y + ++++ M+GACSGCPS++ TLK G+   +    P
Sbjct: 119 KSVLNREIRPVVALDGGDIVFHKYENNVLYIHMKGACSGCPSSTVTLKEGIEVRMKELFP 178

Query: 182 EVKDIRTV 189
           E+ ++ +V
Sbjct: 179 EIVEVVSV 186


>gi|241950625|ref|XP_002418035.1| conserved hypothetical protein [Candida dubliniensis CD36]
 gi|223641374|emb|CAX43334.1| conserved hypothetical protein [Candida dubliniensis CD36]
          Length = 237

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/191 (36%), Positives = 109/191 (57%), Gaps = 12/191 (6%)

Query: 5   TEDTPNPATLKFI-PGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPNP  LKFI P   +L   +    F+   +A  SPLA  +F IPG+ SV  GYDF+
Sbjct: 20  TLPTPNPNALKFISPECNILPMEDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGYDFL 79

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W +LRP ++  + E   S    +    L D    +       E +S ++  
Sbjct: 80  TVNKQDYINWANLRPEIVEHLDEFLTSKKHPVITKELVDEAQREA------EEESELISM 133

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI  KG+ +    VF+ ++GAC  C ++ +TLK+G+ ++L H
Sbjct: 134 IKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESMLMH 193

Query: 179 FVPEVKDIRTV 189
           +V EVK++  +
Sbjct: 194 YVEEVKEVIQI 204


>gi|238881874|gb|EEQ45512.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 237

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 108/191 (56%), Gaps = 12/191 (6%)

Query: 5   TEDTPNPATLKFIP---GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPNP  LKFI      + + +    F+   +A  SPLA  +F IPG+ SV  G+DF+
Sbjct: 20  TLPTPNPNALKFISPECNILPMNDKTFEFTTTLQAIHSPLALTLFKIPGVKSVMLGHDFL 79

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W +LRP ++  + E   S    +    L D    +       E +S ++  
Sbjct: 80  TVNKQDYINWANLRPGIVEQLDEFLTSKKHPVITKELVDEAQREA------EEESELISM 133

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI  KG+ +    VF+ ++GAC  C ++ +TLK+G+ ++L H
Sbjct: 134 IKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESMLMH 193

Query: 179 FVPEVKDIRTV 189
           +V EVK++  +
Sbjct: 194 YVEEVKEVIQI 204


>gi|116781621|gb|ABK22181.1| unknown [Picea sitchensis]
          Length = 181

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/169 (42%), Positives = 99/169 (58%), Gaps = 8/169 (4%)

Query: 23  LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMI 81
           +  G+  F NA+ A  SPLA  ++ I G+A ++FG DFITV K ++  W+ L+P +   I
Sbjct: 1   MEVGSADFPNARVAMGSPLAKSLYGIDGVARIFFGSDFITVTKSEEVSWDILKPEIFAAI 60

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           M+ + SG P+  +   G             E D   V  IKE+L+ R+RPAV  DGGDI 
Sbjct: 61  MDFYSSGQPLFLDSKSGAP-----TDTAINEDDDETVAMIKELLETRIRPAVQDDGGDIE 115

Query: 142 FKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           + G+      V L M+GACSGCPS+S TLK G+ N+L H+VPEVK +  
Sbjct: 116 YCGFDPETGVVKLKMQGACSGCPSSSLTLKSGIENMLMHYVPEVKGVEQ 164


>gi|86140721|ref|ZP_01059280.1| NifU-like domain protein [Leeuwenhoekiella blandensis MED217]
 gi|85832663|gb|EAQ51112.1| NifU-like domain protein [Leeuwenhoekiella blandensis MED217]
          Length = 301

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/191 (29%), Positives = 97/191 (50%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA LKF+  + ++ E  + F N  EA+ +PLA  +F  P +  V+   ++++
Sbjct: 110 VYAESTPNPAVLKFVTNKKIVTE-TLEFKNIDEAKNAPLALALFHFPFVKEVFMDSNYVS 168

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   D  +W+ +   V   I  +   G  II        +  +       E+     + I
Sbjct: 169 VQKYDVAEWDDVFQEVREFIKTYIEEGKEIISENFKKTPQAVEEQKEVEFEAMDDTSKEI 228

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 229 ANIIEEYVKPAVASDGGNILFKHYDPESKNVKVILQGACSGCPSSTFTLKNGIENMLKEM 288

Query: 180 VPE-VKDIRTV 189
           +   +  +  +
Sbjct: 289 LRGKINSVEAI 299



 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 52/137 (37%), Gaps = 1/137 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NPA  KF     ++   +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 6   ITIEPTSNPAIKKFQANSFLVDHNSYEFKNIDEAKNSPLAQQLFYLPFVKTVYISQNFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  +W  ++  +   I         +I        K+      +   + + +    
Sbjct: 66  IEKFNIVEWIDIQDELSAQIENFLNDNGVVIIEDATSVKKVPVTVYAESTPNPAVLKFVT 125

Query: 122 KEVLDNRVRPAVARDGG 138
            + +          D  
Sbjct: 126 NKKIVTETLEFKNIDEA 142


>gi|76155328|gb|AAX26597.2| SJCHGC03039 protein [Schistosoma japonicum]
          Length = 222

 Score =  149 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 8/177 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PGQ VL  G   F + K+A  SPLA ++F I G+  V+FG DF
Sbjct: 53  LFIQAQETPNPNSLKYFPGQAVLGSGTRDFPSRKQAGSSPLARQLFRIEGVEQVFFGPDF 112

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           IT+   + ++W  ++P V   IM+ + SG P+I      +       S    E D   V 
Sbjct: 113 ITITKNNDFEWAVIKPDVYATIMDFYSSGQPVIDEEKSQE-------SDKPCEVDDETVL 165

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            IKE+LD R+RP V  DGGDI++KG++DGIV L ++G+CS CPS+  TLK GV N+L
Sbjct: 166 MIKELLDTRIRPTVQEDGGDIIYKGFKDGIVLLKLQGSCSSCPSSVVTLKNGVQNML 222


>gi|149248632|ref|XP_001528703.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448657|gb|EDK43045.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 248

 Score =  149 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/194 (34%), Positives = 108/194 (55%), Gaps = 9/194 (4%)

Query: 5   TEDTPNPATLKFI-PGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T  TPN   LKFI P   +L        F++  +A  SPLA ++F IPG+ S+  G+DF+
Sbjct: 21  TASTPNENALKFISPESPILPVANTTFEFNSTLQAIHSPLALQLFKIPGVKSIMLGHDFL 80

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK---LDDMGSGDFIESDSAV 117
           TV K D +DW  L P V+ ++ +             +   +     +       E DS +
Sbjct: 81  TVNKLDNHDWNSLSPEVMDVMNKFLDKAGENSGKVPVVTQELLNKAESERLAEDEDDSEL 140

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
           V  IKE+++ R+RPA+  DGGDI +KG+ +    VFL ++GAC  C ++ +TLK G+ ++
Sbjct: 141 VLMIKELIETRIRPAIQDDGGDIEYKGFDEETGTVFLKLQGACKSCSASEDTLKGGIESM 200

Query: 176 LNHFVPEVKDIRTV 189
           L H++ EVK+++ +
Sbjct: 201 LMHYIEEVKEVQQI 214


>gi|300175875|emb|CBK21871.2| Scaffold protein Isu1 [Blastocystis hominis]
          Length = 271

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 72/194 (37%), Positives = 109/194 (56%), Gaps = 11/194 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLV-----EGAIHFSNAKEAEISPLASRIFSIPGIASVY 55
           +F+Q ++TPNP   KF+P   + V        + F+  KEA  SPLAS++F IP + SV 
Sbjct: 28  LFVQIKETPNPDVQKFLPTPSISVLPSEFGHTMEFNTTKEARASPLASKLFDIPEVKSVL 87

Query: 56  FGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
            G D+I V + +  +WE+L P +   I++ F S D   H   +           +  ++D
Sbjct: 88  LGNDYICVTRQKGVEWEYLNPAIFHTILDFFSSPD---HEAVVLKPDEIPEDPNEIKDTD 144

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGV 172
           S VV+ IKE+LD R+RP +  DGGDI F  + +    + + M GAC GC S+S TLK GV
Sbjct: 145 SEVVRLIKELLDTRIRPRIKADGGDIFFHTFDESSGELLVRMTGACKGCASSSVTLKQGV 204

Query: 173 ANILNHFVPEVKDI 186
             ++ H++PEV  +
Sbjct: 205 EQMMKHYIPEVVTV 218


>gi|91216703|ref|ZP_01253668.1| nifU related protein [Psychroflexus torquis ATCC 700755]
 gi|91185172|gb|EAS71550.1| nifU related protein [Psychroflexus torquis ATCC 700755]
          Length = 302

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/181 (30%), Positives = 103/181 (56%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + +++E +  F +  +AE+SPLA ++F  P +  ++   ++I+
Sbjct: 111 VYAESTPNPSVMKFVANKKLVLE-SAEFKSIDDAELSPLAQKLFHFPFVKEIFMDDNYIS 169

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +   D  +WE +   + G I ++   G  I+ +G +   K +         +   + + I
Sbjct: 170 INKYDMAEWEEITNELRGFIKDYLEEGGKILESGKVQSKKTEAPSPEIDTSNLDDISKEI 229

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+FK Y      V + ++GACSGCPS++ TLK G+ ++L   
Sbjct: 230 VQILEEYVKPAVASDGGNIMFKSYNAESKDVQVILQGACSGCPSSTITLKNGIESMLKEM 289

Query: 180 V 180
           +
Sbjct: 290 L 290



 Score = 56.0 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           ++ + T  P+ LKF   + +  +    + N +EA  SP+AS++F +P + +VY   +FI 
Sbjct: 6   VEIKPTNKPSILKFEFNEFLTKQKGYEYHNIEEAMKSPIASQLFYLPFVKTVYISQNFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + K +  +W  ++  +   +++H   G  I+       +  
Sbjct: 66  IEKFNIVEWADVQNEISEQLLKHMNDGGKIVDEKEENSVSK 106


>gi|332519966|ref|ZP_08396430.1| nitrogen-fixing NifU domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332044525|gb|EGI80719.1| nitrogen-fixing NifU domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 300

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + +    A  F    +A+ SPLA+ +F +P + SV+   ++++
Sbjct: 109 VYAESTPNPSVIKFVANKKIANA-AYEFVTIDDAKPSPLATELFHLPFVKSVFIDENYVS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   D  +W+ +   +   I  +   G  II       ++          E+     + I
Sbjct: 168 VTKYDVAEWQEITNELREFIRSYIEDGKEIISANAPEAIEKSTKNVDAHFETLDDTSKEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  V+PAVA DGG+I F+ Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNILEEYVKPAVASDGGNIQFESYNADTKTVKVILQGACSGCPSSTFTLKNGIENMLKEM 287

Query: 180 VPE-VKDIRTV 189
           +   V  +  +
Sbjct: 288 LKGKVNTVEAI 298



 Score = 58.7 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  ++T N + +KF   Q +    +  F+N  EA+ SPLA  +F +P +  VY   +FI 
Sbjct: 6   VTIQETSNNSIIKFELNQFITQHQSFEFNNIDEAKESPLAQELFYLPFVKKVYITSNFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + + +  +W+ ++  V   I  +   G  +I          
Sbjct: 66  IERFNIVEWKDVQDEVSEQIKAYLNKGGIVITENATSKKVP 106


>gi|157826074|ref|YP_001493794.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford]
 gi|157800032|gb|ABV75286.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford]
          Length = 190

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 78/181 (43%), Positives = 119/181 (65%), Gaps = 8/181 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEI-SPLASRIFSIPGIASVYFGYD 59
           MFIQTEDTPNP  +KF PGQ +  +  + FS   E +  S LA  +F I  + S++FG D
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISSDQPVFFSELAEVKGRSKLAESLFHINNVKSIFFGSD 60

Query: 60  FITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           FITV K  + +W+ ++P VL +IM+HF++G P+       D    ++         S + 
Sbjct: 61  FITVTKQAEGNWQIIKPEVLMIIMDHFVAGFPVFEESTKADTVNHNIDGF------SEIE 114

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           ++I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L H
Sbjct: 115 KQIIEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACRGCPSSTITLKNGIESMLKH 174

Query: 179 F 179
           F
Sbjct: 175 F 175


>gi|225011341|ref|ZP_03701795.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
 gi|225004524|gb|EEG42492.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
          Length = 301

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP+ +K++  ++++      F N  EA+ +PLA  +F +P +  V+   ++I+
Sbjct: 110 IYAESTPNPSVMKYVANKLIVPA-LFEFKNIDEAKDAPLAKELFLMPFVKEVFMDQNYIS 168

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   D  +WE +   +   I    +SG   +    +   K     +    ++     ++I
Sbjct: 169 VTKYDVAEWEEINNELREKIRLFLMSGQESVGANTVQKEKEKAPTTLLHTDNLDDTSKQI 228

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK G+ N+L + 
Sbjct: 229 VDILEEYVKPAVASDGGNIMFDSYDEVSKTVNVILQGACSGCPSSTFTLKNGIENMLKNM 288

Query: 180 V-PEVKDIRTV 189
           +  +V  +  +
Sbjct: 289 MGDKVAQVIAI 299



 Score = 70.6 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 2  FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           I    T NP  +KF     +  +    F N  +A+ SPLA ++F +P + +VY   +FI
Sbjct: 6  HITIIPTNNPNIMKFETNHFISPDKNYEFQNIDQAKESPLAQQLFHLPFVKTVYISSNFI 65

Query: 62 TV-GKDQYDWEHLRPPVLGMIMEHFIS 87
           +   D   WE ++  +   ++++  +
Sbjct: 66 GIEKYDIVGWEDIKDSLGQQLVDYLNT 92


>gi|325286802|ref|YP_004262592.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga lytica
           DSM 7489]
 gi|324322256|gb|ADY29721.1| nitrogen-fixing NifU domain-containing protein [Cellulophaga lytica
           DSM 7489]
          Length = 300

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 105/190 (55%), Gaps = 5/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E+TPNPA ++F+  ++++      F N +EA+ S LA+ +F  P +  V+   ++I+
Sbjct: 109 VYAENTPNPAAMRFVANKLIVPT-IFEFKNKEEAKDSDLATTLFQFPYVKEVFLDENYIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D+ DW  +   +   I      G  ++    +   K +   +    E+     ++I
Sbjct: 168 VTKTDEADWNEITLELRESIQAFLTEGKEVVSANSISKQKQEAPATQLQDENLDDTSKQI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+FK Y +    V + ++GACSGCPS++ TLK G+ N+L + 
Sbjct: 228 IDILEEYVKPAVASDGGNIMFKSYDENTKKVNVILQGACSGCPSSTFTLKNGIENMLKNM 287

Query: 180 V-PEVKDIRT 188
           +  ++ ++  
Sbjct: 288 MGDKIGEVVA 297



 Score = 67.5 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I    T NPA LKF     +    +  + N  EA+ SPLA ++F +P I +VY   +FI 
Sbjct: 6   ITIYTTTNPAILKFETNHFITKNNSYEYKNIDEAKNSPLAQQLFYLPFIKTVYISGNFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + + D   W+ +R  V   ++++  SG+ ++H         
Sbjct: 66  LERFDIVAWDDVRDEVAQQLVDYLNSGEVVVHEQEDPQSVP 106


>gi|312885490|ref|ZP_07745129.1| Scaffold protein Nfu/NifU [Mucilaginibacter paludis DSM 18603]
 gi|311302070|gb|EFQ79100.1| Scaffold protein Nfu/NifU [Mucilaginibacter paludis DSM 18603]
          Length = 182

 Score =  147 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/187 (34%), Positives = 109/187 (58%), Gaps = 13/187 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KFI  + +L+ G++ ++  + AE SP A  +F    +  V+F  +F+T
Sbjct: 5   VYTESTPNPATMKFIVNK-LLINGSVDYATRESAEKSPFAKELFKFSFVNGVFFASNFVT 63

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K +  DW  L P +   +     S            +++ +     F  +D+ +  +I
Sbjct: 64  VTKTEGSDWNDLEPILKEFVKGAVES---------ELLVQIKEQEEVAFEGTDAEI--KI 112

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +++L + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+ N+L   VP
Sbjct: 113 QQILQDYVRPAVEQDGGAITYKSFNEGVVTVELRGSCSGCPSSTITLKSGIENLLKRMVP 172

Query: 182 EVKDIRT 188
           EV ++ +
Sbjct: 173 EVTEVVS 179


>gi|255532822|ref|YP_003093194.1| nitrogen-fixing NifU domain-containing protein [Pedobacter
           heparinus DSM 2366]
 gi|255345806|gb|ACU05132.1| nitrogen-fixing NifU domain protein [Pedobacter heparinus DSM 2366]
          Length = 183

 Score =  147 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/187 (34%), Positives = 105/187 (56%), Gaps = 12/187 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  + +L+ G+  F+  + AE SP A  +F    +  V+F  +F+T
Sbjct: 5   VYTEQTPNPATMKFMVNK-LLINGSEDFATKESAEHSPFAKELFKFSFVNGVFFASNFVT 63

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K +  +W  + P +   +     S   I  +        +           S +  +I
Sbjct: 64  VTKTEDAEWADIEPILKEFVKGAVESEYKIKEDTSAEAPAFEG----------SDLEIKI 113

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +++L + VRPAV +DGG I +K + DG+V + +RG+CSGCPS++ TLK G+ N+L   VP
Sbjct: 114 QQILHDYVRPAVEQDGGAISYKSFDDGVVTVELRGSCSGCPSSTITLKSGIQNLLQRMVP 173

Query: 182 EVKDIRT 188
           EVK++ +
Sbjct: 174 EVKEVVS 180


>gi|294659524|ref|XP_461916.2| DEHA2G08492p [Debaryomyces hansenii CBS767]
 gi|199434030|emb|CAG90379.2| DEHA2G08492p [Debaryomyces hansenii]
          Length = 240

 Score =  147 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 66/191 (34%), Positives = 108/191 (56%), Gaps = 9/191 (4%)

Query: 5   TEDTPNPATLKFI-PGQVVLV--EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           T +TPNP  LKFI P   +L        F++  +A  SPLA ++F + G+ S+  G DF+
Sbjct: 22  TLETPNPNALKFISPECQILPIPSKTFEFTSTLQAIHSPLALKLFKLHGVRSIMLGEDFL 81

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W  LRP V+ ++     S    +    L +    ++ S +    DS +V  
Sbjct: 82  TVNKQDHINWAQLRPEVVDLLDGFLTSKKESVVTKELIEESEREIESSE---DDSEIVSM 138

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI FKG+ +    VFL ++GAC  C S+ +TLK G+  ++ H
Sbjct: 139 IKELIETRIRPAIQDDGGDIEFKGFDEETGNVFLKLQGACKTCSSSEDTLKNGIEQMMKH 198

Query: 179 FVPEVKDIRTV 189
           ++  V+++  +
Sbjct: 199 YIDGVQEVIQI 209


>gi|303274691|ref|XP_003056661.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461013|gb|EEH58306.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 190

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/177 (42%), Positives = 113/177 (63%), Gaps = 9/177 (5%)

Query: 16  FIPGQVVLVEGA-IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYD-WEHL 73
           F+PG+ V  +   ++F+  +EA  SPLA ++F+I G+ SV+FG D++TV K++   W  L
Sbjct: 2   FMPGKPVNPDAPPLNFATPREAMASPLAKKLFAIDGVVSVFFGADYVTVTKNETHEWGVL 61

Query: 74  RPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAV 133
           +P V   +M+H+ SGDP++ +                 + D  +V  IKE+L+ R+RPAV
Sbjct: 62  KPEVFAAVMDHYASGDPLVSDDAELVA-----AGTAIADDDDEIVAMIKELLETRIRPAV 116

Query: 134 ARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           A DGGDIV+KG+ +    V + MRGAC GCPS+S TLK G+ N+L H+VPEVK++  
Sbjct: 117 AEDGGDIVYKGWDESTGVVTVQMRGACDGCPSSSVTLKSGIENMLRHYVPEVKEVVQ 173


>gi|221103919|ref|XP_002156303.1| PREDICTED: similar to GK25604 [Hydra magnipapillata]
          Length = 192

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/195 (32%), Positives = 103/195 (52%), Gaps = 14/195 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEG-AIHFSN----AKEAEISPLASRIFSIPGIASVYF 56
            I TE +PNP ++KF+    +  EG    + +     +E++ SPLA  +F  P +  ++ 
Sbjct: 1   MIYTELSPNPNSMKFVLNFELAPEGLTFDYPSLASTVEESKASPLAGDLFQFPFVRRIFI 60

Query: 57  GYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
             +FIT+ KD   +WE +   +   +   F   +P+     +      D  +     +DS
Sbjct: 61  ASNFITITKDDETEWEDIVYDIKKFMKIFFEQNNPVFAQKTI------DKNTLIVDANDS 114

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVA 173
           AV+ +IK  LD  VRPAV  DGG I F  + +  G V + ++G+CSGCPS++ TLK G+ 
Sbjct: 115 AVIAKIKSTLDQYVRPAVESDGGAINFASFDEISGQVKVYLQGSCSGCPSSTVTLKDGIE 174

Query: 174 NILNHFVPEVKDIRT 188
            +L   VPEVK++  
Sbjct: 175 RLLKTMVPEVKEVVA 189


>gi|149369678|ref|ZP_01889530.1| thioredoxin-related protein [unidentified eubacterium SCB49]
 gi|149357105|gb|EDM45660.1| thioredoxin-related protein [unidentified eubacterium SCB49]
          Length = 306

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 99/197 (50%), Gaps = 11/197 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNPA LKF+  + ++  G   F N  +A+ +PLA+ +F+ P +  V+   ++I+
Sbjct: 109 IYGETTPNPAVLKFVANKPLVT-GTFDFKNIDDAKHAPLATALFNFPFVKEVFMSNNYIS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMG------SGDFIESDS 115
           V   D  +W+ +   +   I  +   G  I  +  L +   ++             +S S
Sbjct: 168 VMKYDIAEWDEISMQLREFIRSYIEDGKEIFTDAMLNETIKEEQKAVASPTENGSDKSYS 227

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVA 173
            +   I ++LD  ++PAVA DGG I F  Y      V + ++GACSGCPSA+ TLK G+ 
Sbjct: 228 DIDNEIMDILDEYIKPAVASDGGHIAFDSYDANTKTVKVILQGACSGCPSATVTLKNGIE 287

Query: 174 NILNHFVPE-VKDIRTV 189
            +L   +   V+ +  +
Sbjct: 288 TMLRDMMKGRVEIVEAI 304



 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  + T N   +KF+    +    +  F N +EA  SP+A ++F +P + +VY   +FI 
Sbjct: 6   IIIQPTNNENIVKFVANSFLTQAKSYEFKNIEEAVESPIAQQLFYLPFVKTVYISQNFIA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           +   +   W+ ++  V   I E+  SG P+++       
Sbjct: 66  IEKYNIVSWDMVQDEVAESINEYIESGKPVVNESADKKK 104


>gi|300776224|ref|ZP_07086083.1| nitrogen-fixing NifU [Chryseobacterium gleum ATCC 35910]
 gi|300505357|gb|EFK36496.1| nitrogen-fixing NifU [Chryseobacterium gleum ATCC 35910]
          Length = 292

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 94/192 (48%), Gaps = 9/192 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFI 61
           I  E TPNP  +KF+  ++++ EG +   +   AE  PLA  IF        V+   +F+
Sbjct: 103 IYAEMTPNPNVMKFVSSKLLM-EGFVEVKSKDAAEEVPLAQAIFKEFDFATEVFISDNFV 161

Query: 62  TVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
            V +D   +W  +   V  +I E+  +G  I     +   K ++          +   Q+
Sbjct: 162 AVTRDNSVEWHQVMMTVRALIAEYLQNGGEI---SKIEPQKHENPVEKIINRDYTEDEQK 218

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNH 178
           I ++L+  V PAV  DGG I    Y        + ++GACSGCPS++ TLK G+ NIL  
Sbjct: 219 ISDILNEYVAPAVENDGGKISLMEYDQENKTAKMLLQGACSGCPSSTATLKNGIENILKQ 278

Query: 179 FVPE-VKDIRTV 189
           FVP+ V+ +  V
Sbjct: 279 FVPDLVEKVEAV 290



 Score = 54.4 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 42/95 (44%), Gaps = 2/95 (2%)

Query: 5  TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV- 63
           E T NP  +KF+    ++  G++      +    PLA  +F+ P +  ++   +F+ V 
Sbjct: 6  IEPTENPKVMKFVADYNLIP-GSLELDRNSDISEIPLAQELFNYPFVERIFITANFVAVA 64

Query: 64 GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG 98
           +D  +WEH+   +  +I +  ++   I       
Sbjct: 65 KQDTVEWEHVAESLKNVIEDELLANPRIYLQKKKE 99


>gi|225012214|ref|ZP_03702651.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
 gi|225003769|gb|EEG41742.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-2A]
          Length = 295

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/191 (29%), Positives = 102/191 (53%), Gaps = 9/191 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  + ++   ++ F N  EA+ +PLA ++F +P +  V+   ++++
Sbjct: 108 VYAESTPNPAVMKFVANKPLV-SHSVEFKNIDEAKNAPLAQKLFHLPFVKEVFIDANYVS 166

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  +WE +   V   I      G+ I+    +         S     + +A  ++I
Sbjct: 167 ITKFEVTEWEEVVMEVREFIRAFIEEGNVILTEAPIAIEIDQKNQSS----NLTATEEQI 222

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +LD  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK G+  +L   
Sbjct: 223 VSILDEYIKPAVASDGGNIMFDSYDEVEKEVHVVLQGACSGCPSSTFTLKNGIETMLKEM 282

Query: 180 VPE-VKDIRTV 189
           +P  +  +  V
Sbjct: 283 MPGKIATVIAV 293



 Score = 42.9 bits (99), Expect = 0.023,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 39/98 (39%), Gaps = 1/98 (1%)

Query: 16  FIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-DQYDWEHLR 74
           F   Q +  +  +HF N  EA+ +PL  ++F +P + SV      ++V + D  +WE + 
Sbjct: 19  FEVDQEIGPKEIVHFKNIDEAKGAPLIQQLFYLPFVKSVSLSEKKVSVERFDILEWEEVI 78

Query: 75  PPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
             V   +  +   G  +I       + +          
Sbjct: 79  DEVKEQLQTYLNEGGVVIETQRNDKIPVSVYAESTPNP 116


>gi|260060626|ref|YP_003193706.1| nifU related protein [Robiginitalea biformata HTCC2501]
 gi|88784756|gb|EAR15925.1| nifU related protein [Robiginitalea biformata HTCC2501]
          Length = 300

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 102/191 (53%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +K++  + ++ +    F +  +A  SPLA ++F  P +  V+  +++I+
Sbjct: 109 VYAEVTPNPAVMKYVANKQLVPD-VFEFKDIDQARHSPLAQKLFGFPFVKEVFMDHNYIS 167

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V   +  +WE +   +   I E+  +G  ++  G   +           +E    + Q I
Sbjct: 168 VTKYEVAEWEDVSMELREFIREYLAAGGEVLEPGASAEKSQIAGVPEGNLEQMDPISQEI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  V+PAVA DGG+IVF+ Y      V + ++GACSGCPS++ TLK G+  +L + 
Sbjct: 228 AGILEEYVKPAVASDGGNIVFQSYEAESKTVHVILQGACSGCPSSTFTLKNGIQTMLQNM 287

Query: 180 VPE-VKDIRTV 189
           + + V ++  +
Sbjct: 288 MGDRVNEVVAI 298



 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  ++T NPA LKF   Q ++ +G+  + N  EA+ SPLA ++F +P I +VY   +F+ 
Sbjct: 6   ITLKETNNPAILKFEANQPLVTKGSYEYKNIDEAKDSPLAQQLFYLPFIKTVYISGNFVA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG 98
           + + D   W+ ++  V   ++E+  +G+P++      
Sbjct: 66  MERFDIVTWDDVKQEVAQQLVEYLNAGEPVVDEPEQA 102


>gi|305665213|ref|YP_003861500.1| NifU-like protein [Maribacter sp. HTCC2170]
 gi|88709966|gb|EAR02198.1| nifU related protein [Maribacter sp. HTCC2170]
          Length = 300

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 106/190 (55%), Gaps = 5/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + ++   A  F N  EA+ S LA ++F +P +  V+F  ++++
Sbjct: 109 VYAEVTPNPSVMKFVSNKRIVPT-AFEFKNIDEAKDSALAQQLFQLPFVKEVFFDENYVS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  +WE +  P+  M+ +    G+ ++    +     +   S    ES     ++I
Sbjct: 168 VNKFDVAEWEDITMPLREMVRDFLAEGNEVVTVSAITLKSAEAPKSQLNNESLDDTSKQI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
            ++L+  V+PAVA DGG+I+F+ Y      V + ++GACSGCPS++ TLK G+  +L + 
Sbjct: 228 VDILEEYVKPAVASDGGNILFQSYEKDTKTVNVILQGACSGCPSSTFTLKNGIETMLKNM 287

Query: 180 V-PEVKDIRT 188
           +  +V ++  
Sbjct: 288 MGDKVNEVVA 297



 Score = 70.6 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  + T NPA LKF     +       F N  EA+ SPLA ++F +P I +VYF  +FI 
Sbjct: 6   ITVKQTNNPAVLKFETNHFITKNNNYEFKNIDEAKNSPLAQQLFYLPFIKTVYFSGNFIG 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + + D  +W  ++  V   ++E+  SG+PI+     G    
Sbjct: 66  LERFDIVEWADVKDEVAQQLVEYLNSGEPIVIEEEQGKKVP 106


>gi|146418001|ref|XP_001484967.1| hypothetical protein PGUG_02696 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 244

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/191 (34%), Positives = 111/191 (58%), Gaps = 7/191 (3%)

Query: 4   QTEDTPNPATLKFI-PGQVV-LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           QT  TPN   LKF+ P ++V +      F+++ +A  SPLA ++F +PG+ SV  G DF+
Sbjct: 23  QTLSTPNENALKFVSPTKIVPMENKTFEFTSSLQAVHSPLALKLFKLPGVRSVMLGPDFL 82

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W HLRP VL ++ +        +    L +    +    D  +    +V  
Sbjct: 83  TVNKQDHVNWAHLRPEVLSLLDKFLTEKQEPVITKELIEATEKEAAEADADDL--EIVSM 140

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI +K + +    VFL ++GAC  C ++ +TLK+G+ ++L H
Sbjct: 141 IKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIESMLKH 200

Query: 179 FVPEVKDIRTV 189
           +V EV+++  +
Sbjct: 201 YVEEVQEVEQI 211


>gi|312129640|ref|YP_003996980.1| nitrogeN-fixing nifu domain protein [Leadbetterella byssophila DSM
           17132]
 gi|311906186|gb|ADQ16627.1| nitrogen-fixing NifU domain protein [Leadbetterella byssophila DSM
           17132]
          Length = 199

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/195 (34%), Positives = 98/195 (50%), Gaps = 14/195 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNA----KEAEISPLASRIFSIPGIASVYF 56
            I TE +PNP ++KF+    ++ EG +  +        E + SPLAS +F    +  V+ 
Sbjct: 7   MIYTELSPNPNSMKFVLNYEIVPEGLSFDYPTKASTFDEKKASPLASDLFLFDFVERVFI 66

Query: 57  GYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS 115
             +FIT+ K    DW+ +   V   I  +F    P+     +      D  +     SDS
Sbjct: 67  SSNFITLTKRGDIDWDDVLGDVRQFIKTYFDENHPVFAQKTI------DSHTLIVQGSDS 120

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVA 173
            VV +IK  LD  VRPAV  DGG I F  + +    V + ++G+CSGCPSAS TLK G+ 
Sbjct: 121 EVVAKIKSTLDQYVRPAVESDGGAINFSSFEEESGTVKVLLQGSCSGCPSASLTLKAGIE 180

Query: 174 NILNHFVPEVKDIRT 188
            +L   +PEVK +  
Sbjct: 181 RLLTTMIPEVKSVEA 195


>gi|190346499|gb|EDK38598.2| hypothetical protein PGUG_02696 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 244

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/191 (34%), Positives = 111/191 (58%), Gaps = 7/191 (3%)

Query: 4   QTEDTPNPATLKFI-PGQVV-LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           QT  TPN   LKF+ P ++V +      F+++ +A  SPLA ++F +PG+ SV  G DF+
Sbjct: 23  QTLSTPNENALKFVSPTKIVPMENKTFEFTSSLQAVHSPLALKLFKLPGVRSVMLGPDFL 82

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV  +D  +W HLRP V  ++ +        +    L +    +    D  +S   +V  
Sbjct: 83  TVNKQDHVNWAHLRPEVSSLLDKFLTEKQEPVITKELIEATEKEAAEADADDS--EIVSM 140

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IKE+++ R+RPA+  DGGDI +K + +    VFL ++GAC  C ++ +TLK+G+ ++L H
Sbjct: 141 IKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIESMLKH 200

Query: 179 FVPEVKDIRTV 189
           +V EV+++  +
Sbjct: 201 YVEEVQEVEQI 211


>gi|154339123|ref|XP_001562253.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134062836|emb|CAM39281.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 282

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/190 (32%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQV--VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  L+F       +  E ++   +   A  SPLA  +F + G+ +++   ++
Sbjct: 66  VETNETPNPDCLRFFSMDFSFLKPEFSMDIPSPAHAYKSPLAEALFGVAGVQAIFLADEY 125

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV KD Q DW  L   +  +I+E   S + ++   G  ++   +    +  E D  VV 
Sbjct: 126 VTVRKDPQADWGALVHIIKEVIVEFAESKENVLSEAGEAELMGYN-DDTEPNEDDDEVVL 184

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ F    +G VFL + GAC  CPS+  TLK G+  +L H+
Sbjct: 185 AVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGACKSCPSSHITLKSGIERMLMHW 244

Query: 180 VPEVKDIRTV 189
           +PEV +++ V
Sbjct: 245 IPEVVEVQEV 254


>gi|71662836|ref|XP_818418.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70883670|gb|EAN96567.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 280

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/189 (33%), Positives = 102/189 (53%), Gaps = 4/189 (2%)

Query: 3   IQTEDTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  L+F   +   +    ++ F NA  A  SPLA  +FSI G+ +VY   ++
Sbjct: 64  VETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIADEY 123

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K    DW+ + P +   I E F      + +    D+        +  + D  V+ 
Sbjct: 124 ITVRKGHLVDWDAILPMIKESIEE-FAERKMNVLSEEGEDLLSGHNEDTEPKDDDDEVIL 182

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+  +L H+
Sbjct: 183 AVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGIERMLMHW 242

Query: 180 VPEVKDIRT 188
           +PEV +++ 
Sbjct: 243 IPEVVEVQE 251


>gi|71654974|ref|XP_816097.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70881201|gb|EAN94246.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 280

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/189 (34%), Positives = 103/189 (54%), Gaps = 4/189 (2%)

Query: 3   IQTEDTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  L+F   +   +    ++ F NA  A  SPLA  +FSI G+ +VY   ++
Sbjct: 64  VETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIADEY 123

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K    DW+ + P +   I E   S   I+   G   +   +  +    + D  V+ 
Sbjct: 124 ITVRKGHLVDWDSILPMIKESIAEFAESKVNILSEEGEELLSGHNEDTEP-KDDDDEVIL 182

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+  +L H+
Sbjct: 183 AVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGIERMLMHW 242

Query: 180 VPEVKDIRT 188
           +PEV +++ 
Sbjct: 243 IPEVVEVQE 251


>gi|322824715|gb|EFZ30028.1| hypothetical protein TCSYLVIO_3695 [Trypanosoma cruzi]
          Length = 280

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/189 (34%), Positives = 103/189 (54%), Gaps = 4/189 (2%)

Query: 3   IQTEDTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  L+F   +   +    ++ F NA  A  SPLA  +FSI G+ +VY   ++
Sbjct: 64  VETSETPNPDCLRFYSMELSFLKPGFSMDFPNAGHAYKSPLAEILFSIDGVEAVYIADEY 123

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K    DW+ + P +   I E   S   I+   G   +   +  +    + D  V+ 
Sbjct: 124 ITVRKGHLVDWDAILPMIKESIAEFAESKVNILSEEGEELLSGHNEDTEP-KDDDDEVIL 182

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPSAS TLK G+  +L H+
Sbjct: 183 AVKELLATRIRPMLQADGGNVRYLDMDDGTVFVLLEGACKSCPSASVTLKNGIERMLMHW 242

Query: 180 VPEVKDIRT 188
           +PEV +++ 
Sbjct: 243 IPEVVEVQE 251


>gi|284037367|ref|YP_003387297.1| nitrogen-fixing NifU domain protein [Spirosoma linguale DSM 74]
 gi|283816660|gb|ADB38498.1| nitrogen-fixing NifU domain protein [Spirosoma linguale DSM 74]
          Length = 200

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 61/194 (31%), Positives = 101/194 (52%), Gaps = 15/194 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEA----EISPLASRIFSIPGIASVYFG 57
           I TE +PNP ++KF+    ++  G +  ++   +A    + SPLA  +F    +  V+  
Sbjct: 11  IFTEGSPNPNSMKFVVNFELVPTGLSFDYATPGDALLDGKASPLAVALFGFEFVRRVFIS 70

Query: 58  YDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            +F+TV KD   DW+ +   V   + ++F    P+     +             ++ DS 
Sbjct: 71  ANFVTVTKDDETDWDEVLLEVKLFLKDYFGEQKPVFSQRTVDTNTTK-------LDMDSE 123

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVAN 174
            VQ+IK VL+  ++PAV  DGG I F  + +    V + ++G+CSGCPS++ TLK G+ N
Sbjct: 124 TVQKIKAVLEQYIKPAVESDGGAISFYSFDEPSGTVKVLLQGSCSGCPSSTLTLKAGIEN 183

Query: 175 ILNHFVPEVKDIRT 188
           +L   VPEVK +  
Sbjct: 184 LLTRLVPEVKLVEA 197


>gi|228472622|ref|ZP_04057382.1| nitrogen-fixing NifU domain protein [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276035|gb|EEK14791.1| nitrogen-fixing NifU domain protein [Capnocytophaga gingivalis ATCC
           33624]
          Length = 299

 Score =  144 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 92/192 (47%), Gaps = 11/192 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  + ++      F   +EAE SPLA  +F    + SV+F  ++++
Sbjct: 111 IYVESTPNPMAMKFVANKKLV-SRPYEFKTIEEAENSPLAQALFGFDFVKSVFFDANYVS 169

Query: 63  VGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + +      WE +       + ++ + G  ++      + +   +             ++
Sbjct: 170 ITRLPRSTPWEEVMMETREFLRQYLMEGKTVVKVAVSEEDRPKGLPRLG-----DIYSKK 224

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I  +LD  +RPAV+ DGG+I F  Y      V + ++GAC+GCPS+  TLK G+  +L  
Sbjct: 225 IVALLDQYIRPAVSSDGGNIEFVSYDKETHKVKVVLQGACNGCPSSRITLKQGIEGLLRE 284

Query: 179 FVPEVK-DIRTV 189
            + + K  +  V
Sbjct: 285 QLKDDKLTVEAV 296


>gi|89889561|ref|ZP_01201072.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7]
 gi|89517834|gb|EAS20490.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7]
          Length = 214

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 51/193 (26%), Positives = 97/193 (50%), Gaps = 7/193 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ +KF+  + ++V     F +  +   + LA ++++ P +  +Y   ++++
Sbjct: 21  VYAEATPNPSVMKFVANKKLVVNST-EFKSIADTADNTLARQLYNFPFVKEIYADENYVS 79

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMG--SGDFIESDSAVVQ 119
           +   D   W+ +   +   I E   +G  I  +         +         E+   V +
Sbjct: 80  IQKHDIASWDEVTFEIRSFIKEAIENGAEIGSSKHEAGTVKKEGENIELPKFENLDDVSK 139

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
           ++ E+LD  ++PAVA DGG+IVF  Y +    V + ++GACSGCPS++ TLK G+  +L 
Sbjct: 140 KVVEILDEYIKPAVASDGGNIVFDSYDENTKEVKVILQGACSGCPSSTMTLKSGIETMLR 199

Query: 178 HFVPE-VKDIRTV 189
             +P  V  +  +
Sbjct: 200 DMLPGKVDRVMAI 212


>gi|124006329|ref|ZP_01691163.1| NifU domain protein [Microscilla marina ATCC 23134]
 gi|123987986|gb|EAY27657.1| NifU domain protein [Microscilla marina ATCC 23134]
          Length = 197

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 61/190 (32%), Positives = 104/190 (54%), Gaps = 10/190 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGA-IHFSNAKEAEISPLASRIFS-IPGIASVYFGYDF 60
           I TE  PNP +LK++   +++ +G    F +A+ A+ SPLA+ +FS    +  V+   +F
Sbjct: 11  IYTESNPNPNSLKYVINYMLVPDGTTFDFPDAETAQQSPLATELFSKFSYVDRVFMMSNF 70

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K ++ DW  +   V   +  +     P++         + D    +  + +  + +
Sbjct: 71  VTVTKKEEADWHDVAGEVKEFLQGYLEEQKPLLT------QDIQDEYDKELNKDEPEIDR 124

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +IK +L+  VRPAV  DGG I F  Y +G V + ++G+CSGCPS+  TLK G+ N+L   
Sbjct: 125 KIKGILEEYVRPAVESDGGAINFHSYENGTVKVLLQGSCSGCPSSMVTLKSGIENLLKRM 184

Query: 180 VPE-VKDIRT 188
           +PE VK++  
Sbjct: 185 LPEDVKEVVA 194


>gi|325104464|ref|YP_004274118.1| Scaffold protein Nfu/NifU [Pedobacter saltans DSM 12145]
 gi|324973312|gb|ADY52296.1| Scaffold protein Nfu/NifU [Pedobacter saltans DSM 12145]
          Length = 183

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 103/187 (55%), Gaps = 12/187 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNP T+KFI  + +L+ G++ +   + A  S  AS ++    +  V+F  +F+T
Sbjct: 5   VYTESTPNPNTMKFIVNK-LLINGSVDYPTRESATESRFASELYKFSFVNGVFFASNFVT 63

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  +W  + P +   +     S   +        +  +           S V  +I
Sbjct: 64  ITKSEDAEWADIEPILKEFVKGAVESEYAVQSKKEEEFVDFEG----------SEVEIKI 113

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +++L + V+PAV +DGG I +K + DG+V + +RG+CSGCPS++ TLK G+ ++L   VP
Sbjct: 114 QQILHDYVKPAVEQDGGAIAYKSFEDGVVTVELRGSCSGCPSSTITLKSGIQSLLQRMVP 173

Query: 182 EVKDIRT 188
           EVK++ +
Sbjct: 174 EVKEVVS 180


>gi|163786509|ref|ZP_02180957.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1]
 gi|159878369|gb|EDP72425.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1]
          Length = 300

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 57/181 (31%), Positives = 98/181 (54%), Gaps = 4/181 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ LKF+  + VLV     F++ +EA+ SPLA+ +F  P I +++   +FI+
Sbjct: 109 VYAESTPNPSVLKFVCNK-VLVPSLYEFTSIEEAKPSPLATALFQFPFIKNIFIEKNFIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +WE +   +   +  +   G  I+++     +   +       E+     + I
Sbjct: 168 ITKFDIIEWEDITLQLREFLKSYIEDGKTILNDDAPQKLNKTEEAIEQKFEALDDTSKNI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  ++PAV  DGG+I FK Y      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 228 VNILEEYIKPAVESDGGNIEFKSYDANTKKVEVLLQGACSGCPSSTFTLKNGIENMLKEM 287

Query: 180 V 180
           +
Sbjct: 288 L 288



 Score = 63.3 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I    T N   LKF   + +    +  F+N  +A+ SPLA ++F +P +  VY   +FI 
Sbjct: 6   ISIIPTSNETILKFEADRFLTNHNSFEFNNIDDAKHSPLAQQLFYLPFVKKVYIATNFIA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG 98
           +   +  +W+ ++  V   I ++  +   ++    + 
Sbjct: 66  IERYNIVEWKDVQNEVAAQIEDYLSNDGVVVTEEAIK 102


>gi|304320546|ref|YP_003854189.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503]
 gi|303299448|gb|ADM09047.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503]
          Length = 163

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 6/165 (3%)

Query: 28  IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFI 86
           + F   + A++SPLAS +F I G+  VY G DF+TV KD   +W+HL+P VLG + ++  
Sbjct: 1   MDFPTLESAKVSPLASALFDIDGVVEVYLGADFLTVTKDPSVEWQHLKPAVLGTVADYLA 60

Query: 87  SGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
           +G P++  G   D         D+      +V++I ++++ RVRPAVA+DGGDIVF  + 
Sbjct: 61  AGIPVVDQGAAAD---SADTPDDYEGETKEIVEQIIDLIETRVRPAVAQDGGDIVFHRFV 117

Query: 147 DG--IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            G  IVFLSMRGACSGCPS++ TLK G+ N+L H+VPEV  +  V
Sbjct: 118 PGDGIVFLSMRGACSGCPSSTMTLKSGIENLLKHYVPEVTAVEAV 162


>gi|149280243|ref|ZP_01886366.1| thioredoxin-related protein [Pedobacter sp. BAL39]
 gi|149229080|gb|EDM34476.1| thioredoxin-related protein [Pedobacter sp. BAL39]
          Length = 183

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 103/187 (55%), Gaps = 12/187 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  + +L+ G+  F+  + AE S  A  +F    +  V+F  +F+T
Sbjct: 5   VYTEQTPNPATMKFMVNK-LLINGSEDFATRESAEHSQFAKELFKFNFVNGVFFASNFVT 63

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K +  DW+ +   +   +     S   I           +           S +  +I
Sbjct: 64  ITKTEDADWQDIEALLKDFVKGAVESEYKIKEETQAEAPAFEG----------SDLEIKI 113

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +++L + VRPAV +DGG I +K + +G+V + +RG+CSGCPS++ TLK G+ N+L   VP
Sbjct: 114 QQILHDYVRPAVEQDGGAISYKSFDEGVVTVELRGSCSGCPSSTITLKSGIQNLLQRMVP 173

Query: 182 EVKDIRT 188
           EVK++ +
Sbjct: 174 EVKEVVS 180


>gi|295673142|ref|XP_002797117.1| LiPid Depleted family member [Paracoccidioides brasiliensis Pb01]
 gi|226282489|gb|EEH38055.1| LiPid Depleted family member [Paracoccidioides brasiliensis Pb01]
          Length = 317

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/202 (36%), Positives = 112/202 (55%), Gaps = 16/202 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVE----GAIHFSNAKEAEISPLAS----RIFSIPGIA 52
           +FIQTE+TPN   LKFIP   VL E      + + + +     P  S    ++ ++ G++
Sbjct: 82  IFIQTENTPNADALKFIPNHSVLPENFPTTFLEYLSPRSTLAPPYPSPLASKLLNVDGVS 141

Query: 53  SVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIH-NGGLGDMKLDDMGSGDF 110
           +V++G DFIT+ K    +W H++P V  +I E   +GDPI+  +      +  +  S  +
Sbjct: 142 AVFYGPDFITITKAGDANWAHIKPEVFSLITEAVTAGDPIVTISEAGAGSQAQEEDSLSY 201

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
            E D  VV  IKE+L+ R+RPA+  DGGDI F+G+ DGIV L +RGAC  C S++   K 
Sbjct: 202 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFDDGIVNLKLRGACRTCDSST---KL 258

Query: 171 GVANILNHF---VPEVKDIRTV 189
            V  +  H    + EVK +  V
Sbjct: 259 FVPTLRGHAEISIEEVKGVNQV 280


>gi|262277769|ref|ZP_06055562.1| NifU domain protein [alpha proteobacterium HIMB114]
 gi|262224872|gb|EEY75331.1| NifU domain protein [alpha proteobacterium HIMB114]
          Length = 179

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 60/188 (31%), Positives = 102/188 (54%), Gaps = 15/188 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            I   DTPNP T KF+  Q ++  G+  F  + ++ I  L + +F I  +  VY   +FI
Sbjct: 1   MINVVDTPNPDTKKFVFDQTIVKIGSKEFKKSDQSNI-DLVNDLFLIKELELVYLDKNFI 59

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++ K+    W+ +   +L  + +                   D +   +  E    + +R
Sbjct: 60  SIKKNKDSSWDDIVQDILEALNKRIS-------------QNFDALSFEEESEFTDDISKR 106

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+EVL++++RPAVA DGGDI  K ++DG+  + ++GAC+GCPS++ TLK+GV  ++ H+V
Sbjct: 107 IEEVLNDKIRPAVAMDGGDIRLKSFKDGVAEVMLKGACAGCPSSTVTLKHGVERMIKHYV 166

Query: 181 PEVKDIRT 188
           PEV  +  
Sbjct: 167 PEVTSVEA 174


>gi|50312363|ref|XP_456215.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645351|emb|CAG98923.1| KLLA0F25476p [Kluyveromyces lactis]
          Length = 256

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/205 (27%), Positives = 103/205 (50%), Gaps = 16/205 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKE---AEISPLASRIFSIPGIAS 53
           + I+T  TPN   LKF+   G ++  +G   +   N  E         +      PG+ +
Sbjct: 28  IHIKTLTTPNENALKFVSTDGGLLQEKGTQSVEIKNTDEELLKHAPFPSKVFQQCPGVEA 87

Query: 54  VYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDP------IIHNGGLGDMKLDDMG 106
           +  G DF+T+ KD+   W  + P V+ ++++H  SG P                   D+ 
Sbjct: 88  MMIGDDFVTINKDELIHWNQVTPTVIDLLVQHLASGKPTFLPDFFDVKKSSEVGYDVDIP 147

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
             ++ E +  + + I E++  R+RPA+  DGGDI ++G+      V+L ++GAC  C S+
Sbjct: 148 KFEYDEDEQEISEMIDELIQTRIRPAIMDDGGDIQYRGWNPETGTVYLKLQGACKSCSSS 207

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
            +TLK+G+  +L H++ EV+D+  +
Sbjct: 208 EDTLKHGIEAMLKHYIEEVEDVVQI 232


>gi|295132490|ref|YP_003583166.1| nifU related protein [Zunongwangia profunda SM-A87]
 gi|294980505|gb|ADF50970.1| nifU related protein [Zunongwangia profunda SM-A87]
          Length = 309

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 93/200 (46%), Gaps = 14/200 (7%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP  +KF+  + +++  A  F N  +A  SPLA ++F  P +  V+   ++++
Sbjct: 109 VYAESTPNPKVMKFVANRKLVLH-AAEFKNIDDAAESPLAQKLFHFPFVKEVFIDENYVS 167

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPI---------IHNGGLGDMKLDDMGSGDFIE 112
           +   D   W+ +   +   I      G+ +                +           I+
Sbjct: 168 INKYDVASWDEITMELREFIRNFIQEGNSVLNNDAITGAPEGKNGSETSKTAPKPQINID 227

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKY 170
                 Q++  +L+  ++PAVA DGG+I+F  Y +    V + ++GACSGCPS++ TLK 
Sbjct: 228 ELDDTSQQVVAILEEYIKPAVASDGGNILFDSYNEESRTVKVILQGACSGCPSSTMTLKS 287

Query: 171 GVANILNHFVPE-VKDIRTV 189
           G+  +L   +   V  +  V
Sbjct: 288 GIETMLRDMLKGKVDYVEAV 307



 Score = 61.0 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 1/99 (1%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  + T  P  +KF   + +       F N  EA  SP+A ++F +P + +VY   +FI 
Sbjct: 6   INIQHTTQPEIVKFEANKFLTKHENFEFKNIDEAAKSPIAQQLFYLPFVKTVYISQNFIA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           +   D   W  +   V   I  +   G  +I        
Sbjct: 66  IEKYDIVAWPEVENEVAEQIQNYLNKGGIVIKTDEQQKN 104


>gi|320581036|gb|EFW95258.1| hypothetical protein HPODL_3630 [Pichia angusta DL-1]
          Length = 242

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 107/201 (53%), Gaps = 12/201 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQ----VVLVEGAIHFSNAKEA-EISPLASRIFSIPG--IAS 53
           +FIQT+ TPN   LKF+P +           +  +  K+A   S LA ++ S+    I S
Sbjct: 20  LFIQTQSTPNENALKFVPSEFKFLPSPNTPTLEITGIKDALNKSELAFKLLSVNDKSIKS 79

Query: 54  VYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG--DMKLDDMGSGDF 110
           + FGY+FITV K +++ W  L+P +  ++ EH  SG  +I+   +     +  +    D 
Sbjct: 80  ILFGYNFITVIKGEKHSWSLLKPEIFSILTEHLTSGQAVINQKYINILGQQSAENEDLDG 139

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETL 168
            E +  VV  I E+L  R++PA+  DGGDI F  + +    VFL + GAC  C S+  TL
Sbjct: 140 YEDEDEVVALINELLITRIQPAIQEDGGDIKFVRFDEDTGTVFLKLIGACKSCSSSEITL 199

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+  +L  ++ EVK ++ V
Sbjct: 200 KNGIEEMLKFYIDEVKSVQQV 220


>gi|88802135|ref|ZP_01117663.1| NifU protein [Polaribacter irgensii 23-P]
 gi|88782793|gb|EAR13970.1| NifU protein [Polaribacter irgensii 23-P]
          Length = 301

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 100/192 (52%), Gaps = 6/192 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEIS-PLASRIFSIPGIASVYFGYDFI 61
           +  E TPNPA +KF   +  L +  + F N  EA  S PLA  IF+ P +  V+   ++I
Sbjct: 109 VYAEVTPNPAVMKFGTNKA-LTQTDVEFKNIDEASASSPLAQAIFNFPFVQQVFISDNYI 167

Query: 62  TVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V   D  +W  +   V   I E+   G  II      ++      + +       +  +
Sbjct: 168 SVTKYDMVEWNEVYGEVRTFIREYLADGKTIIKELPKEEVVETANKAQEPEVVLEGISAQ 227

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           I ++LD  ++PAVA DGG+I F+ Y +    V + ++GACSGCPS++ TLK G+ N+L  
Sbjct: 228 IVDILDEYIKPAVASDGGNIAFRSYDEQTKVVRVILQGACSGCPSSTATLKNGIENLLKE 287

Query: 179 FVPE-VKDIRTV 189
            +P+ + ++  +
Sbjct: 288 MLPDQINEVVAI 299



 Score = 61.7 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  ++T N   +K+    +++  G+  F+N  EA+ SPLA  +F +P +  V+   +FI 
Sbjct: 6   ITIQETTNNTIIKYNSNTILINGGSYEFNNIDEAKNSPLAQELFYLPFVKKVFITANFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD 104
           + + D  +W  ++  V   I      G+ +++       +  +
Sbjct: 66  IQRFDILEWIDVQEEVKEQIEAFLNDGNIVVNEQKTSKKEAIE 108


>gi|332877772|ref|ZP_08445513.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332684352|gb|EGJ57208.1| NifU-like protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 298

 Score =  141 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 103/192 (53%), Gaps = 8/192 (4%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFS-IPGIASVYFGYDFIT 62
            TE TPNPA +KF+  + ++    I + +A EA  +PLA  +F   P I  V+F  D+I+
Sbjct: 109 YTETTPNPAVMKFVANKRLVPT-IIEYKSATEAAEAPLAQALFQAFPFITEVFFDNDYIS 167

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K D  DWE   P +   I ++  +   +I+   +   +           +   + Q+I
Sbjct: 168 VTKTDTADWEEESPRLRAFIKDYLAAEKTVINISEVKKWQTAVQAHLLSKVTTDPISQQI 227

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAVA DGG+I F  Y+     +   ++GACSGCPS+++TLK G+  IL + 
Sbjct: 228 VAIIEEHVKPAVASDGGNIQFISYQPDTHHVEVLLQGACSGCPSSTQTLKKGIEAILKNK 287

Query: 180 V--PEVKDIRTV 189
           +  P++ ++  +
Sbjct: 288 LGNPDI-NVEAI 298



 Score = 61.0 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 2/93 (2%)

Query: 5  TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           + T NP  +K    + ++ +G+  + N  EA+ +PLA  +F +P I +VY   +FI + 
Sbjct: 8  VQPTANPDIIKLEANRPLV-KGSYEYKNVDEAKNAPLAKELFYLPFIKTVYISSNFIALK 66

Query: 65 K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
          +    +W+ ++  V   I  +  SG P+++N  
Sbjct: 67 RFPIIEWKDVQEEVAQQIAVYLQSGRPLVNNDS 99


>gi|150026140|ref|YP_001296966.1| hypothetical protein FP2102 [Flavobacterium psychrophilum JIP02/86]
 gi|149772681|emb|CAL44164.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 298

 Score =  141 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 98/191 (51%), Gaps = 7/191 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  +  L +  +   N  +   SPLA  +F  P +  ++   ++++
Sbjct: 107 VYAESTPNPAVMKFVASKK-LTKTIVECKNIDQTHASPLAKELFKFPFVKEIFIDENYLS 165

Query: 63  VGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K    +W+ +   +   I E   +G  ++    +   K ++       ++     Q+I
Sbjct: 166 ITKYAVAEWQEITLELRTFIKEFIENGKIVVDETKIVATKHEEKQEITNFDNLDVTSQKI 225

Query: 122 KEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  +RPAVA DGG+I+F  Y      V + ++GACSGCPS++ TLK G+ ++L   
Sbjct: 226 INIIEEYIRPAVAADGGNILFDSYCQDTKQVKVILQGACSGCPSSTFTLKNGIESMLKDM 285

Query: 180 V--PEVKDIRT 188
           +  PE++ +  
Sbjct: 286 LNQPELR-VEA 295



 Score = 64.4 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  +DT NP  LKF     +    +  + N  EA  SPLA ++F +P + +VY   +FI 
Sbjct: 4   ITIKDTNNPNILKFEFSYFITPNQSYEYKNIDEAGASPLAQQLFYLPFVKTVYISGNFIA 63

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           +   +   WE ++  V   +     +G  ++          
Sbjct: 64  IEKYNIVQWEDVKHDVADQMEAFVSNGGEVVKQTETPKKSP 104


>gi|255713524|ref|XP_002553044.1| KLTH0D07458p [Lachancea thermotolerans]
 gi|238934424|emb|CAR22606.1| KLTH0D07458p [Lachancea thermotolerans]
          Length = 248

 Score =  141 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 58/204 (28%), Positives = 102/204 (50%), Gaps = 15/204 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEG--AIHFSNAKEAEISPLA---SRIFSIPGIAS 53
           + I++  TPN   LKFI   G+++   G  ++   N  E+ I             PG+ +
Sbjct: 21  LHIKSVSTPNENALKFISTDGELLQERGKPSVEIKNTDESLIKHSPLASRLFTQCPGVEA 80

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDP-----IIHNGGLGDMKLDDMGS 107
           +  G DFITV KD    W  + P V+ ++ ++  SG              G     ++  
Sbjct: 81  LMIGDDFITVNKDEMVHWNQITPSVIDLLTQYLASGREAVTPEFFSVQEQGVGYDVNVPK 140

Query: 108 GDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSAS 165
            ++ E +  +   I E++  R+RPA+  DGGDI ++GY      V+L ++GAC  C S+ 
Sbjct: 141 FEYNEDEQEISDMIDELIQTRIRPAIMDDGGDIQYRGYDPQTGTVYLKLQGACKSCSSSE 200

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TLK+G+ ++L H++ EV+++  +
Sbjct: 201 VTLKHGIESMLKHYIEEVENVVQI 224


>gi|126663121|ref|ZP_01734119.1| thioredoxin-related protein [Flavobacteria bacterium BAL38]
 gi|126624779|gb|EAZ95469.1| thioredoxin-related protein [Flavobacteria bacterium BAL38]
          Length = 299

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 100/191 (52%), Gaps = 5/191 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNP+ LKF+  + +L + A+   N  E   SPLA  +F  P +  ++   ++I+
Sbjct: 108 VYAETTPNPSVLKFVCNK-LLTKTALECKNIDETIASPLAKELFKFPFVKEIFIDENYIS 166

Query: 63  VGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K    +W+ +   +   I E+  +G+ +I    +   ++       + ++     Q+I
Sbjct: 167 VTKFAVTEWDEITLELRTFIKEYIENGNTVIDETAIVKTEIHQKQQEAYFDTLDVTSQQI 226

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +++  V+PAV  DGG+I+F+ +      V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 227 INIIEEYVKPAVQSDGGNIMFESFDPIEKRVKVILQGACSGCPSSTFTLKNGIENMLKDM 286

Query: 180 V-PEVKDIRTV 189
           +  E   +  +
Sbjct: 287 LKDENIKVEAI 297



 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I T+ T NPA +KF   + ++      F N  E + SPLA ++F +P + +VY   +FI 
Sbjct: 4   IATKITQNPAIVKFELDENIVRSENFEFKNIDETQNSPLAKQLFFLPFVKTVYVSGNFIA 63

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + K    +WE ++  V   I E   +G  II        K 
Sbjct: 64  IEKFSIVEWEDVQEDVANQINEFISNGGEIIKIDENKTKKQ 104


>gi|330813331|ref|YP_004357570.1| hypothetical protein SAR11G3_00356 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486426|gb|AEA80831.1| hypothetical protein SAR11G3_00356 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 179

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/189 (30%), Positives = 99/189 (52%), Gaps = 14/189 (7%)

Query: 2   FIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
            I   DTPNP + KF+    ++  G+    + ++ +    A ++F       +Y   +F+
Sbjct: 1   MITLTDTPNPESKKFVFDFDIVKSGSKEIKSIEDCKEIKFAEKLFDQVSPELIYIDSNFV 60

Query: 62  TVGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           T+ K     W  ++  +L ++ E   +    +      + K               + QR
Sbjct: 61  TIKKKSSQDWNEIKENILKILSEEVNADFEALSFEKSFEFK-------------DEISQR 107

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I+EVL++++RPAVA DGGDI  K Y+DGIV + ++G+C+GCPS++ TLK GV  ++ H+V
Sbjct: 108 IEEVLNDKIRPAVAMDGGDIQLKSYKDGIVEVMLKGSCAGCPSSTVTLKQGVERMIKHYV 167

Query: 181 PEVKDIRTV 189
           PEV  +  V
Sbjct: 168 PEVNSVIAV 176


>gi|45185274|ref|NP_982991.1| ABR045Wp [Ashbya gossypii ATCC 10895]
 gi|44980932|gb|AAS50815.1| ABR045Wp [Ashbya gossypii ATCC 10895]
          Length = 239

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 14/199 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEG--AIHFSNAKEA---EISPLASRIFSIPGIAS 53
           + I+T  TPN   LK++   G+++   G  ++   N       +          +PG+ +
Sbjct: 20  LHIKTLTTPNENALKYVSTDGELLQERGAPSVEIRNFDMELIRQAPLAEKLFAQVPGVEA 79

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V  G DF+TV KD +  W  + P VL ++ +   SG   +                 + E
Sbjct: 80  VMIGDDFVTVSKDAELGWAQVTPRVLEVLTQQLASGQAAVQGQVAVGG----TERFQYDE 135

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            +  +   I+E++  RVRPA+  DGGDI ++G+      V+L ++GAC  C S+  TLK+
Sbjct: 136 EEQEISDTIEEIIQTRVRPAIMDDGGDIQYRGWDPETGRVYLKLQGACKSCSSSEVTLKH 195

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+ ++L H+V EV  +  V
Sbjct: 196 GIESMLKHYVEEVSGVEQV 214


>gi|91205888|ref|YP_538243.1| NifU-like protein [Rickettsia bellii RML369-C]
 gi|157826752|ref|YP_001495816.1| NifU-like protein [Rickettsia bellii OSU 85-389]
 gi|91069432|gb|ABE05154.1| NifU-like protein [Rickettsia bellii RML369-C]
 gi|157802056|gb|ABV78779.1| NifU-like protein [Rickettsia bellii OSU 85-389]
          Length = 185

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 77/180 (42%), Positives = 117/180 (65%), Gaps = 9/180 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTEDTPNP  +KF PGQ +  +       A+    S LA  +F+I  + S++FG DF
Sbjct: 1   MFIQTEDTPNPDAIKFFPGQEISTQPIFFSERAEVKGKSKLAESLFNINNVKSIFFGSDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           ITV K  + DW+ ++P VL ++M+HF++G P+       D           +E  S + +
Sbjct: 61  ITVTKKTESDWQVIKPEVLMVVMDHFVAGFPVFEVSSKVDD--------VNLEGFSDIEK 112

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           +I E+++ RVRP+VA+DGGDI++KG+ +G+V L++RGAC GCPS++ TLK G+ ++L HF
Sbjct: 113 QIIEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKNGIESMLKHF 172


>gi|4790|emb|CAA49299.1| YKL253 [Saccharomyces cerevisiae]
          Length = 230

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+      N  E  I+            PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI- 111
           +  G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G      
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKINM 141

Query: 112 ------ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPS 163
                 E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S
Sbjct: 142 PKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSS 201

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           +  TLKYG+ ++L H+V EVK++  +
Sbjct: 202 SEVTLKYGIESMLKHYVDEVKEVIQI 227


>gi|148666783|gb|EDK99199.1| mCG130855, isoform CRA_c [Mus musculus]
          Length = 219

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 70/156 (44%), Positives = 94/156 (60%), Gaps = 7/156 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 69  MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 128

Query: 61  ITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV    ++ DW  L+P +   IM+ F SG P+     + +      G     E D  VV
Sbjct: 129 ITVTKENEELDWNLLKPDIYATIMDFFASGLPL-----VTEETPPPPGEAGSSEEDDEVV 183

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM 154
             IKE+LD R+RP V  DGGD++++G+ DGIV L +
Sbjct: 184 AMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKL 219


>gi|313206892|ref|YP_004046069.1| nitrogen-fixing nifu domain protein [Riemerella anatipestifer DSM
           15868]
 gi|312446208|gb|ADQ82563.1| nitrogen-fixing NifU domain protein [Riemerella anatipestifer DSM
           15868]
          Length = 292

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 94/192 (48%), Gaps = 9/192 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFI 61
           I  E TPNP+ +KF+  + +L+EG +   + +EA   PLA  IF        V+   +F+
Sbjct: 103 IYAEMTPNPSVMKFVASR-LLLEGFVEVKSREEAAEVPLAQAIFKEFDFAQEVFISDNFV 161

Query: 62  TVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
            V KD    W  +       I E+  +G  + H       K ++          +   Q+
Sbjct: 162 AVTKDDSVQWHEVMVVTRAFIAEYLQNGGEVSHKEP---QKHENPVEKIINREYTDTEQK 218

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I ++L+  V PAV  DGG I    Y +      + ++GACSGCPS++ TLK G+ N+L  
Sbjct: 219 ISDILNEYVAPAVENDGGKISLMEYDESTKTAKMLLQGACSGCPSSTATLKGGIENVLKQ 278

Query: 179 FVPE-VKDIRTV 189
           F+P+ V+ +  V
Sbjct: 279 FLPDLVEKVEAV 290



 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NP  +KF+    ++  G++      +    PLA  +F+ P +  ++   +FI 
Sbjct: 4  IIIEATENPRVMKFVADYNLIP-GSLELDRNSDISEIPLAQELFNYPFVDKIFITANFIA 62

Query: 63 V-GKDQYDWEHLRPPVLGMIMEHFISG 88
          V  +D  +WEH+   +  +I +  ++ 
Sbjct: 63 VAKQDTVEWEHVVQSLKNVIEDELLAN 89


>gi|255534458|ref|YP_003094829.1| nifU related protein [Flavobacteriaceae bacterium 3519-10]
 gi|255340654|gb|ACU06767.1| nifU related protein [Flavobacteriaceae bacterium 3519-10]
          Length = 292

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/192 (32%), Positives = 95/192 (49%), Gaps = 9/192 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGI-ASVYFGYDFI 61
           I +E TPNP  +KF+    +L +G +   +  EA   PLA  IF   G    ++   +F+
Sbjct: 103 IYSEMTPNPMVMKFVSSTELL-DGFVEVKSPAEAGEVPLAKAIFDEFGFAKEIFISGNFV 161

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
            V K+   +W  +   +   I  +  +G  I     +   K +           +A  Q+
Sbjct: 162 AVTKNVSVEWHEVMITMRDFIANYLQNGGAI---SNIATQKHETPVESSIQRDYTANEQK 218

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I ++LD  V PAVA DGG I    Y +      + ++GACSGCPS++ TLK G+ NIL  
Sbjct: 219 ISDILDEYVAPAVAGDGGKISLIEYDEASKTAKMLLQGACSGCPSSTATLKGGIENILKQ 278

Query: 179 FVPE-VKDIRTV 189
           FVPE V+++  V
Sbjct: 279 FVPELVENVEAV 290



 Score = 56.0 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 2/99 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E T NP  LKF+    +L  G++      +    PLA ++ + P +  ++   +FI 
Sbjct: 4   ILIEATENPKVLKFVADYNLLP-GSLELDRQSDISEIPLAQKLLNFPFVDRIFITANFIA 62

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           V  +D  +WE +   +  +I +  I+   I         
Sbjct: 63  VAKQDTVEWEFVADSLKNVIEDELIANPRIYLQKKSEKH 101


>gi|323354104|gb|EGA85950.1| Nfu1p [Saccharomyces cerevisiae VL3]
          Length = 249

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+      N  E  I+            PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI- 111
           +  G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G      
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKINM 141

Query: 112 ------ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPS 163
                 E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S
Sbjct: 142 PKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSS 201

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           +  TLKYG+ ++L H+V EVK++  +
Sbjct: 202 SEVTLKYGIESMLKHYVDEVKEVIQI 227


>gi|151941505|gb|EDN59868.1| nifu-like protein [Saccharomyces cerevisiae YJM789]
          Length = 256

 Score =  138 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+      N  E  I+            PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI- 111
           +  G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G      
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLACGEDVISKEFHAVQEEEGEGGYKINM 141

Query: 112 ------ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPS 163
                 E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S
Sbjct: 142 PKFELSEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSS 201

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           +  TLKYG+ ++L H+V EVK++  +
Sbjct: 202 SEVTLKYGIESMLKHYVDEVKEVIQI 227


>gi|254582903|ref|XP_002499183.1| ZYRO0E05830p [Zygosaccharomyces rouxii]
 gi|238942757|emb|CAR30928.1| ZYRO0E05830p [Zygosaccharomyces rouxii]
          Length = 254

 Score =  138 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/201 (30%), Positives = 98/201 (48%), Gaps = 15/201 (7%)

Query: 3   IQTEDTPNPATLKFIP--GQVVLVEGA--IHFSNAKEAEISPLA---SRIFSIPGIASVY 55
           I+T  TPN   LKFI   G+++  +G+  +   N+ E+ I             PG+ S+ 
Sbjct: 27  IKTMTTPNENALKFISTDGEMLQDKGSSSLEIKNSDESLIEHSNLAQRIFLQCPGVESLM 86

Query: 56  FGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI--- 111
            G DF+TV KD    W  ++P V+ ++     SG+ ++ +        D           
Sbjct: 87  IGDDFLTVNKDSMVHWNQIKPGVIELLTSQLASGEDVVSDEFHTIRDSDAGYEVTAPKFE 146

Query: 112 --ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASET 167
             E D  V   I E++  R+RPA+  DGGDI ++ Y      V+L ++GAC  C S+ +T
Sbjct: 147 LSEEDEEVSDMIDELIQTRIRPAIQDDGGDIQYRAYDPKTGTVYLKLQGACKSCSSSEDT 206

Query: 168 LKYGVANILNHFVPEVKDIRT 188
           LK G+  +L H+V EV ++  
Sbjct: 207 LKAGIEGMLKHYVDEVTNVVQ 227


>gi|323347797|gb|EGA82061.1| Nfu1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 256

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+      N  E  I+            PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI- 111
           +  G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G      
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAXGEDVISKEFHAVQEEEGEGGYKINM 141

Query: 112 ------ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPS 163
                 E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S
Sbjct: 142 PKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSS 201

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           +  TLKYG+ ++L H+V EVK++  +
Sbjct: 202 SEVTLKYGIESMLKHYVDEVKEVIQI 227


>gi|146299436|ref|YP_001194027.1| NifU domain-containing protein [Flavobacterium johnsoniae UW101]
 gi|146153854|gb|ABQ04708.1| nitrogen-fixing NifU domain protein [Flavobacterium johnsoniae
           UW101]
          Length = 299

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA LKF+  ++ L   A+ + N  +   SPLA  +F  P +  V+   ++I+
Sbjct: 108 VYGETTPNPAALKFVVSRM-LTRNAVEYKNIDQTASSPLAQELFKFPYVKEVFIDENYIS 166

Query: 63  VGKDQYD-WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K + + W+ +   +   I +   +G  ++    +     +D+   +  +      Q+I
Sbjct: 167 VTKYEINDWQEITLELRTFIKQFIENGGTVLDESLIQTATKNDVTKDEAFDKLDVTSQQI 226

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +L+  V+PAVA DGG+I F  Y +    V + ++GACSGCPS++ TLK G+ N+L   
Sbjct: 227 INILEEYVKPAVAADGGNIAFDSYNEDDKTVKVILQGACSGCPSSTFTLKSGIENMLKSM 286

Query: 180 V-PEVKDIRT 188
           +  E   +  
Sbjct: 287 LNDEAIKVEA 296



 Score = 63.3 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 53/131 (40%), Gaps = 1/131 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  ++T NP  LKF     +    +  F N  EA+ SPLA ++F +P + +VY   +FI 
Sbjct: 4   ITIKETQNPTILKFEFEDFITQNQSFEFKNIDEAQASPLAQQLFYLPFVKTVYISGNFIA 63

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +      DW+ ++  V   I      G  II        K      G+   + +A+   +
Sbjct: 64  IERYSIVDWDDVKDAVAEQITSFVDKGGVIIKVDENKAKKQPITVYGETTPNPAALKFVV 123

Query: 122 KEVLDNRVRPA 132
             +L       
Sbjct: 124 SRMLTRNAVEY 134


>gi|315223924|ref|ZP_07865769.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea F0287]
 gi|314946096|gb|EFS98100.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea F0287]
          Length = 299

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 5/182 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFI 61
           + TE TPNP+ +KF+  + ++    I + + KE + +P+A  +F   P I  V+F  ++I
Sbjct: 107 VYTETTPNPSVMKFVANKRLVPT-IIEYKHIKETDEAPMAKALFTQFPFIEEVFFDDNYI 165

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V K D  +W  + P +   I  +   G  +I +  +   +         + +   V ++
Sbjct: 166 SVTKKDNKEWAMVTPNIREFIKNYLSEGHTLISSSEIKRHQQATQERLLSMVTTDEVSKQ 225

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANILNH 178
           I  ++D  V+PAVA DGG+I F  Y     ++   ++GACSGCPS++ TLK G+  IL  
Sbjct: 226 IVAIIDEFVKPAVASDGGNIQFISYNPETHYVEVILQGACSGCPSSTLTLKKGIEVILKD 285

Query: 179 FV 180
            +
Sbjct: 286 KL 287



 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
            + T +P  +K    + ++ +G+  + N  EA+ SPLA  +F +P + +VY   +FI + 
Sbjct: 8   VQPTSSPDIIKLEANKALV-KGSYEYKNIDEAKNSPLAKELFYLPFVKTVYISSNFIALK 66

Query: 65  K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES 113
           +    +W+ ++  V   ++ +  SG  I+   G     +          S
Sbjct: 67  RFPIIEWKDVQEEVAQQVLLYLQSGREIVSTEGEQKEIISVYTETTPNPS 116


>gi|297182169|gb|ADI18341.1| thioredoxin-like proteins and domains [uncultured Rhodobacterales
           bacterium HF4000_03E16]
          Length = 146

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 79/151 (52%), Positives = 103/151 (68%), Gaps = 6/151 (3%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPATLKF+PGQ VL  G   F +A+ A  SPLA R+F++ G+  V+FG+DF
Sbjct: 1   MFIQTESTPNPATLKFLPGQTVLEMGTADFPSAEGASASPLAERLFAVNGVEGVFFGHDF 60

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K +  DW+HL+P +LG IMEHF SG P++     G       G  +    D  +V 
Sbjct: 61  VTVTKAEAMDWDHLKPSLLGAIMEHFQSGAPVMAGDAAGPS-----GHAEHSGEDGEIVS 115

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIV 150
           +IKE+LD+RVRPAVA+DGGDI F G+  G+V
Sbjct: 116 QIKELLDSRVRPAVAQDGGDITFHGFERGVV 146


>gi|313677059|ref|YP_004055055.1| scaffold protein nfu/nifu [Marivirga tractuosa DSM 4126]
 gi|312943757|gb|ADR22947.1| Scaffold protein Nfu/NifU [Marivirga tractuosa DSM 4126]
          Length = 198

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 62/191 (32%), Positives = 105/191 (54%), Gaps = 11/191 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           I  E  PNP +LKF   Q+++ EG +  F + ++   +PLA  +F    +  V++  +FI
Sbjct: 11  IYMEANPNPNSLKFATNQMLVPEGDSFDFPSIEDTAQAPLAEILFKKEYVDRVFYMSNFI 70

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           TV K  +Y+W  ++  V   I E   SG        + +++  D+        ++ + ++
Sbjct: 71  TVTKKPEYEWVEIQNDVKDTIKEFLESGK------RVIELQAKDLFEETNTSENAELEEQ 124

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNH 178
           IK +LD  ++PAV +DGG I F  Y      V L ++GACSGCPS++ TLK G+ N+L  
Sbjct: 125 IKNILDEYIKPAVEQDGGAISFHSYEKDTQRVNLLLQGACSGCPSSTITLKAGIENLLKR 184

Query: 179 FVP-EVKDIRT 188
            +P +VK+++ 
Sbjct: 185 MLPNDVKEVQA 195


>gi|6322811|ref|NP_012884.1| Nfu1p [Saccharomyces cerevisiae S288c]
 gi|549668|sp|P32860|NFU1_YEAST RecName: Full=NifU-like protein, mitochondrial; Flags: Precursor
 gi|486050|emb|CAA81875.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|45269699|gb|AAS56230.1| YKL040C [Saccharomyces cerevisiae]
 gi|190409786|gb|EDV13051.1| hypothetical protein SCRG_03979 [Saccharomyces cerevisiae RM11-1a]
 gi|207343478|gb|EDZ70927.1| YKL040Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256272476|gb|EEU07457.1| Nfu1p [Saccharomyces cerevisiae JAY291]
 gi|259147796|emb|CAY81046.1| Nfu1p [Saccharomyces cerevisiae EC1118]
 gi|285813219|tpg|DAA09116.1| TPA: Nfu1p [Saccharomyces cerevisiae S288c]
          Length = 256

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIAS 53
           + I+T  TPN   LKF+   G+++   G+      N  E  I+            PG+ S
Sbjct: 22  IHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVES 81

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI- 111
           +  G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G      
Sbjct: 82  LMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKINM 141

Query: 112 ------ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPS 163
                 E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S
Sbjct: 142 PKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSS 201

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           +  TLKYG+ ++L H+V EVK++  +
Sbjct: 202 SEVTLKYGIESMLKHYVDEVKEVIQI 227


>gi|315023968|gb|EFT36970.1| nifU related protein [Riemerella anatipestifer RA-YM]
 gi|325335671|gb|ADZ11945.1| Thioredoxin-like protein [Riemerella anatipestifer RA-GD]
          Length = 292

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 58/192 (30%), Positives = 93/192 (48%), Gaps = 9/192 (4%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFI 61
           I  E TPNP+ +KF+  + +L++G +   + +EA   PLA  IF        V+   +F+
Sbjct: 103 IYAEMTPNPSVMKFVASR-LLLDGFVEVKSREEAAEVPLAQAIFKEFSFAQEVFISDNFV 161

Query: 62  TVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
            V KD    W  +       I E+  +G  +         K ++          +   Q+
Sbjct: 162 AVTKDDSVQWHEVMVVTRAFIAEYLQNGGEVSQKEP---QKHENPVEKIINREYTYTEQK 218

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I +VL+  V PAV  DGG I    Y +      + ++GACSGCPS++ TLK G+ N+L  
Sbjct: 219 ISDVLNEYVAPAVENDGGKISLMEYDESTKTAKMLLQGACSGCPSSTATLKGGIENVLKQ 278

Query: 179 FVPE-VKDIRTV 189
           F+P+ V+ +  V
Sbjct: 279 FLPDLVEKVEAV 290



 Score = 54.4 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I  E T NP  +KF+    ++  G++      +    PLA  +F+ P +  ++   +FI 
Sbjct: 4  IIIEATENPRVMKFVADYNLIP-GSLELDRNSDISEIPLAQELFNYPFVDKIFITANFIA 62

Query: 63 V-GKDQYDWEHLRPPVLGMIMEHFISG 88
          V  +D  +WEH+   +  +I +  ++ 
Sbjct: 63 VAKQDTVEWEHVVQSLKNVIEDELLAN 89


>gi|254495078|ref|ZP_05108002.1| NifU-like protein [Polaribacter sp. MED152]
 gi|85819428|gb|EAQ40585.1| NifU-like protein [Polaribacter sp. MED152]
          Length = 301

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 105/192 (54%), Gaps = 7/192 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEA-EISPLASRIFSIPGIASVYFGYDFI 61
           +  E TPNPA +KF   +  L +  + + N +EA + SPLA  IF+ P +  V+   ++I
Sbjct: 110 VYAEVTPNPAVMKFGTNKA-LTQTDVEYKNIEEASKSSPLAQAIFNFPFVKEVFISDNYI 168

Query: 62  TV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V   D  +W  +   V   I E+ + G  II +    +           +E    +  +
Sbjct: 169 SVTKYDMVEWNEVFAEVRSFIREYLVDGKTIIKDLPTVETSKTPEVVAPVVE-LEGIPAQ 227

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           I ++LD  ++PAVA DGG+I F+ Y  ++ +V + ++GACSGCPS++ TLK G+ ++L  
Sbjct: 228 ISDILDEYIKPAVAGDGGNIAFRSYDEQNKVVSVILQGACSGCPSSTATLKNGIESLLKE 287

Query: 179 FVP-EVKDIRTV 189
            +P ++ ++  +
Sbjct: 288 MLPNQINEVVAI 299



 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  ++T N   LKF   +V++  G+  FSN  EA+ SPLA ++F +P +  V+   +FI 
Sbjct: 6   ITIQETTNETILKFNSTKVLINGGSYEFSNIDEAKNSPLAQQLFYLPFVKKVFITANFIA 65

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           + + D  +W  ++  V   I  +   G+ +++       K 
Sbjct: 66  IQRFDIVEWADVQDEVAEQIEAYISDGNIVVNEETTSSKKE 106


>gi|197106639|ref|YP_002132016.1| thioredoxin-like domain protein [Phenylobacterium zucineum HLK1]
 gi|196480059|gb|ACG79587.1| thioredoxin-like domain protein [Phenylobacterium zucineum HLK1]
          Length = 233

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 67/193 (34%), Positives = 96/193 (49%), Gaps = 15/193 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHF-SNAKEAEISPLASRIFSIPGIASVYFGYD 59
           M I TE TPNP   KF+P   +    A  F     +   SPLA+R+F++  +  V    D
Sbjct: 1   MLILTETTPNPEARKFLPHARLTDGTAHAFDRTGFDPAASPLAARLFALGSVRHVLIAED 60

Query: 60  FITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           F+TV +  D   W  LR   +  I +H  SG P +   G      ++          S V
Sbjct: 61  FVTVTRETDGEAWTTLRIKAIAEIADHLESGAPAVAAEGADPPDPEE----------SQV 110

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
              I++VL   VRP VARDGGD++F  +      +++ M+GAC GCPS+  TLK G+  I
Sbjct: 111 EGEIRQVLGLYVRPGVARDGGDVLFDRFEPDTGVLWIRMQGACGGCPSSRLTLKAGIEQI 170

Query: 176 LNHFVPEVKDIRT 188
           +  +VPEV  +  
Sbjct: 171 VRRYVPEVLRVEE 183


>gi|325955388|ref|YP_004239048.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
 gi|323438006|gb|ADX68470.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
          Length = 295

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 101/191 (52%), Gaps = 6/191 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFIT 62
             E TPNPA +KF+  ++++    I   + ++A+  P+A+ IF   P I  V+   ++I+
Sbjct: 104 YAEMTPNPAVMKFVSNKLLVPS-IIEIKSREKAQNVPIATAIFQEYPFIEEVFIAENYIS 162

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +   D   W+     V   ++ +  +   I ++      ++    +   IE  + V Q+I
Sbjct: 163 LTKNDTESWDLWTMDVRSFVLSYLQTDGKIFNDDYEFVTEIPHEVAIKSIEEMTDVEQQI 222

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHF 179
           K +LD  V+PAVA DGG+I    + +      + ++GACSGCPS++ TLK+G+  +L   
Sbjct: 223 KAILDEYVQPAVANDGGNIELIEFDEQTKTAKMLLQGACSGCPSSTATLKHGIEGLLKQM 282

Query: 180 VPEVK-DIRTV 189
           +PEV  ++  +
Sbjct: 283 LPEVVNNVEAI 293



 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 3  IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
          I TE+TPNP  LKF+     L  G + +     AE SPLA  + + P I  V+   +F+ 
Sbjct: 4  IYTENTPNPNILKFVCP-TQLTAGGVEYKKDDSAENSPLAQVLLTFPFIDKVFITANFVA 62

Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
          + K D   WE +   ++ +I EH+     I  +  
Sbjct: 63 LEKIDTIKWEDVSDDLIEIIQEHYDDDAIIYESKK 97


>gi|156839096|ref|XP_001643243.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113844|gb|EDO15385.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 256

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 64/205 (31%), Positives = 102/205 (49%), Gaps = 16/205 (7%)

Query: 1   MFIQTEDTPNPATLKFIP--GQVVLVEGAI--HFSNAKEAEISPLA---SRIFSIPGIAS 53
           + ++T  TPN   LKFI   G++    G       N  ++ I             PGI S
Sbjct: 27  LHVKTVSTPNENALKFISTDGELFQDRGTHSLEIKNTDDSLIEQSKFAQRLFVQCPGIES 86

Query: 54  VYFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDF-- 110
           +  G DF+TV KD    W  ++P VL ++++   SG+ I+        K  + G      
Sbjct: 87  LMIGDDFVTVNKDEMIHWNQIKPNVLEILLQQLSSGESIVTQKFHEISKESESGYDIQLP 146

Query: 111 ----IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
                E +  V   I E++  R+RPA+  DGGDI ++GY      V+L ++GAC  C S+
Sbjct: 147 KFELNEDEQEVSDMIDELIQTRIRPAIQDDGGDIQYRGYDPKTGKVYLKLQGACKSCSSS 206

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
            +TLKYG+ ++L H+V EV+++  +
Sbjct: 207 EDTLKYGIESMLKHYVEEVEEVIQI 231


>gi|213962175|ref|ZP_03390439.1| nitrogen-fixing NifU domain protein [Capnocytophaga sputigena
           Capno]
 gi|213955181|gb|EEB66499.1| nitrogen-fixing NifU domain protein [Capnocytophaga sputigena
           Capno]
          Length = 300

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 100/191 (52%), Gaps = 6/191 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASR-IFSIPGIASVYFGYDFI 61
           + TE TPNP  +KF+  + ++    I + + +EA  +P+A+  +   P I  V+F  ++I
Sbjct: 109 VYTETTPNPTVMKFVANKRLVPT-VIEYKSIEEATEAPMAATLLTRFPFIEEVFFDDNYI 167

Query: 62  TVGKDQY-DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++ K    +WE +   +   I ++   G PII+   +   + +       + +   + Q+
Sbjct: 168 SLTKKGMEEWEMIAADLRDYIRKYLSEGRPIINPSEIKRRQEEAQARLLSMVTTDEISQQ 227

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANILNH 178
           I  +++  V+PAVA DGG+I F  Y      +   ++GACSGCPS+++TLK G+  IL  
Sbjct: 228 IVAIIEQYVKPAVASDGGNIQFISYNRDTHHVEVLLQGACSGCPSSTQTLKKGIEVILKD 287

Query: 179 FVPE-VKDIRT 188
            +   + ++  
Sbjct: 288 KLNNPLINVEA 298



 Score = 61.7 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 2/95 (2%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
            + T NP  +K    + ++ +G+  F N  EA+ +PLA  +F +P + +VY   +FI + 
Sbjct: 8   IQPTANPDIIKLEANRPLV-KGSYEFKNIDEAKNAPLAKELFYLPFVKTVYISSNFIALK 66

Query: 65  K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG 98
           +    +W+ ++  V   ++ +  SG  I+      
Sbjct: 67  RFPIVEWKEVQEEVAQQVLVYLQSGKDILLGEARK 101


>gi|326334857|ref|ZP_08201058.1| nitrogen-fixing NifU domain protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325692894|gb|EGD34832.1| nitrogen-fixing NifU domain protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 295

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 99/191 (51%), Gaps = 10/191 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I  E TPNP  +KF+  + ++      + +A+EA  SPLA+ +F  P +  V+F  ++I+
Sbjct: 110 IYVESTPNPMAMKFVANKKLV-SRVYEYKSAQEAAESPLAAALFKFPYVKEVFFDSNYIS 168

Query: 63  -VGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
            + + +  WE +   +   I ++ ++G P++        +   + +      +    ++I
Sbjct: 169 VIRQPKILWEEVMMELREFIRQYLMAGKPVVRVIVEDGDRPKGLPTL-----NDIYSRKI 223

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +LD  ++PAV+ DGG+I F  Y     +V + M+GAC+GCPS+  TLK G+  IL   
Sbjct: 224 IAILDQYIKPAVSSDGGNIQFVSYDKESQVVKVLMQGACNGCPSSKLTLKQGIEAILREK 283

Query: 180 V-PEVKDIRTV 189
           +  E   +  +
Sbjct: 284 MKNERIVVEAI 294



 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 2/103 (1%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M +  + T NPA +K +   V+LV+G+  F+  ++AE SPLA  + +IP I +V+   +F
Sbjct: 1   MRLDIQRTTNPAIIK-LEAPVILVKGSYQFTTEEQAENSPLAKELLAIPFIKTVFISANF 59

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           I +      +W+ +   V   +  +   G PI+ +    +   
Sbjct: 60  IALEALPIVEWDDVAQEVALQVEAYLRRGAPILIDNIPEEAVP 102


>gi|256820781|ref|YP_003142060.1| nitrogen-fixing NifU domain-containing protein [Capnocytophaga
           ochracea DSM 7271]
 gi|256582364|gb|ACU93499.1| nitrogen-fixing NifU domain protein [Capnocytophaga ochracea DSM
           7271]
          Length = 299

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 95/182 (52%), Gaps = 5/182 (2%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIF-SIPGIASVYFGYDFI 61
           + TE TPNP+ +KF+  + ++    I + + +E + +P+A  +F   P I  V+F  ++I
Sbjct: 107 VYTETTPNPSVMKFVANKRLVPT-IIEYKHIEETDEAPMAKALFTQFPFIEEVFFDDNYI 165

Query: 62  TVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           +V K D  +W  +   +   I  +   G  +I +  +   +         + +   V ++
Sbjct: 166 SVTKKDNKEWAMVTSNIREFIKNYLSEGHILISSSEIKRHQQATQERLLSMVTTDEVSKQ 225

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLS--MRGACSGCPSASETLKYGVANILNH 178
           I  ++D  V+PAVA DGG+I F  Y     ++   ++GACSGCPS++ TLK G+  IL  
Sbjct: 226 IIAIIDEFVKPAVASDGGNIQFISYNPETHYVEVILQGACSGCPSSTLTLKKGIEVILKD 285

Query: 179 FV 180
            +
Sbjct: 286 KL 287



 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
            + T +P  +K    + ++ +G+  + N  EA+ SPLA  +F +P + +VY   +FI + 
Sbjct: 8   VQPTSSPDIIKLEANKALV-KGSYEYKNIDEAKNSPLAKELFYLPFVKTVYISSNFIALK 66

Query: 65  K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES 113
           +    +W+ ++  V   ++ +  SG  I+   G     +          S
Sbjct: 67  RFPIIEWKDVQEEVAQQVLLYLQSGREIVSTEGEQKKVISVYTETTPNPS 116


>gi|322499834|emb|CBZ34907.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 284

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQV--VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  ++F    V  +  E ++   +  +A  SPLA  +F + G+ +V+   ++
Sbjct: 68  VETNETPNPDCMRFFSMDVSFLKPEFSMDIPSPAQAYKSPLAEALFGVAGVQAVFLADEY 127

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV    Q DW  L P +  +I+E   S + ++   G  ++   +    +  + D  VV 
Sbjct: 128 VTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEELLGYN-NDTEPDDDDDEVVL 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  +L H+
Sbjct: 187 AVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHVTLKSGIERMLMHW 246

Query: 180 VPEVKDIRTV 189
           +PEV + + V
Sbjct: 247 IPEVVEAQEV 256


>gi|146089377|ref|XP_001470367.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134070400|emb|CAM68738.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 284

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQV--VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  ++F    V  +  E ++   +  +A  SPLA  +F + G+ +V+   ++
Sbjct: 68  VETNETPNPDCMRFFSMDVSFLKPEFSMDIPSPAQAYKSPLAEALFGVAGVQAVFLADEY 127

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV    Q DW  L P +  +I+E   S + ++   G  ++   +    +  + D  VV 
Sbjct: 128 VTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEELLGYN-NDTEPDDDDDEVVL 186

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  +L H+
Sbjct: 187 AVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHVTLKSGIERMLMHW 246

Query: 180 VPEVKDIRTV 189
           +PEV + + V
Sbjct: 247 IPEVVEAQEV 256


>gi|227536308|ref|ZP_03966357.1| nifU domain protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|300772344|ref|ZP_07082214.1| NifU domain protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|227243915|gb|EEI93930.1| nifU domain protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|300760647|gb|EFK57473.1| NifU domain protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 184

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 57/178 (32%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           + TE TPNPAT+KF+  + +L+ G++ + N ++A+ SP A  +F    +  V+F  +F+T
Sbjct: 6   VYTESTPNPATMKFLVNK-LLINGSLDYPNKEKAQESPFAFELFKFNFVTGVFFASNFVT 64

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           + K D  +W  +   +   +     S   +       D   +           + V  +I
Sbjct: 65  ITKSDDVEWSDIEAILKDFVKGAVESELAVKEVHHDEDTNFEG----------TEVEVKI 114

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
           ++VL + VRPAV +DGG I +K + +GIV + +RG+CSGCPS++ TLK G+  +L   
Sbjct: 115 QQVLHDYVRPAVEQDGGAIHYKSFDNGIVTVELRGSCSGCPSSTITLKSGIEGLLKRM 172


>gi|254566217|ref|XP_002490219.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|238030015|emb|CAY67938.1| Protein involved in iron metabolism in mitochondria [Pichia
           pastoris GS115]
 gi|328350616|emb|CCA37016.1| NifU-like protein 5, mitochondrial [Pichia pastoris CBS 7435]
          Length = 257

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 68/211 (32%), Positives = 109/211 (51%), Gaps = 24/211 (11%)

Query: 3   IQTEDTPNPATLKFIP-GQVVLV----EGAIHFSNAKEA-EISPLASRIFSIPGIASVYF 56
           IQT  TPN   LKFI  G  +L     +  I   +   A E SPLA ++F +PG+ S+  
Sbjct: 22  IQTASTPNDNALKFITKGVRLLPPHIQKSTIEIDDLASATEKSPLALQLFKVPGVKSILI 81

Query: 57  GYDFITVGK--------DQYDWEHLRPPVLGMIMEHFISG--------DPIIHNGGLGDM 100
           G DFITV K        D   W+ L+P ++ +I                P          
Sbjct: 82  GDDFITVNKVDEKLSNSDHSRWQFLKPQIINVIDRSLSKSSEKKVNVLTPQFLENISNVH 141

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGAC 158
             D + S + +++D  V   IKE+++ R+RPA+  DGGD+ F+ +     IV++ ++GAC
Sbjct: 142 HDDYIVSQEPLDTDDDVTYEIKELINTRIRPAIQDDGGDVQFRRFDPDAGIVYIKLKGAC 201

Query: 159 SGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             C  + +TLK+G+ ++L H+V EVK+++ +
Sbjct: 202 KSCSLSEDTLKHGIESMLQHYVEEVKEVKAI 232


>gi|301166538|emb|CBW26114.1| putative nitrogen fixation-related protein [Bacteriovorax marinus
           SJ]
          Length = 184

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 86/184 (46%), Gaps = 9/184 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M IQ + TPNP  LKFI  + V  EG   + +  +   + LA  +F++ G+  ++F  + 
Sbjct: 1   MDIQIQPTPNPNALKFILDKPVKNEGNSSYKSPMDCGDNNLALTLFTVRGVDQLHFYDNV 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           IT+ K  Y+       +   IM++  S  P            D     +   + S  ++ 
Sbjct: 61  ITITKFGYEDWE---SMEPTIMDYINSEYPKH-----DPNYFDPDPEAERRANLSPELKE 112

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN-HF 179
           I+ +LD  +RP +  DGGDI    + D I+ +  +GAC  CPS++      +  IL   +
Sbjct: 113 IEAILDKTIRPGLQGDGGDIQTISFEDNILLVQYQGACGTCPSSTTGTLEAIKAILRDEY 172

Query: 180 VPEV 183
            P++
Sbjct: 173 NPDI 176


>gi|328350796|emb|CCA37196.1| NifU-like protein 5, mitochondrial [Pichia pastoris CBS 7435]
          Length = 210

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 99/179 (55%), Gaps = 11/179 (6%)

Query: 14  LKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYD-WEH 72
           +K +P Q       I F N ++A  SPLA ++F I G+ ++  G+DFITV K   D W  
Sbjct: 1   MKILPEQT-----TIEFLNGRQAFKSPLALKLFGIDGVKTIMIGHDFITVEKKTQDDWSL 55

Query: 73  LRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPA 132
           L+P +  ++ E   +G P+++     D     +      + +  VV  +KE++  R+RPA
Sbjct: 56  LKPEIFAVLTESLNNGTPVLNEQHQSDANDQALLEE---DDEDEVVSMVKELIFTRIRPA 112

Query: 133 VARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +  DGGDI F  +    G V+L +RGAC  C S+S TLK G+ ++L H++ EV+ +  +
Sbjct: 113 IQDDGGDIEFVRFEYETGTVYLRLRGACRSCSSSSITLKNGIESMLKHYIEEVEAVEQI 171


>gi|261329222|emb|CBH12201.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 280

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 69/192 (35%), Positives = 105/192 (54%), Gaps = 6/192 (3%)

Query: 2   FIQTE--DTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFG 57
           FI  E  +TPNP  L+F   +   +    ++   +A+ A  SPLA  +FSI G+ SV+  
Sbjct: 60  FIVVEKNETPNPDCLRFYSMELSFLPPGRSLDLPDAQHAGKSPLAELLFSISGVQSVFLA 119

Query: 58  YDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            ++ITVGK    DW  L P +   I+E   SG  I+   G     +D+    D  + D  
Sbjct: 120 DEYITVGKVPHVDWGSLVPQIQECIVEFAESGVGILSEEGEA-CFVDNNNDTDPEDDDDE 178

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  +KE+L  R+RP +  DGG++ +    DG VF+ + GAC  CPS+  TLK G+  +L
Sbjct: 179 VVLAVKELLSARIRPLLRADGGNVRYISMDDGTVFVLLEGACKSCPSSGVTLKNGIERML 238

Query: 177 NHFVPEVKDIRT 188
            H++PEV +++ 
Sbjct: 239 MHWIPEVVEVQE 250


>gi|195559882|ref|XP_002077376.1| GD12677 [Drosophila simulans]
 gi|194202482|gb|EDX16058.1| GD12677 [Drosophila simulans]
          Length = 175

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 60/148 (40%), Positives = 89/148 (60%), Gaps = 8/148 (5%)

Query: 43  SRIFSIPGIASVYFGYDFITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK 101
             +F + G+  V+FG DFIT+  ++  +W  ++P V  +IM+ F SG P++++       
Sbjct: 2   KLLFRVEGVKGVFFGSDFITISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPN--- 58

Query: 102 LDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGC 161
                  + +E D   V  IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS C
Sbjct: 59  ----ADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIVFMGYEAGVVKLKMQGSCSSC 114

Query: 162 PSASETLKYGVANILNHFVPEVKDIRTV 189
           PS+  TLK GV N+L  ++PEV+ +  V
Sbjct: 115 PSSIVTLKNGVQNMLQFYIPEVESVEQV 142


>gi|322827929|gb|EFZ31905.1| hypothetical protein TCSYLVIO_1772 [Trypanosoma cruzi]
          Length = 261

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/198 (31%), Positives = 94/198 (47%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPGQV----VLVEGAIHFSNAKEAEISPLASRIFSIPG--IAS 53
           M +    TPNP  L F IP       +        ++   A + PL++ IF   G  +AS
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTYDGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEVAS 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  L   +   I  + +  +  +       +  DD+      E
Sbjct: 71  VFIAPRHVSITVYPNVDWSTLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDL---RIHE 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            DS V+Q IKE+L  +VRP V RDGGD+    + D    V L+M GAC  CPS+S TLK 
Sbjct: 128 EDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNDETGVVSLAMLGACRTCPSSSNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 188 GIERVMKHFLPEVTEVVE 205


>gi|71666135|ref|XP_820030.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885357|gb|EAN98179.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 261

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 61/198 (30%), Positives = 94/198 (47%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPGQV----VLVEGAIHFSNAKEAEISPLASRIFSIPG--IAS 53
           M +    TPNP  L F IP       +        ++   A + PL++ IF   G  +AS
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTYDGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEVAS 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  L   +   I  + +  +  +       +  DD+      E
Sbjct: 71  VFIAPRHVSITVYPNVDWSTLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDL---RIHE 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            DS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+S TLK 
Sbjct: 128 EDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 188 GIERVMKHFLPEVTEVVE 205


>gi|8118105|gb|AAF72894.1|AF228511_2 NU1 [Trypanosoma cruzi]
          Length = 261

 Score =  131 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 60/198 (30%), Positives = 94/198 (47%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IPGQV----VLVEGAIHFSNAKEAEISPLASRIFSIPG--IAS 53
           M +    TPNP  L F IP       +        ++   A + PL++ IF   G  +AS
Sbjct: 11  MQLHAAPTPNPLCLAFHIPSSTYDGFIPNGQTCEVAHRGLAWVHPLSNGIFEQYGQEVAS 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      +W  L   +   I  + +  +  +       +  DD+      E
Sbjct: 71  VFIAPRHVSITVYPNVEWSKLEWSISSFIGHYLLFVNECVPAAKEYTLMEDDL---RIHE 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            DS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+S TLK 
Sbjct: 128 EDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 188 GIERVMKHFLPEVTEVVE 205


>gi|79313311|ref|NP_001030735.1| NFU4; structural molecule [Arabidopsis thaliana]
 gi|332642928|gb|AEE76449.1| NifU-like protein 4 [Arabidopsis thaliana]
          Length = 222

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 62/148 (41%), Positives = 86/148 (58%), Gaps = 6/148 (4%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+ TPNP++L F PG+ V+  G+  F N + A  SPLA  I+SI G+  V+FG DF
Sbjct: 80  MFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPLAKSIYSIDGVVRVFFGSDF 139

Query: 61  ITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV K D   W+ L+P +   +M+ + SG P+  +      K          E DS  V 
Sbjct: 140 VTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAAK-----DTAISEDDSETVA 194

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRD 147
            IKE+L+ R+RPAV  DGGDI + G+  
Sbjct: 195 MIKELLETRIRPAVQDDGGDIEYCGFDP 222


>gi|294936237|ref|XP_002781672.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239892594|gb|EER13467.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 262

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 98/193 (50%), Gaps = 11/193 (5%)

Query: 3   IQTEDTPNPATLKFIP--GQVVLVEGAIHFS-NAKEAEISPLASRIFSIPGIASVYFGYD 59
           +  E TPNP+ + F    G+ +L +GA   S    +   SPLA+ +F I G+  V     
Sbjct: 31  VSAEATPNPSAMIFTLEGGKPILGKGAKSMSFEKTQCGGSPLAASLFRIHGVDKVLLAAR 90

Query: 60  FITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
             TV K    +WE L+P V  +I + F   +         +   +          +  VV
Sbjct: 91  HATVTKSPETEWEMLKPNVELVISQFFDIPNVKPVAPDTIEYTQEGQDQH-----NDDVV 145

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANIL 176
           + I E+L+ R++P V RDGGD+ F  +      + + + G+C+GCP +S TLK+G+  ++
Sbjct: 146 KSIHEILEQRIKPFVERDGGDVEFIAFDSDTGVLQIRLVGSCAGCPKSSVTLKFGIQRMV 205

Query: 177 NHFVPEVKDIRTV 189
            H++PEVK++  +
Sbjct: 206 CHYIPEVKNVINI 218


>gi|72391004|ref|XP_845796.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|62176423|gb|AAX70531.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
 gi|70802332|gb|AAZ12237.1| HIRA-interacting protein 5, putative [Trypanosoma brucei brucei
           strain 927/4 GUTat10.1]
          Length = 280

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/185 (35%), Positives = 102/185 (55%), Gaps = 4/185 (2%)

Query: 7   DTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           +TPNP  L+F   +   +    ++   +A+ A  SPLA  +FSI G+ SV+   ++ITVG
Sbjct: 67  ETPNPDCLRFYSMELSFLPPGRSLDLPDAQHAGKSPLAELLFSISGVQSVFLADEYITVG 126

Query: 65  K-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           K    DW  L P +   I+E   SG  ++   G     +D+    D  + D  VV  +KE
Sbjct: 127 KVPHVDWGSLVPQIQECIVEFAESGVGVLSEEGEA-CFVDNNNDTDPEDDDDEVVLAVKE 185

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           +L  R+RP +  DGG++ +    DG VF+ + GAC  CPS+  TLK G+  +L H++PEV
Sbjct: 186 LLSARIRPLLRADGGNVRYISMDDGTVFVLLEGACKSCPSSGVTLKNGIERMLMHWIPEV 245

Query: 184 KDIRT 188
            +++ 
Sbjct: 246 VEVQE 250


>gi|322492565|emb|CBZ27842.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 281

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 60/190 (31%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQV--VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  ++F    +  +  E ++   +  +A  SPLA  +F + G+ +V+   ++
Sbjct: 65  VETNETPNPDCIRFFSMDISFLKPEFSVDIPSPAQAYKSPLAEALFGVAGVQAVFLADEY 124

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV    Q DW  L P +  +I+E   S + ++   G  ++   +    +  E D  VV 
Sbjct: 125 VTVRKHPQEDWAALMPIIKEVIVEFAESKENVLSAAGEEELLGYN-NDTEPDEDDDEVVL 183

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ F    +G VFL + GAC  CPS+  TLK G+  +L H+
Sbjct: 184 AVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGACKSCPSSHITLKSGIERMLMHW 243

Query: 180 VPEVKDIRTV 189
           +PEV + + V
Sbjct: 244 IPEVVEAQEV 253


>gi|157870953|ref|XP_001684026.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68127094|emb|CAJ04535.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 240

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 3   IQTEDTPNPATLKFIPGQ--VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           ++T +TPNP  ++F       +  E ++  ++  +A  SPLA  +F + G+ +V+   ++
Sbjct: 24  VETNETPNPDCMRFFSMDLSFLKPEFSMDITSPAQAYKSPLAEALFGVAGVQAVFLADEY 83

Query: 61  ITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQ 119
           +TV    Q DW  L P +  +I+E   S + ++   G  ++   +    +  E D  VV 
Sbjct: 84  VTVRKHPQADWAALIPIIKEVIVEFAESKENVLSAAGEEELLGYN-NDTEPDEDDDEVVL 142

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            +KE+L  R+RP +  DGG++ F    +G VFL + G+C  CPS+  TLK G+  +L H+
Sbjct: 143 AVKELLATRIRPMLRADGGNVRFIDMDEGTVFLLLEGSCKSCPSSHITLKSGIERMLMHW 202

Query: 180 VPEVKDIRTV 189
           +PEV + + V
Sbjct: 203 IPEVVEAQEV 212


>gi|71747438|ref|XP_822774.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|70832442|gb|EAN77946.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/198 (30%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M + +  TPNP+   F IP       +        ++   A + PL+  IF      +AS
Sbjct: 11  MQLHSLPTPNPSCYTFHIPSSTYDNFIPDGQTCDVAHMGLAWVHPLSQGIFEQYPQEVAS 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+      ++      DW  L   +   I  + +  +          +  DD+      E
Sbjct: 71  VFIAPRHTSITVHPHVDWNKLEWSISSFIGHYLVFTNACFPAAAEYALLEDDL---VIHE 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            DS V+Q IKE++  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 128 DDSEVLQCIKELVREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           GV  +L HF+PEVK++  
Sbjct: 188 GVERLLKHFLPEVKEVVE 205


>gi|261332565|emb|CBH15560.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 261

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/198 (30%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M + +  TPNP+   F IP       +        ++   A + PL+  IF      +AS
Sbjct: 11  MQLHSLPTPNPSCYTFHIPSSTYDNFIPDGQTCDVAHMSLAWVHPLSQGIFEQYPQEVAS 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+      ++      DW  L   +   I  + +  +          +  DD+      E
Sbjct: 71  VFIAPRHTSITVHPHVDWNKLEWSISSFIGHYLVFTNACFPAAAEYALLEDDL---VIHE 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
            DS V+Q IKE++  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 128 DDSEVLQCIKELVRGQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           GV  +L HF+PEVK++  
Sbjct: 188 GVERLLKHFLPEVKEVVE 205


>gi|320584117|gb|EFW98328.1| hypothetical protein HPODL_0008 [Pichia angusta DL-1]
          Length = 250

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/197 (29%), Positives = 103/197 (52%), Gaps = 18/197 (9%)

Query: 8   TPNPATLKFIPGQ----VVLVEGAIHFSN-AKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           TPN   LKFI          +  A+  ++  + ++ SPLAS +F + G+ S+  G++FIT
Sbjct: 31  TPNENALKFISTDFNFLPESLTSAVEVNDLPEASQRSPLASELFKLNGVKSLLIGHNFIT 90

Query: 63  VG--------KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
           V              W+ L   V+ +I     S  P+++   L ++      + +  +  
Sbjct: 91  VNKVDPELSNNPDLHWDSLSTKVMNVITNAVDSNIPVLNPEYLDEIVRKQDEAQEDDDD- 149

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGV 172
             V   IKE+++ R+RPA+  DGGDI F+ +      V+L ++GAC  C  + +TLK G+
Sbjct: 150 --VTYEIKELINTRIRPALQDDGGDIHFRSFDAESGTVYLKLQGACKSCSLSEDTLKNGI 207

Query: 173 ANILNHFVPEVKDIRTV 189
            ++L H++PEV++++ V
Sbjct: 208 ESMLKHYIPEVEEVKAV 224


>gi|50292835|ref|XP_448850.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528163|emb|CAG61820.1| unnamed protein product [Candida glabrata]
          Length = 263

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/202 (30%), Positives = 103/202 (50%), Gaps = 16/202 (7%)

Query: 3   IQTEDTPNPATLKFI--PGQVVLVEGAIHF--SNAKEAEISPL---ASRIFSIPGIASVY 55
           IQT  TPN   LKF+    +++   G+      N  +  IS     +      PG+ S+ 
Sbjct: 26  IQTLTTPNENALKFLNKDNELLQTRGSKSIVIKNTDQNLISHSDLASKIFAQCPGVESLM 85

Query: 56  FGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
            G DF+TV KD Q  W  ++  V+ ++ +   SG  +I +      + ++ G        
Sbjct: 86  IGDDFLTVNKDSQVPWAQIQSDVIDLLTQQLASGKNVISDEFHAIKEDNEAGYQINEMKF 145

Query: 115 S------AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASE 166
                   + + I+E+++ R+RPA+  DGGDI F+G+      V+L ++GAC+ C S+  
Sbjct: 146 DLTEEDEEIKELIEELIETRIRPAILEDGGDIDFRGWDPESGTVYLKLQGACTSCSSSEV 205

Query: 167 TLKYGVANILNHFVPEVKDIRT 188
           TLKYG+ ++L H+V EVK++  
Sbjct: 206 TLKYGIESMLKHYVDEVKEVIQ 227


>gi|149912092|ref|ZP_01900681.1| hypothetical protein PE36_11562 [Moritella sp. PE36]
 gi|149804829|gb|EDM64868.1| hypothetical protein PE36_11562 [Moritella sp. PE36]
          Length = 215

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 88/179 (49%), Gaps = 5/179 (2%)

Query: 11  PATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQY-D 69
           P T KFI  + +   G   F+N + A  SPL  ++F++PG+A+V      +T+ K+    
Sbjct: 22  PDTCKFIVSRTLHPGGPFFFANKERAAGSPLGEQLFALPGVANVLIAESIVTICKEPTAS 81

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  +   I    ++G P I    +      D  +G    SD+ ++  I+ +LD  +
Sbjct: 82  WSGLKAAIGTAIRAQLLTGVPAILEMYI----HTDTQTGMQRRSDAELITVIQGLLDKEI 137

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
             ++A  GG I     R G +++SM G C GC SA  TL+ G   +L    PE+++I  
Sbjct: 138 NRSIANHGGKISIVEIRQGKLYISMSGGCQGCASAQVTLRQGFEVMLKRVAPEIEEIVD 196


>gi|82701834|ref|YP_411400.1| nitrogen-fixing NifU-like [Nitrosospira multiformis ATCC 25196]
 gi|82409899|gb|ABB74008.1| Nitrogen-fixing NifU-like protein [Nitrosospira multiformis ATCC
           25196]
          Length = 186

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 83/188 (44%), Gaps = 7/188 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           ++ E TPN   LKFI  + +       + NA++A+  PLA  +F I  + +V++   +IT
Sbjct: 5   VEIEGTPNRNALKFILKEPLTWGVTRSYDNAEQAKGDPLAEALFDIDHVTNVFYVDRWIT 64

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V +D   DW+ L   V   I        P         +        +    D   +  I
Sbjct: 65  VTQDGAADWQDLAREVADPIR-----AAPAADAQTAATIAAAGAEIANLSPEDQQRLNLI 119

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
            E+LD  +RP +  DGGD+   G     + +  +GAC  CPS+      G+ N+L    P
Sbjct: 120 NEMLDEEIRPYLQSDGGDLHVLGLEGNRLSVHYQGACGTCPSSITGTLRGIQNMLRSIEP 179

Query: 182 EVKDIRTV 189
           ++ ++  V
Sbjct: 180 DL-EVVAV 186


>gi|325982994|ref|YP_004295396.1| Scaffold protein Nfu/NifU [Nitrosomonas sp. AL212]
 gi|325532513|gb|ADZ27234.1| Scaffold protein Nfu/NifU [Nitrosomonas sp. AL212]
          Length = 186

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 6/183 (3%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
            E TPN   LKFI  + +    A  F NA+ A   PLAS +F I  + +V++   +ITV 
Sbjct: 7   IEGTPNKNALKFILKEPLTWGVARSFDNAEAARDDPLASALFDIDHVTNVFYIDHWITVT 66

Query: 65  KD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           +D + +W+ L   +   I     +              L ++        D   +++I  
Sbjct: 67  QDGEANWQDLARDIADPIRAAPAASAQSAETVATASQALANLN-----PEDQLRLEKINI 121

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           +LD  VRP +  DGGD+   G    I+ +  +GAC  CPS+      G+ N+L    P++
Sbjct: 122 LLDEEVRPYLQSDGGDLHILGLEGNILHIHYQGACGTCPSSISGTLRGIENMLRTLEPDI 181

Query: 184 KDI 186
           + +
Sbjct: 182 QVV 184


>gi|149525599|ref|XP_001517848.1| PREDICTED: similar to HIRA interacting protein 5 [Ornithorhynchus
           anatinus]
          Length = 180

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 52/150 (34%), Positives = 82/150 (54%), Gaps = 9/150 (6%)

Query: 42  ASRIFSIPGIASVYFGYDFITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGD 99
           +  +F I G+ SV+ G DFITV    +  DW  L+P +   IM+ F SG P++       
Sbjct: 29  SRHLFRIEGVKSVFLGPDFITVTKENEDVDWNLLKPDIYATIMDFFASGLPVVTEEAPSA 88

Query: 100 MKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACS 159
                  S          V  I+ +L +  RP V  DGGD++++G+ DG+V L ++G+C+
Sbjct: 89  EAARARESK-------DAVVLIERLLSSMARPTVQEDGGDVIYRGFEDGVVQLKLQGSCT 141

Query: 160 GCPSASETLKYGVANILNHFVPEVKDIRTV 189
            CPS+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 142 SCPSSIVTLKSGIQNMLQFYIPEVEGVEQV 171


>gi|30249416|ref|NP_841486.1| nitrogen-fixing protein NifU [Nitrosomonas europaea ATCC 19718]
 gi|30138779|emb|CAD85356.1| Nitrogen-fixing protein NifU [Nitrosomonas europaea ATCC 19718]
          Length = 186

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 6/186 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + E TPNP  LKF+  + +    A  + +A++A   PLA+ +F I  + +V++   +IT+
Sbjct: 6   EIEGTPNPNALKFVLKEPLTWGVAKSYDHAEQAVDDPLAAALFDIDHVTNVFYVDRWITI 65

Query: 64  GKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D   DW+ L   V   I     + D            L D+      E D   ++RI 
Sbjct: 66  TQDGGADWQDLAREVADPIRAAPAATDQSAAVVAAASRTLADLS-----EEDQQRLERIN 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +LD  VRP +  DGGD+        I+ +  +GAC  CPS+      G+  +L    P+
Sbjct: 121 ILLDEEVRPFLQHDGGDLHVLALEGNILRIHYQGACGTCPSSISGTLRGIEQLLRTIEPD 180

Query: 183 VKDIRT 188
           ++ +  
Sbjct: 181 IRVVSA 186


>gi|322490669|emb|CBZ25931.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 301

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/198 (27%), Positives = 92/198 (46%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP       V    +   ++   A + PL+  +F      + S
Sbjct: 52  MQLHAQPTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYSQEVMS 111

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      +W  +   +   +  + I  +  I       +  DD+      +
Sbjct: 112 VFIAPRHVSISVYTNVEWSKIEWSISSFLGHYLIFNNTCISPAKEYTLIEDDLE---LKD 168

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 169 TDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACKTCPSSQNTLKD 228

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 229 GIERVMKHFLPEVTEVIE 246


>gi|42521822|ref|NP_967202.1| putative nitrogen-fixing protein NifU [Bdellovibrio bacteriovorus
           HD100]
 gi|39574352|emb|CAE77856.1| putative nitrogen-fixing protein NifU [Bdellovibrio bacteriovorus
           HD100]
          Length = 186

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 91/187 (48%), Gaps = 10/187 (5%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I+ + TPNP   KF+  + VL +G   +++AKEAE S LAS +F + G+  V+F  + IT
Sbjct: 8   IRIQATPNPNAWKFVLDRAVLNDGKATYADAKEAEQSILASSLFQVEGVRQVHFFQNVIT 67

Query: 63  VGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +  +   D E ++  V  +I     + +P +       ++           S    VQ+I
Sbjct: 68  ITHNFDADPEEIQRNVCSVIQTRMPAHNPAVTQMDEKKLR---------RASLPPEVQQI 118

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           +E+LD  VRP +  DGGD+    Y D  +++  +GAC  CPSA+      +  IL     
Sbjct: 119 EEILDQTVRPGLQGDGGDLDVVKYEDNKLYVFYQGACGTCPSATSGTLMAIEGILRDQFN 178

Query: 182 EVKDIRT 188
              ++  
Sbjct: 179 PTIEVIP 185


>gi|126668356|ref|ZP_01739314.1| hypothetical protein MELB17_13022 [Marinobacter sp. ELB17]
 gi|126627172|gb|EAZ97811.1| hypothetical protein MELB17_13022 [Marinobacter sp. ELB17]
          Length = 211

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 85/180 (47%), Gaps = 9/180 (5%)

Query: 11  PATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQY-D 69
           P T KFI  + +   G   F N + A  SPL  ++F++PG+A++      +TV K+    
Sbjct: 22  PDTCKFIVSRTLHPGGPFFFGNKERAVGSPLGEQLFALPGVANLLIADSVVTVCKEPAAS 81

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+  +   I     SG P I              +    ++D+ +   ++E+LD  V
Sbjct: 82  WSGLKAGIGMAIRTQLRSGVPAILEMPA--------HNRRQGKTDAELTTAVQELLDKEV 133

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             ++A  GG I   G R G + ++M G C GC S+  TL+ G   +L    PE+++I  V
Sbjct: 134 NRSIANHGGKISIVGVRQGKLSITMSGGCQGCASSQVTLRQGFEVMLKRVAPEIEEIIDV 193


>gi|154345572|ref|XP_001568723.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134066065|emb|CAM43852.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 260

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 54/198 (27%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP       V    +   ++   A + PL+  +F      +  
Sbjct: 11  MQLHAQPTPNPLCHSFSIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQEVMC 70

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  +       +  DD+      +
Sbjct: 71  VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFNNACVSPAKEYTLIEDDLE---LKD 127

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 128 NDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKD 187

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 188 GIERVMKHFLPEVTEVIE 205


>gi|114331232|ref|YP_747454.1| NifU domain-containing protein [Nitrosomonas eutropha C91]
 gi|114308246|gb|ABI59489.1| nitrogen-fixing NifU domain protein [Nitrosomonas eutropha C91]
          Length = 186

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 85/184 (46%), Gaps = 6/184 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + E TPNP  LKFI  + +       ++NA++A   PLA+ +F I  + +V++   +IT+
Sbjct: 6   EIEGTPNPNALKFILKEPLTWGVTKSYNNAEQAADDPLAAALFDIDHVINVFYVDRWITI 65

Query: 64  GKDQ-YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D   DW+ L   V   I        P   +     +        +  E D   ++RI 
Sbjct: 66  TQDGGADWQDLAREVADPIR-----AAPAATDQSATVVAAASEALANLSEEDQQRLERIN 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +L+  VRP +  DGGD+        ++ +  +GAC  CPS+      G+  +L    P+
Sbjct: 121 ILLEEEVRPYLQHDGGDLHVLALEGSLLRIHYQGACGTCPSSISGTLRGIEQLLRTIEPD 180

Query: 183 VKDI 186
           ++ +
Sbjct: 181 IRVV 184


>gi|323332794|gb|EGA74199.1| Nfu1p [Saccharomyces cerevisiae AWRI796]
          Length = 224

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/194 (28%), Positives = 98/194 (50%), Gaps = 17/194 (8%)

Query: 13  TLKFIP--GQVVLVEGAIHF--SNAKEAEISPLA---SRIFSIPGIASVYFGYDFITVGK 65
            LKF+   G+++   G+      N  E  I+            PG+ S+  G DF+T+ K
Sbjct: 2   ALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINK 61

Query: 66  D-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-------ESDSAV 117
           D    W  ++P ++ ++ +    G+ +I        + +  G            E D  V
Sbjct: 62  DRMVHWNSIKPEIIDLLTKQLACGEDVISKEFHAVQEEEGEGGYKINMPKFELTEEDEEV 121

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANI 175
            + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S+  TLKYG+ ++
Sbjct: 122 SELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESM 181

Query: 176 LNHFVPEVKDIRTV 189
           L H+V EVK++  +
Sbjct: 182 LKHYVDEVKEVIQI 195


>gi|90076830|dbj|BAE88095.1| unnamed protein product [Macaca fascicularis]
          Length = 199

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/132 (42%), Positives = 73/132 (55%), Gaps = 10/132 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT++TPNP +LKFIPG+ VL    + F     A  SPLA ++F I G+ SV+FG DF
Sbjct: 59  MFIQTQNTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDF 118

Query: 61  ITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV    +  DW  L+P +   IM+ F SG P++                   E D  VV
Sbjct: 119 ITVTKENEDLDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGS--------EEDDEVV 170

Query: 119 QRIKEVLDNRVR 130
             IKE+LD R+R
Sbjct: 171 AMIKELLDTRIR 182


>gi|157876630|ref|XP_001686660.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68129735|emb|CAJ09041.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 311

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 56/198 (28%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +    TPNP    F IP       V    +   ++   A + PL+  +F      + S
Sbjct: 62  MQLHALPTPNPLCHTFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMS 121

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  I       +  DD+      +
Sbjct: 122 VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLMEDDLE---LKD 178

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
           +D+ V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 179 TDTEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKD 238

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HFVPEV ++  
Sbjct: 239 GIERVMKHFVPEVTEVIE 256


>gi|146103241|ref|XP_001469515.1| hypothetical protein [Leishmania infantum]
 gi|134073885|emb|CAM72624.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 299

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/198 (28%), Positives = 92/198 (46%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP       V    +   ++   A + PL+  +F      + S
Sbjct: 50  MQLHAQRTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMS 109

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  I       +  DD+      +
Sbjct: 110 VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLIEDDLE---LKD 166

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
           SDS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 167 SDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKD 226

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 227 GIERVMKHFLPEVTEVIE 244


>gi|322503448|emb|CBZ38533.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 299

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/198 (28%), Positives = 92/198 (46%), Gaps = 13/198 (6%)

Query: 1   MFIQTEDTPNPATLKF-IP----GQVVLVEGAIHFSNAKEAEISPLASRIFSI--PGIAS 53
           M +  + TPNP    F IP       V    +   ++   A + PL+  +F      + S
Sbjct: 50  MQLHAQRTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQYPQELMS 109

Query: 54  VYFGYDFITVG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE 112
           V+     +++      DW  +   +   +  + I  +  I       +  DD+      +
Sbjct: 110 VFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLIEDDLE---LKD 166

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKY 170
           +DS V+Q IKE+L  +VRP V RDGGD+    + +    V L+M GAC  CPS+  TLK 
Sbjct: 167 TDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKD 226

Query: 171 GVANILNHFVPEVKDIRT 188
           G+  ++ HF+PEV ++  
Sbjct: 227 GIERVMKHFLPEVTEVIE 244


>gi|57335931|emb|CAH25367.1| nifU-like protein [Guillardia theta]
          Length = 183

 Score =  117 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 71/127 (55%), Gaps = 8/127 (6%)

Query: 65  KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEV 124
           KDQ+ W  ++P V   I++ + S         +   + D        E DS +V  IKE+
Sbjct: 32  KDQHSWAEMKPEVFDAILDFYAS------GQSIITAEEDMPQDTKVNEDDSEIVAMIKEL 85

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           LD R+RPAV  DGGDI F G+ +    V + ++GACS C S+  TLK GV N+L H+VPE
Sbjct: 86  LDTRIRPAVQDDGGDISFIGFDEETGRVTVRLQGACSTCSSSKVTLKSGVENMLMHYVPE 145

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 146 VTEVVAV 152


>gi|89900651|ref|YP_523122.1| nitrogen-fixing NifU-like protein [Rhodoferax ferrireducens T118]
 gi|89345388|gb|ABD69591.1| nitrogen-fixing NifU-like [Rhodoferax ferrireducens T118]
          Length = 186

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + EDTPNP   KF+  + +    A  + NA++A+   LAS +F+I  + +V++   ++TV
Sbjct: 6   EIEDTPNPNARKFVLREPLTWGIAHSYENAEQAQGDALASALFAIDHVTNVFYIDRWLTV 65

Query: 64  GKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D Q +W+ L   +   +     + +            + D+ + D    D      I+
Sbjct: 66  TQDGQANWDALVREIAVPLRAAPAASEQSAAAVFEARAHVADLSAQDRQRLDD-----IE 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +LD  +RP +  DGGD+   G     + +  +GAC  CPSA      G+ + L    P+
Sbjct: 121 LILDQEIRPYLQSDGGDLHILGLAGNQLIVHYQGACGTCPSAISGTLQGIESRLRTLEPD 180

Query: 183 VKDIRT 188
           + ++  
Sbjct: 181 I-EVIA 185


>gi|327289878|ref|XP_003229651.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like, partial [Anolis carolinensis]
          Length = 129

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQT+DTPNP +LKFIPG+ VL    + F++      SPLA ++F I G+ SV+FG DF
Sbjct: 6   MFIQTQDTPNPNSLKFIPGKPVLESRTMEFTSPASTYCSPLARQLFRIEGVKSVFFGADF 65

Query: 61  ITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +TV K  +  DW  ++P +   IM+ + SG P++ +                 E D  VV
Sbjct: 66  VTVTKESEDVDWNLIKPDIYATIMDFYASGLPVVTDEAP-------RPETAPSEEDDEVV 118

Query: 119 QRIKEVLDNRV 129
             IKE+LD R+
Sbjct: 119 SMIKELLDTRI 129


>gi|218659803|ref|ZP_03515733.1| Scaffold protein Nfu/NifU [Rhizobium etli IE4771]
          Length = 107

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 76/97 (78%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPNPAT KF+PG+VV+  G   F +A+EA+ SPLA+R+F IPG+  VYFGYDF
Sbjct: 9   MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAQASPLAARLFEIPGVTGVYFGYDF 68

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGL 97
           I+V KD  +W+HL+P +LG IMEHF+SG P++ +  +
Sbjct: 69  ISVSKDDVEWQHLKPAILGSIMEHFMSGKPVMGDASI 105


>gi|310877201|gb|ADP36961.1| hypothetical protein [Asterochloris sp. DA2]
          Length = 141

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 7/120 (5%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDN 127
           Y W  L+P V   IM+HF SGDP+     L D            E DS VV  IKE+L+ 
Sbjct: 1   YTWSVLKPDVFXAIMDHFTSGDPL-----LLDDDEYGASDTAIQEDDSDVVAMIKELLET 55

Query: 128 RVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           R+RPAV  DGGDIVF+G+ +   IV L M+GACSGCPS++ TLK G+ N+L H++PEVK 
Sbjct: 56  RIRPAVMEDGGDIVFQGFDENSGIVKLKMQGACSGCPSSAVTLKSGIENMLKHYIPEVKS 115


>gi|327188587|gb|EGE55797.1| nitrogen fixation protein [Rhizobium etli CNPAF512]
          Length = 107

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 80/107 (74%), Gaps = 1/107 (0%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           MEHF+SG P++ +  +     D  G   F E D ++V  IKE+L+ RVRPAVA+DGGDI 
Sbjct: 1   MEHFMSGKPVMGDASILSEDADA-GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDIT 59

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           F+G++DG V+L+M+G+CSGCPS++ TLK+GV N+L HFVPEV+++  
Sbjct: 60  FRGFKDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFVPEVQEVIA 106


>gi|218516514|ref|ZP_03513354.1| nitrogen fixation protein [Rhizobium etli 8C-3]
          Length = 99

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 73/93 (78%)

Query: 1  MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
          MFIQTE TPNPAT KF+PG+VV+  G   F +A EAE SPLA+R+F IPG+  VYFGYDF
Sbjct: 1  MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAAEAEASPLAARLFEIPGVTGVYFGYDF 60

Query: 61 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIH 93
          I+V KD  +W+HL+P +LG IM+HF+SG P++ 
Sbjct: 61 ISVSKDNAEWQHLKPAILGSIMKHFMSGKPVMG 93


>gi|316971797|gb|EFV55531.1| putative HECT-domain protein [Trichinella spiralis]
          Length = 626

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 62/145 (42%), Positives = 82/145 (56%), Gaps = 11/145 (7%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           M+IQ  +TPNP +LKF+PG  VL      F N   AE SPLA  IF I G+ SV+FG DF
Sbjct: 1   MYIQVMETPNPHSLKFLPGIPVLPGRTAEFPNRPSAENSPLARAIFRIKGVKSVFFGEDF 60

Query: 61  ITVGKDQ--YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           ITV K+    DW  ++P +   IM+ F S           D+ +DD    D  + D+  V
Sbjct: 61  ITVTKNSEVKDWVTMKPEIFSTIMDFFTSKQ---------DIIIDDSTEKDAADDDNDTV 111

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFK 143
             IK++L+ R+RP V  DGGD+VF 
Sbjct: 112 AMIKDLLNTRIRPTVQDDGGDVVFM 136


>gi|297266190|ref|XP_001096379.2| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like [Macaca mulatta]
          Length = 196

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 27/147 (18%)

Query: 45  IFSIPGIASVYFGYDFITV--GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           +  I G+ SV+FG DFITV    +  DW  L+P +   IM+ F SG P++          
Sbjct: 62  LKQIEGVKSVFFGPDFITVTKENEDLDWNLLKPDIYATIMDFFASGLPLVTEETPSGEA- 120

Query: 103 DDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCP 162
                                     + P V  DGGD+++KG+ DGIV L ++G+C+ CP
Sbjct: 121 ------------------------GNMLPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCP 156

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 157 SSIITLKNGIQNMLQFYIPEVEGVEQV 183


>gi|149196448|ref|ZP_01873503.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
 gi|149140709|gb|EDM29107.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
          Length = 189

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 94/184 (51%), Gaps = 13/184 (7%)

Query: 5   TEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           T+ TPNP  +KFI    V+ +G + +SNA++   + LA+ +FSI  I  V+F  + ITV 
Sbjct: 7   TQPTPNPNAVKFILNLDVITKGRVSYSNAEDCHNNELAATLFSIACITQVHFFENVITVT 66

Query: 65  KD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
           ++    WE L   V+ ++ +     DP    G   + +             S  V++I++
Sbjct: 67  QNGDMYWEELEDAVIALLQDGIDKHDPEFQVGEDEEERRAK---------LSPEVRQIED 117

Query: 124 VLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILN-HFV 180
           +LD  VRP++  DGGD++  GY     I+ +   GAC+ C S++      + + L   F 
Sbjct: 118 ILDRTVRPSLQGDGGDLMVMGYDLGSKILKVMYEGACNSCASSTTGTLMAIKSTLQAEFD 177

Query: 181 PEVK 184
           P+++
Sbjct: 178 PDIE 181


>gi|149195565|ref|ZP_01872622.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
 gi|149141027|gb|EDM29423.1| putative nitrogen-fixing protein NifU [Lentisphaera araneosa
           HTCC2155]
          Length = 185

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 15/181 (8%)

Query: 1   MFI-QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +F+   E TPNP  LK++  + +L +G   FS A+EA    LA   F++ G+ S+++  +
Sbjct: 2   IFVTHMETTPNPNALKYVLNETILEDGICQFSAAEEATD-DLARACFAVEGVVSIFYRDN 60

Query: 60  FITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
           +IT+   D  DW  +   +   I                                   +V
Sbjct: 61  YITITKNDSADWFEIEMTIKDEINN-----------RVEAIEFKAQAVPEINFGEKQTLV 109

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDGIV-FLSMRGACSGCPSASETLKYGVANILN 177
             I ++LD  +RP +A DGG +      D +V  +  +GAC  CPS++      + NIL 
Sbjct: 110 FEIDDILDETIRPGLAMDGGGVDIIDLSDEMVLSVRYQGACGSCPSSTTGTLMAIENILQ 169

Query: 178 H 178
            
Sbjct: 170 E 170


>gi|325115956|emb|CBZ51510.1| Nitrogen-fixing NifU, C-terminal, related [Neospora caninum
           Liverpool]
          Length = 191

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/175 (29%), Positives = 89/175 (50%), Gaps = 9/175 (5%)

Query: 23  LVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMI 81
           L  G I   + +    SPLA  +F I G +SV    D++TV K    DW  L  PV   I
Sbjct: 4   LKRGMIDVLSVRAEGASPLADCLFKIDGTSSVLIAGDYVTVVKAKDTDWGDLEEPVKRSI 63

Query: 82  MEHFISGDP------IIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
           ++H +SG P            + + +  +       + +  + + I+E+L  R RP +  
Sbjct: 64  LDHLMSGLPAIQPVASSEEISVPEGRRQEPQQQSKPDEEEDLSEAIRELLHMRARPMLQA 123

Query: 136 DGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           DGGD+    + +    V++ ++G+C GCPS+  T+K G+  +L +++PEV+D+R 
Sbjct: 124 DGGDLEMMRFDEETGIVWVHLKGSCEGCPSSLITVKRGMKQMLQYYIPEVEDVRQ 178


>gi|329904748|ref|ZP_08273923.1| nitrogen-fixing NifU-like protein [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547851|gb|EGF32611.1| nitrogen-fixing NifU-like protein [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 186

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 86/187 (45%), Gaps = 7/187 (3%)

Query: 4   QTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           + +DTPNP  +KF   + +    A  + N  +A   PLA+ +F++  + +V++   ++TV
Sbjct: 6   EIDDTPNPNAVKFTLHEPLSWGVAHAYDNPAQAAGDPLATALFALDHVTNVFYTDRWLTV 65

Query: 64  GKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIK 122
            +D + DW  L   +   +     +            + +  M      E +     RI 
Sbjct: 66  TQDGEADWPALVRLIAVPLRAAPAAAAQSAELVSAARLAVHTMS-----EDEQDRFARIT 120

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           ++LD ++RPA+  DGGD+   G     + +  +GAC  CPS+       + N+L    P+
Sbjct: 121 DLLDLQIRPALQADGGDLHVLGLSGDTLSIHYQGACGTCPSSIGGTLASIENLLRSIEPD 180

Query: 183 VKDIRTV 189
           +  ++ V
Sbjct: 181 I-AVQAV 186


>gi|256089666|ref|XP_002580899.1| iron-sulfur cluster scaffold protein nfu-related [Schistosoma
           mansoni]
 gi|238666574|emb|CAZ37138.1| iron-sulfur cluster scaffold protein nfu-related [Schistosoma
           mansoni]
          Length = 153

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 1/103 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           +FIQ ++TPNP +LK+ PG+ VL  G   F +  ++  SPLA ++F I G+  V+FG DF
Sbjct: 44  LFIQVQETPNPNSLKYFPGKPVLGSGTRDFPSCTQSTSSPLARQLFRIEGVERVFFGPDF 103

Query: 61  ITV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           IT+   D ++W  ++P V   IM+ + SG P++      D+  
Sbjct: 104 ITITKNDDFEWAVIKPDVYATIMDFYSSGQPVVSEEKAQDLSK 146


>gi|17946069|gb|AAL49077.1| RE53788p [Drosophila melanogaster]
          Length = 134

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 65/108 (60%), Gaps = 7/108 (6%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           M+ F SG P++++              + +E D   V  IKE+LD R+RP V  DGGDIV
Sbjct: 1   MDFFASGLPVLNDAQPN-------ADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIV 53

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           F GY  G+V L M+G+CS CPS+  TLK GV N+L  ++PEV+ +  V
Sbjct: 54  FMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 101


>gi|209883397|ref|YP_002287254.1| nifu protein [Oligotropha carboxidovorans OM5]
 gi|209871593|gb|ACI91389.1| nifu protein [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 62/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+TP+P  +KF+PG+ VL EG ++  + + A  SPLA ++F+IPG+A V    D 
Sbjct: 1   MFIQTEETPDPERMKFLPGREVLPEGTLNLKSREHAGSSPLAEQLFAIPGVAGVLLNKDS 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I V +   DW+HL+P +LG+IMEHF+SG P++        +  +   G     ++    R
Sbjct: 61  IVVTRSDSDWQHLKPAILGVIMEHFMSGAPVLRAPPAAPERTAESDGG-----ETDATGR 115

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACS--------GCPSASETLKYG 171
           I+E L   + P +  +  D+         V ++  G           GCP A+  LK G
Sbjct: 116 IREALRKVIDPELGYNIVDLGLI----YDVTVASGGVTIVTMTTTTPGCP-ATNYLKAG 169


>gi|237653650|ref|YP_002889964.1| nitrogen-fixing NifU domain protein [Thauera sp. MZ1T]
 gi|237624897|gb|ACR01587.1| nitrogen-fixing NifU domain protein [Thauera sp. MZ1T]
          Length = 202

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 10/193 (5%)

Query: 7   DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD 66
            TPNP   KF+    +      HFS         L   + ++PG+  +Y    FIT+ +D
Sbjct: 9   STPNPLANKFMLDAPLYTGAPRHFSAGVAVVGDTLGESLLAVPGVVDIYCTGGFITITRD 68

Query: 67  Q-YDWEHLRPPVLGMIMEH---------FISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
               W  + P V  +I  H           +G        +G  +       +    D+ 
Sbjct: 69  PGTPWSAIEPAVTELIEGHKARRVIGIANPAGPGGAAGAAIGAGEAVAEEPVEVEADDAE 128

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++ RI ++LD  +RP + +DGG +     ++  + +  +GAC GCPS+S    + + N+L
Sbjct: 129 LLMRINQILDEHIRPFLDQDGGGLDVVKLKEFTLTVRYKGACGGCPSSSTGTLFAINNLL 188

Query: 177 NHFVPEVKDIRTV 189
            ++V +   +  +
Sbjct: 189 QNYVDDRLLVEPI 201


>gi|145544593|ref|XP_001457981.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124425800|emb|CAK90584.1| unnamed protein product [Paramecium tetraurelia]
          Length = 196

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 91/190 (47%), Gaps = 16/190 (8%)

Query: 3   IQTEDTPNPATLKFIP-GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           IQ +  PNP  LKFIP G+            +K   +     +     G+   ++G D+I
Sbjct: 12  IQVKQVPNPNFLKFIPIGKQ-----------SKRCLMFTTCLKPIQHNGVTREFYGMDYI 60

Query: 62  TV-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           ++  K++  W+ LR  +   I + + S         L +    +  S    + DS  +Q 
Sbjct: 61  SISKKNESKWDDLRSRIFEQIFDQYESNQEGSEKQFLFEGFKQNKDS-VIQDDDSKPIQL 119

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNH 178
           IK++L++R+RP     GGDIVF+ +   +GI++L  +G+C  CP+ + TLK     +L  
Sbjct: 120 IKDILNHRIRPDFQEIGGDIVFREFDELNGILYLYKKGSCVECPATATTLKNRFEKMLCQ 179

Query: 179 FVPEVKDIRT 188
            V +VK +  
Sbjct: 180 NVDQVKQVIA 189


>gi|294877892|ref|XP_002768179.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239870376|gb|EER00897.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 83/158 (52%), Gaps = 8/158 (5%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGDPIIH 93
           +   SPLA+ +F I G+  V       TV K    DWE L+P V  ++ + F   +    
Sbjct: 7   QCGGSPLAASLFRIHGVDKVLLAARHATVTKSPETDWEMLQPNVELVMSQFFEIPNVKPV 66

Query: 94  NGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVF 151
           +    +   +        + +  VV+ I E+L+ R++P V RDGGD+ F  +      + 
Sbjct: 67  SPEAIEYTPEGQD-----QHNDEVVKSIHEILEQRIKPFVERDGGDVEFVSFDADSGELE 121

Query: 152 LSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           + + G+CSGCP +S TLK+G+  ++ H++PEVK++  +
Sbjct: 122 IRLVGSCSGCPKSSVTLKFGIQRMVCHYIPEVKNVTNI 159


>gi|323336723|gb|EGA77987.1| Nfu1p [Saccharomyces cerevisiae Vin13]
          Length = 174

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/145 (31%), Positives = 79/145 (54%), Gaps = 10/145 (6%)

Query: 55  YFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-- 111
             G DF+T+ KD    W  ++P ++ ++ +    G+ +I        + +  G       
Sbjct: 1   MIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAXGEDVISKEFHAVQEEEGEGGYKINMP 60

Query: 112 -----ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
                E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S+
Sbjct: 61  KFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSS 120

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
             TLKYG+ ++L H+V EVK++  +
Sbjct: 121 EVTLKYGIESMLKHYVDEVKEVIQI 145


>gi|323304101|gb|EGA57879.1| Nfu1p [Saccharomyces cerevisiae FostersB]
          Length = 174

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 78/145 (53%), Gaps = 10/145 (6%)

Query: 55  YFGYDFITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFI-- 111
             G DF+T+ KD    W  ++P ++ ++ +     + +I        + +  G       
Sbjct: 1   MIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYXEDVISKEFHAVQEEEGEGGYKINMP 60

Query: 112 -----ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
                E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S+
Sbjct: 61  KFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSS 120

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
             TLKYG+ ++L H+V EVK++  +
Sbjct: 121 EVTLKYGIESMLKHYVDEVKEVIQI 145


>gi|50593019|ref|NP_001002757.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 3
           [Homo sapiens]
 gi|50593023|ref|NP_001002756.1| NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform 3
           [Homo sapiens]
 gi|114577881|ref|XP_001137265.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 3 [Pan troglodytes]
 gi|114577883|ref|XP_001137343.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 4 [Pan troglodytes]
 gi|114577885|ref|XP_001137421.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
           isoform 5 [Pan troglodytes]
 gi|332226736|ref|XP_003262548.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 4 [Nomascus leucogenys]
 gi|332226738|ref|XP_003262549.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 5 [Nomascus leucogenys]
 gi|332226740|ref|XP_003262550.1| PREDICTED: NFU1 iron-sulfur cluster scaffold homolog,
           mitochondrial-like isoform 6 [Nomascus leucogenys]
          Length = 113

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 64/108 (59%), Gaps = 8/108 (7%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           M+ F SG P++                   E D  VV  IKE+LD R+RP V  DGGD++
Sbjct: 1   MDFFASGLPLVTEETPSGEAGS--------EEDDEVVAMIKELLDTRIRPTVQEDGGDVI 52

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +KG+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV+ +  V
Sbjct: 53  YKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQV 100


>gi|238568059|ref|XP_002386363.1| hypothetical protein MPER_15421 [Moniliophthora perniciosa FA553]
 gi|215438109|gb|EEB87293.1| hypothetical protein MPER_15421 [Moniliophthora perniciosa FA553]
          Length = 105

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 1/101 (0%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE TPN  +LKFIPG  V+ EG   F + + A  SPLA R+  I G+ +V++G DF
Sbjct: 1   MFIQTETTPNDDSLKFIPGIPVMGEGTAEFLDTRSALASPLAIRLMGIEGVKAVFYGPDF 60

Query: 61  ITVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
           +T+ KD +  W  ++P V  ++ME F SG  +  +    + 
Sbjct: 61  VTISKDSENPWAVIKPEVYSILMEFFSSGQKMFRSDEEREN 101


>gi|294877894|ref|XP_002768180.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239870377|gb|EER00898.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 251

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 12/185 (6%)

Query: 12  ATLKFIPG--QVVLVEGA--IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGK-D 66
             + F     + +L  GA  + F + + +  SPLA  +F I G+  V   +  + V K  
Sbjct: 58  NVMIFWLNNDKKILPSGAKGMTFDSKEGSSQSPLALSLFKIEGVERVVLTHHNVAVSKVS 117

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
             DW  ++P V  ++   F               + +   +       + +++RI EVLD
Sbjct: 118 SIDWCFVKPKVESVLSNFFAVPGLQSVYRSALQFETEVEEA-----EKAKLMERIAEVLD 172

Query: 127 NRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +R+RP +  DGGD+    + +    + + ++GAC+GCP +S TL++ + N+L   VPEVK
Sbjct: 173 DRIRPVLQDDGGDVDVADFDEETGVLSVRLKGACAGCPMSSVTLRFRIENMLVQSVPEVK 232

Query: 185 DIRTV 189
            +  +
Sbjct: 233 KVINI 237


>gi|213407222|ref|XP_002174382.1| NifU-like protein c [Schizosaccharomyces japonicus yFS275]
 gi|212002429|gb|EEB08089.1| NifU-like protein c [Schizosaccharomyces japonicus yFS275]
          Length = 183

 Score = 98.7 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 90  PIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI 149
           P      +     +       ++SDS  V  IKE++D+ +RP++  DGGD+ ++G+ +  
Sbjct: 45  PFHGEPVIDGTPFNPSADTQILDSDSETVAMIKELIDSSIRPSIQEDGGDLEYRGFDEQT 104

Query: 150 --VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
             V+L +RG+C  C S+  TLK G+  +L H++PEVK++  
Sbjct: 105 GTVYLKLRGSCRTCASSEITLKSGIQQMLMHYIPEVKNVEQ 145


>gi|120434576|ref|YP_860269.1| hypothetical protein GFO_0207 [Gramella forsetii KT0803]
 gi|117576726|emb|CAL65195.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 257

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 73/146 (50%), Gaps = 5/146 (3%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           +  E TPNPA +KF+  + ++++ A+ F N  +A+ +PL  ++F  P +  ++   ++++
Sbjct: 110 VYAESTPNPAVMKFVANKKLVLK-AVEFKNIDDAKNAPLVQKLFHFPFVKEIFIDENYVS 168

Query: 63  VG-KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGG---LGDMKLDDMGSGDFIESDSAVV 118
           +   D   WE +   +   I  +   G+ +++        D   +        E+     
Sbjct: 169 IQKYDMAGWEEITMELREFIRNYIEEGNEVLNVESVQVAADSSSEKGTKTPEFENLDDTS 228

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKG 144
           Q+I  +LD  ++PAVA DGG+I+F  
Sbjct: 229 QQIIAILDEYIKPAVASDGGNILFDR 254



 Score = 55.2 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 1/101 (0%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I    T  P+  KF   + +    +  F N  EA  SP+A ++F +P + +VY   +FI 
Sbjct: 6   INIVRTTTPSIAKFEADKFLTRHESFEFKNIDEASRSPIAQQLFYLPFVKTVYIAQNFIA 65

Query: 63  V-GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKL 102
           +   D  +WE +   V   I  +   G  +I        K+
Sbjct: 66  IEKYDIVEWEDVEKEVAEQIETYLNKGGEVIKEVKASTGKV 106


>gi|297830796|ref|XP_002883280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329120|gb|EFH59539.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 96

 Score = 97.6 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 2/78 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKY 170
            DS  V  IKE+L+ R+RPAV  DGGDI + G+     IV L M+GACSGCPS+S TLK 
Sbjct: 1   DDSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKS 60

Query: 171 GVANILNHFVPEVKDIRT 188
           G+ N+L H+V EVK +  
Sbjct: 61  GIENMLMHYVSEVKGVEQ 78


>gi|313230548|emb|CBY18764.1| unnamed protein product [Oikopleura dioica]
          Length = 140

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FI TE TPNP  LKF+PG+ VL  G    F + +EA  SPLA RIF++ G+   +FG D
Sbjct: 15  LFITTEVTPNPNALKFVPGRDVLGAGATCDFPDIREAYKSPLAKRIFAVDGVKGCFFGPD 74

Query: 60  FITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           F+T+ +     DW  ++  +  ++ + F S  PII+   L +            + D  +
Sbjct: 75  FVTIIRHDETDDWPVMKAELFAVLTDFFDSNLPIINEDALPN------QDTIIYDDDVML 128

Query: 118 VQRIKEVLDNR 128
              I   L   
Sbjct: 129 GFFIIFRLLRH 139


>gi|313220326|emb|CBY31182.1| unnamed protein product [Oikopleura dioica]
          Length = 140

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEG-AIHFSNAKEAEISPLASRIFSIPGIASVYFGYD 59
           +FI TE TPNP  LKF+PG+ VL  G    F + +EA  SPLA RIF++ G+   +FG D
Sbjct: 15  LFITTEVTPNPNALKFVPGRDVLGAGATCDFPDIREAYKSPLAKRIFAVDGVKGCFFGPD 74

Query: 60  FITVGKDQY--DWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
           F+T+ +     DW  ++  +  ++ + F S  PII+   L +            + D  +
Sbjct: 75  FVTIIRHDETDDWPVMKAELFAVLTDFFDSNLPIINEDALPN------QDTIIYDDDVML 128

Query: 118 VQRIKEVLDNR 128
              I   L   
Sbjct: 129 GFFIIFRLLRH 139


>gi|299132121|ref|ZP_07025316.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
 gi|298592258|gb|EFI52458.1| Scaffold protein Nfu/NifU [Afipia sp. 1NLS2]
          Length = 213

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 90/179 (50%), Gaps = 17/179 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60
           MFIQTE+T +   L+F+PG+ VL EG ++    ++A  SPLA ++F+IPG+A V    D 
Sbjct: 1   MFIQTEETQDSERLRFLPGREVLPEGTLNLKTKEQAASSPLAEQLFTIPGVAGVLLNKDS 60

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           I V +   DW+HL+P +LG IMEHF+SG P++             G     E D+    +
Sbjct: 61  IVVTRSGSDWQHLKPAILGAIMEHFMSGAPVVRTPPGASAHASASGE----EGDATATGQ 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACS--------GCPSASETLKYG 171
           I+E L   + P +  +  D+         V +   G           GCP A+  LK G
Sbjct: 117 IREALRRVIDPELGYNIVDLGLV----YDVTVEDGGVTIVTMTTTTPGCP-ATNYLKTG 170


>gi|237843489|ref|XP_002371042.1| NifU-like domain-containing protein [Toxoplasma gondii ME49]
 gi|211968706|gb|EEB03902.1| NifU-like domain-containing protein [Toxoplasma gondii ME49]
 gi|221484803|gb|EEE23097.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 235

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 74/155 (47%), Gaps = 11/155 (7%)

Query: 46  FSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM---- 100
           F I G +SV     ++TV K    DW+ L  PV   I +H  SG P +      +     
Sbjct: 24  FQIDGTSSVLIAGGYVTVVKARDTDWKDLEEPVKRCIQDHLTSGIPAVQRAVSSEDVSGA 83

Query: 101 ----KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSM 154
                          E +  + + I+E+L  R RP +  DGGD+    + +    V++ +
Sbjct: 84  AEGRPEVPEKKNAKSEEEEDLSEAIRELLHMRARPMLQADGGDLEMMRFDEETGIVWVHL 143

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +G+C GCPS+  T+K G+  +L +++PEV+ I  V
Sbjct: 144 KGSCEGCPSSLITVKRGMKQMLQYYIPEVRTILRV 178


>gi|221504979|gb|EEE30644.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 235

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 74/155 (47%), Gaps = 11/155 (7%)

Query: 46  FSIPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM---- 100
           F I G +SV     ++TV K    DW+ L  PV   I +H  SG P +      +     
Sbjct: 24  FQIDGTSSVLIAGGYVTVVKARDTDWKDLEEPVKRCIQDHLTSGIPAVQRAVSSEDVSGA 83

Query: 101 ----KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSM 154
                          E +  + + I+E+L  R RP +  DGGD+    + +    V++ +
Sbjct: 84  AEGRPQVPEKKNAKSEEEEDLSEAIRELLHMRARPMLQADGGDLEMMRFDEETGIVWVHL 143

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +G+C GCPS+  T+K G+  +L +++PEV+ I  V
Sbjct: 144 KGSCEGCPSSLITVKRGMKQMLQYYIPEVRTILRV 178


>gi|159163237|pdb|1VEH|A Chain A, Solution Structure Of Rsgi Ruh-018, A Nifu-Like Domain Of
           Hirip5 Protein From Mouse Cdna
          Length = 92

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 54/73 (73%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           VV  IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L
Sbjct: 14  VVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNML 73

Query: 177 NHFVPEVKDIRTV 189
             ++PEV+ +  V
Sbjct: 74  QFYIPEVEGVEQV 86


>gi|254439456|ref|ZP_05052950.1| NifU-like domain protein [Octadecabacter antarcticus 307]
 gi|198254902|gb|EDY79216.1| NifU-like domain protein [Octadecabacter antarcticus 307]
          Length = 414

 Score = 94.9 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 76/179 (42%), Gaps = 14/179 (7%)

Query: 11  PATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKD-QYD 69
           P TL+FI    V    ++ +     +  +PLA  +F+I G+  V      I V +    D
Sbjct: 19  PQTLRFILDAPVQDSTSVCY--DDASADAPLARALFAISGVQRVEVDGASIYVSRSADVD 76

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
           W  L+ P+   I +               +       S      D+ +   + ++LD+  
Sbjct: 77  WSALKAPIAAAIRDVLE-----------REALPLGQRSEAPKGEDALLFLAVADLLDSEA 125

Query: 130 RPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
            PA+A  GG +  +   +  V+L M G C GC ++S TL+ G+  +L   +P + +I  
Sbjct: 126 NPAIASHGGSVAVERVENSDVYLRMSGGCQGCAASSATLRQGIETMLRAGLPAIGEIID 184


>gi|254455102|ref|ZP_05068538.1| NifU-like domain protein [Octadecabacter antarcticus 238]
 gi|198263804|gb|EDY88075.1| NifU-like domain protein [Octadecabacter antarcticus 238]
          Length = 419

 Score = 94.5 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 15/188 (7%)

Query: 3   IQTEDT-PNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFI 61
           I+ + T  +P TL+FI    V    ++ +     +  +PLA  +F+I G+  V      I
Sbjct: 10  IRVQPTVKDPQTLRFILEAPVQDSTSVCY--DDASADAPLARALFAISGVQRVEVDGASI 67

Query: 62  TVGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
            V +    DW  L+ P+   I +   S           +       S      D+ ++  
Sbjct: 68  YVSRSTDVDWSALKAPIAVAIRDVLDS-----------EALPLGQRSEAPKGEDALLLLA 116

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           + E+LD    PA+A  GG +  +   +  V+L M G C GC ++S TL+ G+  +L   +
Sbjct: 117 VAELLDCEANPAIASHGGSVAVERVENSDVYLRMSGGCQGCAASSATLRQGIETMLRAGL 176

Query: 181 PEVKDIRT 188
           P + +I  
Sbjct: 177 PAIGEIID 184


>gi|8571395|gb|AAF76865.1|AF232919_4 NifU-like protein [Sinorhizobium meliloti]
          Length = 63

 Score = 94.5 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 55/63 (87%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            RVRPAVA+DGGDI F+G++DG VFL+M+GACSGCPS++ TL++GV N+L HFVPEV+ +
Sbjct: 1   TRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHFVPEVEAV 60

Query: 187 RTV 189
            +V
Sbjct: 61  ESV 63


>gi|261333257|emb|CBH16252.1| HIRA-interacting protein 5, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 337

 Score = 94.1 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 5/155 (3%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHN 94
           +         + S  G+A        +        W  L+  V  ++ +H  SG      
Sbjct: 174 DGGGENTEDNLGSQGGVALDSVDEAALRDLVRSTHWSELKLHVSALLTDHLYSGRAH--- 230

Query: 95  GGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM 154
             +              + DS VV  +KE++   +RP +  DGGDI F G  D ++ + M
Sbjct: 231 --IDADAPHPHPDTIPQDGDSEVVVVLKELISTTIRPQLQADGGDIRFVGLADSVMLVEM 288

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            GAC  C S+  TL+  +     H+VPEV+ +  V
Sbjct: 289 LGACRKCRSSKTTLRDMIERTTRHWVPEVQKVEEV 323


>gi|71748540|ref|XP_823325.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927]
 gi|70832993|gb|EAN78497.1| HIRA-interacting protein 5, putative [Trypanosoma brucei]
          Length = 243

 Score = 94.1 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 5/155 (3%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHN 94
           +         + S  G+A        +        W  L+  V  ++ +H  SG      
Sbjct: 80  DGGGENTEDNLGSQGGVALDSVDEAALRDLVRSTHWSELKLHVSALLTDHLYSGRAH--- 136

Query: 95  GGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSM 154
             +              + DS VV  +KE++   +RP +  DGGDI F G  D ++ + M
Sbjct: 137 --IDADAPHPHPDTIPQDGDSEVVVVLKELISTTIRPQLQADGGDIRFVGLADSVMLVEM 194

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            GAC  C S+  TL+  +     H+VPEV+ +  V
Sbjct: 195 LGACRKCRSSKTTLRDMIERTTRHWVPEVQKVEEV 229


>gi|157874760|ref|XP_001685794.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68128867|emb|CAJ06031.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 426

 Score = 94.1 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P +                   E DS VV  IKE++ 
Sbjct: 216 ETDWSELKLHVSALLTDHICSGNPHVDPSA-----PHPHADTAPEEGDSEVVLMIKELVS 270

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV 
Sbjct: 271 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVS 330

Query: 185 DIRTV 189
            +R V
Sbjct: 331 AVRDV 335



 Score = 42.1 bits (97), Expect = 0.042,   Method: Composition-based stats.
 Identities = 17/148 (11%), Positives = 41/148 (27%), Gaps = 3/148 (2%)

Query: 2   FIQTEDTPNPATLKFIPGQV---VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           F++ + TPN A  KF   ++         + F++          + + ++P +  V  G 
Sbjct: 48  FVRFQPTPNDACYKFYVDEMQFLPPNAHTMVFNSTNSYLSPLAHTLLEALPMVEEVTVGT 107

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
            F+TV + +            M                    +       + ++ D    
Sbjct: 108 SFVTVKRVEEADAAAAARYFAMKFSTVQQNHGTDEEAAAARSQALQQHVANVLKEDGEAA 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR 146
              +        P ++          + 
Sbjct: 168 AEARSFNAASTAPVLSPADASFDVGEFT 195


>gi|307153189|ref|YP_003888573.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           7822]
 gi|306983417|gb|ADN15298.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7822]
          Length = 78

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  ++PE
Sbjct: 11  ETVLDEMRPYLMADGGNVELVEIDGPIVKLRLQGACGSCPSSTMTLKMGIERRLREYIPE 70

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 71  IVEVEQV 77


>gi|294901264|ref|XP_002777311.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239884853|gb|EER09127.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 299

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 3/159 (1%)

Query: 32  NAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPI 91
             + +    +A  +  + G+  V  G  F+++   +             +       D  
Sbjct: 23  TTESSFCPRVAKELLEVKGVDKVTVGDGFLSIIASRPSGREF-AFAEEQLAAFKSILDKA 81

Query: 92  IHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI-- 149
                        +       S + V +RI+ +LD RVRP +A+DGGD  F  +      
Sbjct: 82  AVEPENYLSGDSTVTERAPSSSSNEVEERIQSLLDTRVRPVIAQDGGDCEFISFDSQTGR 141

Query: 150 VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           V L++ G+C GCP + +TLK  +   L  +V EV  +  
Sbjct: 142 VTLALHGSCEGCPQSVKTLKDSIERTLKFYVEEVSSVEQ 180


>gi|260892780|ref|YP_003238877.1| nitrogen-fixing NifU domain protein [Ammonifex degensii KC4]
 gi|260864921|gb|ACX52027.1| nitrogen-fixing NifU domain protein [Ammonifex degensii KC4]
          Length = 72

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E    ++RP + RDGGD+      DG+V + ++GAC GCP A  TLK G+  IL   VPE
Sbjct: 6   EAALAQIRPHLQRDGGDVELVAVEDGVVKVRLKGACGGCPMAMVTLKQGIERILKEAVPE 65

Query: 183 VKDIRTV 189
           VK++  V
Sbjct: 66  VKEVVAV 72


>gi|322502114|emb|CBZ37197.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 448

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P +                   E DS VV  IKE++ 
Sbjct: 238 ETDWSELKLHVSALLTDHICSGNPHVDPSA-----PHPHADTVPEEGDSEVVLMIKELVS 292

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV 
Sbjct: 293 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVS 352

Query: 185 DIRTV 189
            ++ V
Sbjct: 353 AVKDV 357



 Score = 42.5 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 19/148 (12%), Positives = 43/148 (29%), Gaps = 3/148 (2%)

Query: 2   FIQTEDTPNPATLKFIPGQV---VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           F++ + TPN A  KF   ++         + F++          + + ++P +  V  G 
Sbjct: 70  FVRFQPTPNDACYKFYVDEMQFLPPNAHTMVFNSTNSYISPLAHTLLEALPMVEEVTVGT 129

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
            F+TV + +            M +                  +       D ++ D    
Sbjct: 130 SFVTVKRVEEANAAAAARYFAMKLNRVQQNHETDEEAAAARSQALQQRVADALKKDGETA 189

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR 146
              +        P ++         G+ 
Sbjct: 190 AEPRSCNAASTAPPLSPADAPFDVGGFT 217


>gi|146097555|ref|XP_001468136.1| hypothetical protein [Leishmania infantum]
 gi|134072503|emb|CAM71216.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 448

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P +                   E DS VV  IKE++ 
Sbjct: 238 ETDWSELKLHVSALLTDHICSGNPHVDPSA-----PHPHADTVPEEGDSEVVLMIKELVS 292

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV 
Sbjct: 293 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVS 352

Query: 185 DIRTV 189
            ++ V
Sbjct: 353 AVKDV 357



 Score = 42.5 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 19/148 (12%), Positives = 43/148 (29%), Gaps = 3/148 (2%)

Query: 2   FIQTEDTPNPATLKFIPGQV---VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           F++ + TPN A  KF   ++         + F++          + + ++P +  V  G 
Sbjct: 70  FVRFQPTPNDACYKFYVDEMQFLPPNAHTMVFNSTNSYISPLAHTLLEALPMVEEVTVGT 129

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
            F+TV + +            M +                  +       D ++ D    
Sbjct: 130 SFVTVKRVEEANAAAAARYFAMKLNRVQQNHETDEEAAAARSQALQQRVADALKKDGETA 189

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR 146
              +        P ++         G+ 
Sbjct: 190 AEPRSCNAASTAPPLSPADAPFDVGGFT 217


>gi|21430120|gb|AAM50738.1| GM32035p [Drosophila melanogaster]
          Length = 104

 Score = 92.6 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/70 (55%), Positives = 50/70 (71%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
            IKE+LD R+RP V  DGGDIVF GY  G+V L M+G+CS CPS+  TLK GV N+L  +
Sbjct: 2   MIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFY 61

Query: 180 VPEVKDIRTV 189
           +PEV+ +  V
Sbjct: 62  IPEVESVEQV 71


>gi|295401381|ref|ZP_06811352.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109659|ref|YP_003987975.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
 gi|294976596|gb|EFG52203.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214760|gb|ADP73364.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
          Length = 78

 Score = 91.8 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  + ++++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   SDQEIKEQVQEVLDK-LRPFLLRDGGDCELIDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIVEVEQV 77


>gi|116783204|gb|ABK22836.1| unknown [Picea sitchensis]
          Length = 248

 Score = 91.8 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 1/108 (0%)

Query: 82  MEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
                S              ++ + S    E  +   + + E++ + VRP +  DGG++ 
Sbjct: 64  NRFVCSRKSERQQQRGRRHVVEAIASPPSTEGLALTEENV-EMVLDEVRPYLMSDGGNVE 122

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
                  +V L ++GAC  CPS+  T+K G+   L   +PE+  +  V
Sbjct: 123 LYDIDGLVVKLKLQGACGSCPSSLMTMKMGIERRLMEQIPEIVAVEQV 170



 Score = 37.9 bits (86), Expect = 0.80,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 31/83 (37%), Gaps = 5/83 (6%)

Query: 106 GSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSA 164
                 E+   + +   E +   +RP +   GG  +      + IV + + G  +G    
Sbjct: 168 EQVMDGETGLELNEENVEKVLAEIRPYLVGTGGGELELVEIEEPIVKVRIGGPAAG---- 223

Query: 165 SETLKYGVANILNHFVPEVKDIR 187
             T++  V   L   +P +  ++
Sbjct: 224 VMTVRVAVTQKLREKIPAIAAVQ 246


>gi|71665794|ref|XP_819863.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885183|gb|EAN98012.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 426

 Score = 91.8 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 5/165 (3%)

Query: 24  VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME 83
            E ++H  +A++ +   L+ +          +     +        W  L+  V  ++ +
Sbjct: 228 GESSLHREDARQPKRDKLSEKETEEEIGTGEHVDEATLRDLLLSTHWSELKLHVSALLTD 287

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFK 143
           H  SG P +                   E DS VV  +KE++   +RP +  DGGDI F 
Sbjct: 288 HLFSGRPHVDPDA-----PHPHPDTLPQEGDSEVVLILKELISTTIRPQLQLDGGDIRFV 342

Query: 144 GYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
               G++++ M GAC  C S+  TL   +     H+VPEV ++R 
Sbjct: 343 SLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVRE 387



 Score = 40.2 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 3   IQTEDTPNPATLKFIPGQV-VLV---EGAIHFSNAKEAEISPLASR-IFSIPGIASVYFG 57
           I+ ++TPN A  KF    V  L     G + F +      SPLA + +  +P +  V  G
Sbjct: 89  IRFQETPNEACYKFFVNDVAFLPAGHAGTLRF-DLDNCFQSPLAEKILHGLPMVEEVTIG 147

Query: 58  YDFITVGK 65
             F+TV +
Sbjct: 148 PHFVTVRR 155


>gi|322494548|emb|CBZ29850.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 426

 Score = 91.4 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 67  QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLD 126
           + DW  L+  V  ++ +H  SG+P +                   E DS VV  IKE++ 
Sbjct: 216 ETDWSELKLHVSALLTDHICSGNPHVDPSSS-----HPHADTLPEEGDSEVVLLIKELVS 270

Query: 127 NRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
             +RP +  DGGD+ F G+    G + + + GAC  C S+  TL   +     H++PEV+
Sbjct: 271 TTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVR 330

Query: 185 DIRTV 189
            ++ V
Sbjct: 331 AVKDV 335



 Score = 40.6 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/148 (12%), Positives = 43/148 (29%), Gaps = 3/148 (2%)

Query: 2   FIQTEDTPNPATLKFIPGQV---VLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           F++ + TPN A  KF   ++         + F +          + + ++P +  V  G 
Sbjct: 48  FVRFQPTPNDACYKFYVDEMHFLPPNAHTMVFDSTNSYLSPLAHTLLEALPMVEEVTVGT 107

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVV 118
            F+TV + +     +                           +       D ++ D A  
Sbjct: 108 SFVTVKRVEEADAAVAARYFAKKFNGVQQNHGTDEEAAAMRSQALQQHVADVLKEDGAPA 167

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYR 146
              +        P+++         G+ 
Sbjct: 168 AEPRSCNAASTAPSLSPVDASFDVGGFT 195


>gi|118340603|gb|ABK80653.1| uncharacterized protein [uncultured marine Nitrospinaceae
           bacterium]
          Length = 253

 Score = 91.0 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 16  FIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ---YDWEH 72
           F   + ++   + +F++ + AE S LA R+FS   + +V      +T+ +     +DW  
Sbjct: 76  FTVNRSLMTGHSWYFADFESAEGSSLAERLFSQEDVETVLVCECTVTITRKDKTLFDWGP 135

Query: 73  LRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPA 132
           L   V   I E    G+ +I    + D+  ++            V + I++V+D  V P 
Sbjct: 136 LAKDVGTAIREAIQDGEGLIAEKIIADLPTEE-----------EVREGIQKVIDVEVNPG 184

Query: 133 VARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           VA  GG+I     R   V + M G C GC +A  TLK G+       VP+V
Sbjct: 185 VAGHGGNISLLDVRGNSVTIQMGGGCQGCSAADLTLKQGIHTSFRTAVPKV 235


>gi|322820651|gb|EFZ27204.1| HIRA-interacting protein 5, putative [Trypanosoma cruzi]
          Length = 452

 Score = 91.0 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 5/165 (3%)

Query: 24  VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME 83
            E ++H  +A++ +   L+ +          +     +        W  L+  V  ++ +
Sbjct: 254 GESSLHREDARQLKRDKLSEKETEEEVGTGEHVDEATLRDLFLSTHWSELKLHVSALLTD 313

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFK 143
           H  SG P +                   E DS VV  +KE++   +RP +  DGGDI F 
Sbjct: 314 HLFSGRPHVDPDA-----PHPHPDTLPQEGDSEVVLILKELISTTIRPQLQLDGGDIRFV 368

Query: 144 GYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
               G++++ M GAC  C S+  TL   +     H+VPEV ++R 
Sbjct: 369 SLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVRE 413



 Score = 40.2 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 3   IQTEDTPNPATLKFIPGQV-VLV---EGAIHFSNAKEAEISPLASR-IFSIPGIASVYFG 57
           I+ ++TPN A  KF    V  L     G + F +      SPLA + +  +P +  V  G
Sbjct: 112 IRFQETPNEACYKFFVNDVAFLPAGHAGTLRF-DLDNCFQSPLAEKILHGLPMVEEVTIG 170

Query: 58  YDFITVGK 65
             F+TV +
Sbjct: 171 PHFVTVRR 178


>gi|254415273|ref|ZP_05029035.1| hypothetical protein MC7420_2699 [Microcoleus chthonoplastes PCC
           7420]
 gi|196178079|gb|EDX73081.1| hypothetical protein MC7420_2699 [Microcoleus chthonoplastes PCC
           7420]
          Length = 84

 Score = 91.0 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L  F+PE
Sbjct: 17  EAVLDELRPYLMADGGNVDLVEIDGPIVKLRLQGACGSCPSSAMTLKMGIERRLREFIPE 76

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 77  IVEVEQV 83


>gi|238604262|ref|XP_002396156.1| hypothetical protein MPER_03666 [Moniliophthora perniciosa FA553]
 gi|215468178|gb|EEB97086.1| hypothetical protein MPER_03666 [Moniliophthora perniciosa FA553]
          Length = 115

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDG---IVFLSMRGACSGCPSASETLKYGVANILNHFV 180
            ++ RVRPA+  DGGDI ++G+ +    +V + ++G+C GC S++ TLK G+  +L H++
Sbjct: 21  AVETRVRPAIQEDGGDIEYRGFDEDGSGLVKIKLKGSCRGCDSSTVTLKSGIERMLMHYI 80

Query: 181 PEVKDIRTV 189
           PEVK +  V
Sbjct: 81  PEVKGVEQV 89


>gi|119493943|ref|ZP_01624504.1| putative NifU-like protein [Lyngbya sp. PCC 8106]
 gi|119452300|gb|EAW33495.1| putative NifU-like protein [Lyngbya sp. PCC 8106]
          Length = 79

 Score = 90.6 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 12  ETVLDELRPYLMADGGNVEIVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLREKIPE 71

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 72  IAEVVAV 78


>gi|71416241|ref|XP_810158.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70874651|gb|EAN88307.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 452

 Score = 90.6 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 5/165 (3%)

Query: 24  VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME 83
            E ++H  +A + +   L+ +          +     +        W  L+  V  ++ +
Sbjct: 255 GESSLHREDASQLKREKLSEKETEEEVGTGEHVDEATLRDLLLSTHWSELKLHVSALLTD 314

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFK 143
           H  SG P +                   E DS VV  +KE++   +RP +  DGGDI F 
Sbjct: 315 HLFSGRPHVDPDA-----PHPHPDTLPQEGDSEVVLILKELISTTIRPQLQLDGGDIRFV 369

Query: 144 GYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
               G++++ M GAC  C S+  TL   +     H+VPEV ++R 
Sbjct: 370 SLEGGVMYVEMLGACRRCKSSKTTLSDLIERTTRHWVPEVHEVRE 414



 Score = 40.2 bits (92), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 3   IQTEDTPNPATLKFIPGQV-VLV---EGAIHFSNAKEAEISPLASR-IFSIPGIASVYFG 57
           I+ ++TPN A  KF    V  L     G + F +      SPLA + +  +P +  V  G
Sbjct: 116 IRFQETPNEACYKFFVNDVAFLPAGHAGTLRF-DLDNCFQSPLAEKILHGLPMVEEVTIG 174

Query: 58  YDFITVGK 65
             F+TV +
Sbjct: 175 PHFVTVRR 182


>gi|295695724|ref|YP_003588962.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
 gi|295411326|gb|ADG05818.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
          Length = 73

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + ++++E L  R+RP +  DGGD+      DG+V L + GAC  CP ++ TLK G+   L
Sbjct: 2   LREKVEEAL-ERIRPGLQFDGGDVELVDVEDGVVTLHLIGACGACPMSTMTLKMGIERAL 60

Query: 177 NHFVPEVKDIRTV 189
              VPEVK++  V
Sbjct: 61  RAAVPEVKEVIAV 73


>gi|113476915|ref|YP_722976.1| nitrogen-fixing NifU-like protein [Trichodesmium erythraeum IMS101]
 gi|110167963|gb|ABG52503.1| nitrogen-fixing NifU-like [Trichodesmium erythraeum IMS101]
          Length = 80

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 42/67 (62%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + +RP +A DGG++        IV L ++GACS CPS++ TLK G+   L   +PE
Sbjct: 13  EIVLDELRPYLAADGGNVELVDIEGPIVKLRLQGACSSCPSSTMTLKMGIERKLREEIPE 72

Query: 183 VKDIRTV 189
           + ++ +V
Sbjct: 73  IAEVESV 79


>gi|297792273|ref|XP_002864021.1| hypothetical protein ARALYDRAFT_331396 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297309856|gb|EFH40280.1| hypothetical protein ARALYDRAFT_331396 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 707

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   
Sbjct: 83  PLTEENVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERR 142

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+  +  V
Sbjct: 143 LMEKIPEIVAVEAV 156



 Score = 34.4 bits (77), Expect = 8.3,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 50/176 (28%), Gaps = 26/176 (14%)

Query: 8   TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67
           TP+P     I    +  E      N +          +     +A      + + V    
Sbjct: 75  TPDP-----ILEVPLTEE------NVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQG 123

Query: 68  YDW--EHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVL 125
                      +   I    +   P I    +  +  ++ G     E+   V++ I+  L
Sbjct: 124 ACGSCPSSTMTMKMGIERRLMEKIPEIV--AVEAVADEETGLELNEENIEKVLEEIRPYL 181

Query: 126 DNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
                       G +      D IV + + G  +G      T++  V   L   +P
Sbjct: 182 IGTA-------DGSLDLVEIEDPIVKIRITGPAAG----VMTVRVAVTQKLREKIP 226


>gi|317967928|ref|ZP_07969318.1| NifU-like protein [Synechococcus sp. CB0205]
          Length = 92

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 104 DMGSGDFIESDSAVVQRIK--EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGC 161
           +  +    E+       I+  E   + +RP +  DGG++        IV + ++GAC  C
Sbjct: 4   ETPAAAATENADPRALTIENVERTLDELRPYLMADGGNVEVVEIDGPIVKVRLQGACGSC 63

Query: 162 PSASETLKYGVANILNHFVPEVKDIRTV 189
           PS++ TLK G+   L   +PEV ++  V
Sbjct: 64  PSSTMTLKMGIERKLREAIPEVSEVVQV 91


>gi|170078022|ref|YP_001734660.1| NifU like protein [Synechococcus sp. PCC 7002]
 gi|169885691|gb|ACA99404.1| NifU like protein [Synechococcus sp. PCC 7002]
          Length = 78

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E   + +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +PE
Sbjct: 11  EATLDELRPYLKADGGNVELVEIDGPVVKLRLQGACGSCPSSTMTLRMGIERRLRENIPE 70

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 71  IAEVEQV 77


>gi|87303149|ref|ZP_01085947.1| NifU-like protein [Synechococcus sp. WH 5701]
 gi|87282316|gb|EAQ74276.1| NifU-like protein [Synechococcus sp. WH 5701]
          Length = 97

 Score = 89.9 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++         V + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 30  ERVLDELRPYLMADGGNVEIVEIDGPTVKVRLQGACGSCPSSTMTLKMGIERKLREAIPE 89

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 90  VNEVVQV 96


>gi|218438992|ref|YP_002377321.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7424]
 gi|218171720|gb|ACK70453.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7424]
          Length = 81

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
              E+     + +++VLD  +RP +  DGG++        IV L ++GAC  CPS++ TL
Sbjct: 1   MATETLPLTTENVEQVLDE-LRPYLMADGGNVELVEIDGPIVKLRLQGACGSCPSSTMTL 59

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K G+   L  ++PE+ ++  
Sbjct: 60  KMGIERRLREYIPEIAEVEQ 79


>gi|198414946|ref|XP_002131248.1| PREDICTED: similar to NFU1 iron-sulfur cluster scaffold homolog
           (HIRA-interacting protein 5) [Ciona intestinalis]
          Length = 201

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 80/185 (43%), Gaps = 10/185 (5%)

Query: 14  LKFIPGQVVL---VEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ--- 67
           + F PG  VL    E  I + +      SPL  +I  I GI SV      I V K+    
Sbjct: 1   MIFHPGCPVLHNLNEQKIKYHSRHPCYHSPLVRQIMKIDGIESVTLFTKHIHVQKNTDTL 60

Query: 68  -YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMK-LDDMGSGDFIESDSAVVQRIKEVL 125
              W  ++P ++  ++  F S  P   +     +    + G          +   I +++
Sbjct: 61  SPQWSSIKPIIVATLINFFASQLPTTTHHQSKRLHYHKESGECVAYGKLDDIEYVIDDLI 120

Query: 126 DNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           ++R+RP V  +GGD+++K +   +G V++ + G+C   P A+  +      +L + VP V
Sbjct: 121 NSRIRPTVQDEGGDVIYKDFNRGNGTVYVLLLGSCLYTPKATNAITSATLLLLQYHVPCV 180

Query: 184 KDIRT 188
             +  
Sbjct: 181 TSVVQ 185


>gi|86605616|ref|YP_474379.1| NifU domain-containing protein [Synechococcus sp. JA-3-3Ab]
 gi|86554158|gb|ABC99116.1| NifU domain protein [Synechococcus sp. JA-3-3Ab]
          Length = 80

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + N +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 6   ELTAENVEKVLNELRPYLQADGGNVELVEIDGPVVKLRLQGACGACPSSTLTLKMGIERK 65

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  V
Sbjct: 66  LRESIPDILEVEQV 79


>gi|294941309|ref|XP_002783074.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239895342|gb|EER14870.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 165

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 73  LRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPA 132
           L+P V  +I + F   +         +   +        + +  VV+ I E+L+ R++P 
Sbjct: 2   LKPNVELVISQFFDIPNVKPVAPDSIEYTQEGQD-----QHNDDVVKSIHEILEQRIKPF 56

Query: 133 VARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           V RDGGD+ F  +      + + + G+C+GCP +S TLK+G+  ++ H++PEVK++  +
Sbjct: 57  VERDGGDVEFIAFDSDTGVLQIRLVGSCAGCPKSSVTLKFGIQRMVCHYIPEVKNVINI 115


>gi|254430627|ref|ZP_05044330.1| NifU domain protein [Cyanobium sp. PCC 7001]
 gi|197625080|gb|EDY37639.1| NifU domain protein [Cyanobium sp. PCC 7001]
          Length = 88

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E   + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 21  ERTLDELRPYLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREAIPE 80

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 81  VSEVVQV 87


>gi|167042854|gb|ABZ07571.1| putative NifU-like domain protein [uncultured marine microorganism
           HF4000_ANIW137J11]
          Length = 225

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/188 (25%), Positives = 87/188 (46%), Gaps = 16/188 (8%)

Query: 3   IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           I+ E T +    +F+  +  L +G   F++   AE +PLA  +F++P +++V    D ++
Sbjct: 6   IRGEPTADQQVCRFVVDRS-LHDGNASFTSTAAAEGAPLAEALFALPDVSAVTIARDTVS 64

Query: 63  VGKD-QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           V K    +W  +   +   I     SG+P +                        + +R+
Sbjct: 65  VTKQGDAEWPEIGKLIGDAIRAQIASGEPAVGEMTPASG--------------EELFERV 110

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + VL N + P++A  GG +  +   +G  ++ M G C GC  A  TLK+G+ + L   VP
Sbjct: 111 QAVLVNEINPSIANHGGVVTLQRIEEGKAYVQMGGGCQGCGMADVTLKHGIESYLRQKVP 170

Query: 182 EVKDIRTV 189
           E+ ++  V
Sbjct: 171 EISEVVDV 178


>gi|318040472|ref|ZP_07972428.1| NifU-like protein [Synechococcus sp. CB0101]
          Length = 96

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E   + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 29  ERTLDELRPYLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREAIPE 88

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 89  VSEVVQV 95


>gi|148241647|ref|YP_001226804.1| NifU-like protein [Synechococcus sp. RCC307]
 gi|147849957|emb|CAK27451.1| NifU-like protein [Synechococcus sp. RCC307]
          Length = 88

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E   + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 21  ERTLDELRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREAIPE 80

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 81  VSEVVQV 87


>gi|145334787|ref|NP_001078739.1| NFU2 (NIFU-LIKE PROTEIN 2); structural molecule [Arabidopsis
           thaliana]
 gi|222422967|dbj|BAH19468.1| AT5G49940 [Arabidopsis thaliana]
 gi|332008491|gb|AED95874.1| NifU-like protein 2 [Arabidopsis thaliana]
          Length = 185

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 38/73 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   
Sbjct: 84  PLTEENVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERR 143

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 144 LMEKIPEIVAVEA 156


>gi|209523451|ref|ZP_03272006.1| nitrogen-fixing NifU domain protein [Arthrospira maxima CS-328]
 gi|209496193|gb|EDZ96493.1| nitrogen-fixing NifU domain protein [Arthrospira maxima CS-328]
          Length = 79

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 12  ETVLDELRPYLMADGGNVEVVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLRERIPE 71

Query: 183 VKDIRTV 189
           + ++ +V
Sbjct: 72  IAEVESV 78


>gi|16332125|ref|NP_442853.1| NifU protein [Synechocystis sp. PCC 6803]
 gi|1653754|dbj|BAA18665.1| NifU protein [Synechocystis sp. PCC 6803]
          Length = 76

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   
Sbjct: 2   ELTLNNVETVLDELRPYLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERK 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 62  LREMIPEIAEVEQV 75


>gi|326534082|dbj|BAJ89391.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 216

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 43/74 (58%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++ RDGG++        +V L ++GAC  CPS++ TLK G+ + 
Sbjct: 64  PLTEENVERVLDEVRPSLMRDGGNVALHEIDGLVVVLMLQGACGSCPSSTMTLKMGIESR 123

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  +
Sbjct: 124 LRDKIPEILEVEQI 137



 Score = 37.5 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 32/85 (37%), Gaps = 5/85 (5%)

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCP 162
           ++      E+   +     E + + +RP ++  GG  +        +V + + G  +G  
Sbjct: 133 EVEQIHDTETGLELNTENVEKVLDEIRPYLSGTGGGSLDLVQIDGFVVKIQISGPAAG-- 190

Query: 163 SASETLKYGVANILNHFVPEVKDIR 187
               T++  V   L   +P +  + 
Sbjct: 191 --VMTVRVAVTQKLREKIPSILAVE 213


>gi|323308188|gb|EGA61437.1| Nfu1p [Saccharomyces cerevisiae FostersO]
          Length = 109

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 55/80 (68%), Gaps = 2/80 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLK 169
           E D  V + I+E++D R+RPA+  DGGDI ++G+      V+L ++GAC+ C S+  TLK
Sbjct: 8   EEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLK 67

Query: 170 YGVANILNHFVPEVKDIRTV 189
           YG+ ++L H+V EVK++  +
Sbjct: 68  YGIESMLKHYVDEVKEVIQI 87


>gi|311031755|ref|ZP_07709845.1| NifU-like protein [Bacillus sp. m3-13]
          Length = 78

 Score = 89.1 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           S+  +  +++EVLD  +RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 2   SNPEINAQVQEVLDK-LRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIIEVEQV 77


>gi|115469688|ref|NP_001058443.1| Os06g0694500 [Oryza sativa Japonica Group]
 gi|53791826|dbj|BAD53892.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica
           Group]
 gi|53792847|dbj|BAD53880.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica
           Group]
 gi|113596483|dbj|BAF20357.1| Os06g0694500 [Oryza sativa Japonica Group]
 gi|215678926|dbj|BAG96356.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215695250|dbj|BAG90441.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218198813|gb|EEC81240.1| hypothetical protein OsI_24300 [Oryza sativa Indica Group]
 gi|222636145|gb|EEE66277.1| hypothetical protein OsJ_22478 [Oryza sativa Japonica Group]
          Length = 219

 Score = 89.1 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 42/74 (56%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E++ ++VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 67  PLTEENVEMVLDQVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETR 126

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+  +  +
Sbjct: 127 LRDKIPEILAVEQI 140



 Score = 36.3 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 30/73 (41%), Gaps = 5/73 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            +     + + + +RP ++  GG  +      + +V + + G  +G      T++  V  
Sbjct: 148 ELNHDNVDKVLDEIRPYLSGTGGGSLDLVQIDESVVKVRLTGPAAG----VMTVRVAVTQ 203

Query: 175 ILNHFVPEVKDIR 187
            L   +P +  ++
Sbjct: 204 KLREKIPSILAVQ 216


>gi|124360086|gb|ABN08102.1| Nitrogen-fixing NifU, C-terminal [Medicago truncatula]
          Length = 242

 Score = 89.1 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 40/74 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP +  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 90  PLTEENVEKVLDEVRPGLMADGGNVALHEIDGLVVILKLQGACGSCPSSTMTLKMGIETR 149

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  +
Sbjct: 150 LRDKIPEILEVEQI 163



 Score = 39.4 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCP 162
           ++      E+   + +   E + + +RP +   GG  +      D IV + + G  +G  
Sbjct: 159 EVEQILDTETGLELTEDNVESVLSEIRPYLIGTGGGTLELVEINDYIVKVRLSGPAAG-- 216

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
               T++  +   L   +P +  ++ +
Sbjct: 217 --VMTVRVALTQKLRDKIPSIAAVQLI 241


>gi|22298836|ref|NP_682083.1| NifU protein [Thermosynechococcus elongatus BP-1]
 gi|22295017|dbj|BAC08845.1| tsl1293 [Thermosynechococcus elongatus BP-1]
          Length = 89

 Score = 89.1 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 45/87 (51%)

Query: 103 DDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCP 162
           +D      + +   + Q   E + + +RP +  DGG++        +V L ++GAC  CP
Sbjct: 2   NDRPRTVTMAATLELSQENVEKVLDELRPYLMADGGNVELVEIEGPVVRLRLQGACGACP 61

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
           S++ TL+ G+   L   +PE+ +++ V
Sbjct: 62  SSTMTLRMGIERKLKESIPEIAEVQQV 88


>gi|225446006|ref|XP_002268218.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297735420|emb|CBI17860.3| unnamed protein product [Vitis vinifera]
          Length = 237

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 40/74 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP +  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 84  PLTEENVEKVLDEVRPGLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETR 143

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE++ +  +
Sbjct: 144 LRDKIPEIEAVEQI 157



 Score = 40.2 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 37/91 (40%), Gaps = 5/91 (5%)

Query: 100 MKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGAC 158
            +++ +      E+   + +   E +   +RP +A  GG +       D ++ + + G  
Sbjct: 149 PEIEAVEQILDTETGLELNEENVEKVLAEIRPYLAGTGGGVLELVQINDYVIKVRLSGPA 208

Query: 159 SGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +G      T++  +   L   +P +  ++ +
Sbjct: 209 AG----VMTVRVALTQKLREKIPAIAAVQLI 235


>gi|284053033|ref|ZP_06383243.1| nitrogen-fixing NifU domain protein [Arthrospira platensis str.
           Paraca]
 gi|291566311|dbj|BAI88583.1| iron-sulfur cluster assembly factor [Arthrospira platensis NIES-39]
          Length = 79

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 12  ETVLDELRPYLMADGGNVEIVELDGPIVRLRLQGACGSCPSSTMTLKMGIERRLREKIPE 71

Query: 183 VKDIRTV 189
           + ++ +V
Sbjct: 72  IAEVESV 78


>gi|67921653|ref|ZP_00515171.1| Nitrogen-fixing NifU, C-terminal [Crocosphaera watsonii WH 8501]
 gi|67856765|gb|EAM52006.1| Nitrogen-fixing NifU, C-terminal [Crocosphaera watsonii WH 8501]
          Length = 80

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +PE
Sbjct: 13  ETVLDEMRPYLMADGGNVELVDIEGPVVKLRLQGACGSCPSSTMTLRMGIERRLREMIPE 72

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 73  IGEVEQV 79


>gi|126652035|ref|ZP_01724224.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905]
 gi|169826170|ref|YP_001696328.1| NifU-like protein [Lysinibacillus sphaericus C3-41]
 gi|299536342|ref|ZP_07049655.1| NifU-like protein [Lysinibacillus fusiformis ZC1]
 gi|126591125|gb|EAZ85235.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905]
 gi|168990658|gb|ACA38198.1| NifU-like protein [Lysinibacillus sphaericus C3-41]
 gi|298728328|gb|EFI68890.1| NifU-like protein [Lysinibacillus fusiformis ZC1]
          Length = 78

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           ++ +  +++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+ 
Sbjct: 3   EATINDQVQEVLDK-LRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGIE 61

Query: 174 NILNHFVPEVKDIRTV 189
             L   VP + ++  V
Sbjct: 62  RALLEEVPGIVEVEQV 77


>gi|332707425|ref|ZP_08427474.1| thioredoxin-like protein [Lyngbya majuscula 3L]
 gi|332353776|gb|EGJ33267.1| thioredoxin-like protein [Lyngbya majuscula 3L]
          Length = 80

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++         V L ++GAC  CPS++ TL+ G+   L  F+PE
Sbjct: 13  ETVLDEMRPYLMADGGNVELVELDGPTVKLRLQGACGSCPSSTMTLRMGIERRLKEFIPE 72

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 73  ILEVEQV 79


>gi|159028416|emb|CAO89859.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 78

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 37/66 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 11  EKVLDEMRPYLMSDGGNVELVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERRLREMIPE 70

Query: 183 VKDIRT 188
           + ++  
Sbjct: 71  IAEVEQ 76


>gi|229816700|ref|ZP_04446988.1| hypothetical protein COLINT_03748 [Collinsella intestinalis DSM
           13280]
 gi|229807752|gb|EEP43566.1| hypothetical protein COLINT_03748 [Collinsella intestinalis DSM
           13280]
          Length = 98

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           V + + + +  ++RP +  DGGD+ + G  +  +V L ++GAC+GCP +S TL  GV  I
Sbjct: 8   VDETLLKEVLEQIRPNLQADGGDMEYIGVTEDGVVKLELQGACAGCPMSSLTLSMGVERI 67

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V  +  V
Sbjct: 68  LKEHVPGVTRVEQV 81


>gi|218245975|ref|YP_002371346.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           8801]
 gi|257059024|ref|YP_003136912.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8802]
 gi|218166453|gb|ACK65190.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8801]
 gi|256589190|gb|ACV00077.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 8802]
          Length = 79

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
               +     E + + +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+
Sbjct: 2   ETMELTPDNVETVLDEMRPYLMADGGNVELVELDGPVVKLRLQGACGSCPSSTMTLRMGI 61

Query: 173 ANILNHFVPEVKDIRTV 189
              L   +PE+ ++  V
Sbjct: 62  ERRLREMIPEIAEVEQV 78


>gi|18423084|ref|NP_568715.1| NFU2 (NIFU-LIKE PROTEIN 2); structural molecule [Arabidopsis
           thaliana]
 gi|75163219|sp|Q93W20|NIFU2_ARATH RecName: Full=NifU-like protein 2, chloroplastic; Short=AtCNfu2;
           Short=AtCnfU-V; Flags: Precursor
 gi|13878181|gb|AAK44168.1|AF370353_1 unknown protein [Arabidopsis thaliana]
 gi|16226434|gb|AAL16167.1|AF428399_1 AT5g49940/K9P8_8 [Arabidopsis thaliana]
 gi|17104539|gb|AAL34158.1| unknown protein [Arabidopsis thaliana]
 gi|26452324|dbj|BAC43248.1| unknown protein [Arabidopsis thaliana]
 gi|28207818|emb|CAD55559.1| NFU2 protein [Arabidopsis thaliana]
 gi|332008490|gb|AED95873.1| NifU-like protein 2 [Arabidopsis thaliana]
          Length = 235

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 38/73 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   
Sbjct: 84  PLTEENVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERR 143

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 144 LMEKIPEIVAVEA 156



 Score = 39.8 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 54/184 (29%), Gaps = 26/184 (14%)

Query: 8   TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67
           TP+P     I    +  E      N +          +     +A      + + V    
Sbjct: 76  TPDP-----ILEVPLTEE------NVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQG 124

Query: 68  YDW--EHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVL 125
                      +   I    +   P I    +  +  ++ G     E+   V++ I+  L
Sbjct: 125 ACGSCPSSTMTMKMGIERRLMEKIPEIV--AVEALPDEETGLELNEENIEKVLEEIRPYL 182

Query: 126 DNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
                       G +      D IV + + G  +G      T++  V   L   +P +  
Sbjct: 183 IGTA-------DGSLDLVEIEDPIVKIRITGPAAG----VMTVRVAVTQKLREKIPSIAA 231

Query: 186 IRTV 189
           ++ +
Sbjct: 232 VQLI 235


>gi|86608468|ref|YP_477230.1| NifU domain-containing protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557010|gb|ABD01967.1| NifU domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 80

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + N +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 6   ELNTENVEKVLNELRPYLMADGGNVELVEIDGPVVKLRLQGACGACPSSTMTLKMGIERK 65

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  V
Sbjct: 66  LRESIPDILEVEQV 79


>gi|284929666|ref|YP_003422188.1| thioredoxin-like protein [cyanobacterium UCYN-A]
 gi|284810110|gb|ADB95807.1| thioredoxin-like protein [cyanobacterium UCYN-A]
          Length = 76

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 37/66 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 9   EQVLDELRPYLIADGGNVELVEIDGAIVKLRLQGACGSCPSSTMTLKMGIERRLKEMIPE 68

Query: 183 VKDIRT 188
           V ++  
Sbjct: 69  VSEVEQ 74


>gi|149183085|ref|ZP_01861537.1| YutI [Bacillus sp. SG-1]
 gi|148849214|gb|EDL63412.1| YutI [Bacillus sp. SG-1]
          Length = 78

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +V +++EVLD  +RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   
Sbjct: 5   ELVPQVQEVLDK-LRPFLLRDGGDCELVDIEDGIVKLRLLGACGSCPSSTITLKAGIERA 63

Query: 176 LNHFVPEVKDIRTV 189
           L   VP + ++  V
Sbjct: 64  LLEEVPGIVEVEQV 77


>gi|327439123|dbj|BAK15488.1| thioredoxin-like protein [Solibacillus silvestris StLB046]
          Length = 78

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +++    +++EVLD  +RP + RDGGD       +GIV L + GAC  CPS++ TLK G+
Sbjct: 2   TETEQYAQVQEVLDK-LRPFLLRDGGDCELVDIEEGIVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP + ++  V
Sbjct: 61  ERALLEEVPGIVEVEQV 77


>gi|17228804|ref|NP_485352.1| hypothetical protein asr1309 [Nostoc sp. PCC 7120]
 gi|75909243|ref|YP_323539.1| nitrogen-fixing NifU-like protein [Anabaena variabilis ATCC 29413]
 gi|17130656|dbj|BAB73266.1| asr1309 [Nostoc sp. PCC 7120]
 gi|75702968|gb|ABA22644.1| Nitrogen-fixing NifU-like protein [Anabaena variabilis ATCC 29413]
          Length = 76

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L   +PE
Sbjct: 9   ETVLDEMRPYLISDGGNVELVELDGPIVKLRLQGACGSCPSSTMTLRMGIERRLREMIPE 68

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 69  IAEVEQV 75


>gi|220907447|ref|YP_002482758.1| nitrogen-fixing NifU domain-containing protein [Cyanothece sp. PCC
           7425]
 gi|219864058|gb|ACL44397.1| nitrogen-fixing NifU domain protein [Cyanothece sp. PCC 7425]
          Length = 76

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   
Sbjct: 2   ELTTDNVEKVLDELRPYLMADGGNVELVELEGPIVRLRLQGACGSCPSSTMTLRMGIERK 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 62  LRESIPEIAEVEQV 75


>gi|254422508|ref|ZP_05036226.1| hypothetical protein S7335_2660 [Synechococcus sp. PCC 7335]
 gi|196189997|gb|EDX84961.1| hypothetical protein S7335_2660 [Synechococcus sp. PCC 7335]
          Length = 79

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 41/73 (56%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + +   E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   L
Sbjct: 6   LTKPNVEKVLDELRPYLMADGGNVELVELDGPIVKLRLQGACGSCPSSAMTLRMGIERRL 65

Query: 177 NHFVPEVKDIRTV 189
             F+PE+ +I  V
Sbjct: 66  REFIPEIAEIEQV 78


>gi|308272822|emb|CBX29426.1| hypothetical protein N47_J04070 [uncultured Desulfobacterium sp.]
          Length = 61

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +RP + +DGGD+      +GIV + ++GAC+GCP +  TLK G+  +L   VP VK +  
Sbjct: 1   MRPMLQKDGGDVEIVDVSEGIVKVRLQGACAGCPMSQMTLKNGIEKLLMQDVPGVKSVVA 60

Query: 189 V 189
           V
Sbjct: 61  V 61


>gi|91200475|emb|CAJ73523.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 72

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + ++I+E L   +RPA+  DGGDI    Y DGIV + ++GAC  CPS+  TLKYGV   L
Sbjct: 1   MKEKIEEAL-KGIRPALQADGGDIELVDYEDGIVKVRLKGACGSCPSSLATLKYGVEARL 59

Query: 177 NHFVPEVKDIR 187
              +PE++ + 
Sbjct: 60  KEIIPEIESVE 70


>gi|56964703|ref|YP_176434.1| nitrogen fixation protein [Bacillus clausii KSM-K16]
 gi|56910946|dbj|BAD65473.1| nitrogen fixation protein [Bacillus clausii KSM-K16]
          Length = 79

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E+ + ++++++EVLD  +RP + RDGGD+      DG+V + + GAC  CPS++ TLK 
Sbjct: 1   METSTELMEQVQEVLDK-LRPFLLRDGGDVELIDVEDGVVKVRLLGACGSCPSSTITLKA 59

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+   L   VP + +I  V
Sbjct: 60  GIERALLEEVPGITEIEQV 78


>gi|8777425|dbj|BAA97015.1| unnamed protein product [Arabidopsis thaliana]
          Length = 684

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 38/73 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + +RP +  DGG++        IV + ++GAC  CPS++ T+K G+   
Sbjct: 84  PLTEENVESVLDEIRPYLMSDGGNVALHEIDGNIVRVKLQGACGSCPSSTMTMKMGIERR 143

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 144 LMEKIPEIVAVEA 156


>gi|87125583|ref|ZP_01081428.1| NifU-like protein [Synechococcus sp. RS9917]
 gi|86166883|gb|EAQ68145.1| NifU-like protein [Synechococcus sp. RS9917]
          Length = 81

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKLREMIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|255582605|ref|XP_002532084.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223528244|gb|EEF30298.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 220

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP +  DGG++V       +V L ++GAC  CPS++ TLK G+   
Sbjct: 68  PLTEENVEKVLDEVRPGLMADGGNVVLHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETR 127

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+  +  +
Sbjct: 128 LRDKIPEIMAVEQI 141



 Score = 37.9 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 30/75 (40%), Gaps = 5/75 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            +     E +   +RP +A  GG +       D IV + + G  +G      T++  +  
Sbjct: 149 ELNDENVEKVLAEIRPYLAGTGGGVLELVQIDDYIVKVRLSGPAAG----VMTVRVALTQ 204

Query: 175 ILNHFVPEVKDIRTV 189
            L   +P +  ++ +
Sbjct: 205 KLRDKIPAIAAVQLI 219


>gi|158334696|ref|YP_001515868.1| NifU domain-containing protein [Acaryochloris marina MBIC11017]
 gi|158304937|gb|ABW26554.1| NifU domain protein [Acaryochloris marina MBIC11017]
          Length = 80

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 6   ELNPENVETVLDELRPYLMADGGNVELVEVEGPVVKLRLQGACGSCPSSAMTLKMGIERK 65

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 66  LRDTIPEIAEVEQV 79


>gi|210630137|ref|ZP_03296252.1| hypothetical protein COLSTE_00136 [Collinsella stercoris DSM 13279]
 gi|210160610|gb|EEA91581.1| hypothetical protein COLSTE_00136 [Collinsella stercoris DSM 13279]
          Length = 93

 Score = 87.5 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           V +++   +  ++RP +  DGGD+ + G  D  +V L ++GAC+GCP +S TL  G+  I
Sbjct: 3   VNEQLLLEVLEQIRPNLQADGGDMAYVGVTDEGVVQLELQGACAGCPMSSLTLSMGIERI 62

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V  +  V
Sbjct: 63  LKEHVPGVTRVEQV 76


>gi|194476553|ref|YP_002048732.1| NifU-like protein [Paulinella chromatophora]
 gi|171191560|gb|ACB42522.1| NifU-like protein [Paulinella chromatophora]
          Length = 81

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + N +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 14  ETVLNELRPFLIADGGNVEVAEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKLREAIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVIQV 80


>gi|15615981|ref|NP_244286.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans
           C-125]
 gi|10176042|dbj|BAB07138.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans
           C-125]
          Length = 79

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E+ + + +++KEVLD  +RP + RDGGD+      DGIV + + GAC  CPS++ TLK 
Sbjct: 1   METSTEMHEQVKEVLDK-LRPFLLRDGGDVELVDVEDGIVKVRLLGACGSCPSSTITLKA 59

Query: 171 GVANILNHFVPEVKDIRTV 189
           G+   L   VP VK+I  V
Sbjct: 60  GIERALLEEVPGVKEIEQV 78


>gi|166364297|ref|YP_001656570.1| NifU-like protein [Microcystis aeruginosa NIES-843]
 gi|166086670|dbj|BAG01378.1| NifU-like protein [Microcystis aeruginosa NIES-843]
          Length = 78

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 37/66 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 11  EQVLDEMRPYLMADGGNVELVEIDGPVVKLRLQGACGSCPSSTMTLKMGIERRLREVIPE 70

Query: 183 VKDIRT 188
           + ++  
Sbjct: 71  IAEVEQ 76


>gi|126660171|ref|ZP_01731289.1| putative NifU-like protein [Cyanothece sp. CCY0110]
 gi|126618536|gb|EAZ89287.1| putative NifU-like protein [Cyanothece sp. CCY0110]
          Length = 80

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 37/66 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 13  ETVLDEMRPYLMADGGNVELVEIEGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMIPE 72

Query: 183 VKDIRT 188
           + ++  
Sbjct: 73  IAEVEQ 78


>gi|255083372|ref|XP_002504672.1| predicted protein [Micromonas sp. RCC299]
 gi|226519940|gb|ACO65930.1| predicted protein [Micromonas sp. RCC299]
          Length = 192

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 106 GSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSAS 165
           G     E        +++VLD  VRP +  DGGD+        +V L + GAC  CPS++
Sbjct: 31  GESSISEKLELTADNVEKVLDE-VRPYLIADGGDVELVEIDGLVVRLKLNGACGSCPSST 89

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            T++ G+   L   +PE+ ++  +
Sbjct: 90  VTMRMGIEKRLMEKIPEIMEVEQI 113



 Score = 39.8 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 30/73 (41%), Gaps = 5/73 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +   E   + +RP +A  GG  +      D IV + + G      ++  T++  V  
Sbjct: 121 DLTEENVEATLDEIRPYLAGTGGGQLELVDIEDPIVKVRLTGP----AASVMTVRVAVTQ 176

Query: 175 ILNHFVPEVKDIR 187
            L   +P +  ++
Sbjct: 177 KLREKMPSIAAVQ 189


>gi|332968729|gb|EGK07781.1| NifU domain protein [Desmospora sp. 8437]
          Length = 73

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++   + + +++RP + RDGGD+      DG+V + + GAC  CPS++ TLK G+   L 
Sbjct: 1   MKEQVQEVLDKLRPFIQRDGGDVELVNVEDGVVKVRLLGACGSCPSSTITLKAGIERALM 60

Query: 178 HFVPEVKDIRTV 189
             +P V ++  V
Sbjct: 61  EEIPGVTEVEQV 72


>gi|282898150|ref|ZP_06306143.1| Nitrogen-fixing NifU-like protein [Raphidiopsis brookii D9]
 gi|281196974|gb|EFA71877.1| Nitrogen-fixing NifU-like protein [Raphidiopsis brookii D9]
          Length = 76

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   
Sbjct: 2   ELTLENVETVLDEMRPYLMSDGGNVEVVELDGPIVKLRLQGACGSCPSSTMTLRMGIERR 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 62  LKEMIPEIGEVEQV 75


>gi|33862527|ref|NP_894087.1| NifU-like protein [Prochlorococcus marinus str. MIT 9313]
 gi|124023791|ref|YP_001018098.1| NifU-like protein [Prochlorococcus marinus str. MIT 9303]
 gi|33640640|emb|CAE20429.1| NifU-like protein [Prochlorococcus marinus str. MIT 9313]
 gi|123964077|gb|ABM78833.1| NifU-like protein [Prochlorococcus marinus str. MIT 9303]
          Length = 81

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 14  ETVLDELRPFLMADGGNVEIVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKLREMIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|242094042|ref|XP_002437511.1| hypothetical protein SORBIDRAFT_10g028390 [Sorghum bicolor]
 gi|241915734|gb|EER88878.1| hypothetical protein SORBIDRAFT_10g028390 [Sorghum bicolor]
          Length = 240

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 41/74 (55%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 88  PLTEENVEKVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETR 147

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  +
Sbjct: 148 LRDKIPDILEVEQI 161


>gi|226503511|ref|NP_001150793.1| NFU3 [Zea mays]
 gi|195641898|gb|ACG40417.1| NFU3 [Zea mays]
          Length = 213

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 41/74 (55%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS++ TLK G+   
Sbjct: 61  PLTEENVEKVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLKMGIETR 120

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  +
Sbjct: 121 LRDKIPDILEVEQI 134



 Score = 34.4 bits (77), Expect = 7.2,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 5/64 (7%)

Query: 125 LDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + + +RP ++  GG  +        +V + + G  +G      T++  V   L   +P +
Sbjct: 151 VLDEIRPYLSGTGGGSLELLQIDGYVVKIRIGGPAAG----VMTVRVAVTQKLREKIPSI 206

Query: 184 KDIR 187
             ++
Sbjct: 207 LAVQ 210


>gi|172035933|ref|YP_001802434.1| NifU-like protein [Cyanothece sp. ATCC 51142]
 gi|171697387|gb|ACB50368.1| NifU-like protein [Cyanothece sp. ATCC 51142]
          Length = 80

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 37/66 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 13  EQVLDEMRPYLMADGGNVELVEIEGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMIPE 72

Query: 183 VKDIRT 188
           + ++  
Sbjct: 73  IAEVEQ 78


>gi|65316943|ref|ZP_00389902.1| COG0694: Thioredoxin-like proteins and domains [Bacillus anthracis
           str. A2012]
          Length = 95

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  + +++ EVLD  +RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+
Sbjct: 2   ENPHMQEQVLEVLDK-LRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP V ++  V
Sbjct: 61  ERALLEEVPGVIEVEQV 77


>gi|223993177|ref|XP_002286272.1| nifU like protein [Thalassiosira pseudonana CCMP1335]
 gi|220977587|gb|EED95913.1| nifU like protein [Thalassiosira pseudonana CCMP1335]
          Length = 237

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 59/134 (44%), Gaps = 2/134 (1%)

Query: 55  YFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESD 114
           +   + I++   ++     RP +   I+  F   +    +     +      S    +  
Sbjct: 24  HGARNHISLSTRRHSPFSTRPQLRMTIVSPF--DNTEDSDESGEGVATATYTSLGSDDEP 81

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             +     +++   +RP + +DGG++        IV L ++GAC  CPS+++T+K G+  
Sbjct: 82  LDLTWENVDMVLEEMRPFLLQDGGNVAISEIDGPIVKLELQGACGTCPSSTQTMKMGLER 141

Query: 175 ILNHFVPEVKDIRT 188
            L   +PE++++  
Sbjct: 142 KLRERIPEIQEVIQ 155


>gi|313230549|emb|CBY18765.1| unnamed protein product [Oikopleura dioica]
          Length = 146

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 52/83 (62%), Gaps = 2/83 (2%)

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASE 166
              +S + VV  IKE+LD R+RP V  DGGDI F  +      + LS+ GAC+ CPS+  
Sbjct: 41  PQPKSANEVVAMIKELLDTRIRPTVMEDGGDIAFVSFDPDTGVLQLSLIGACATCPSSVV 100

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK+GV N++  ++PE+ ++  +
Sbjct: 101 TLKHGVENMMKFYIPEITEVEQI 123


>gi|52081716|ref|YP_080507.1| hypothetical protein BL02118 [Bacillus licheniformis ATCC 14580]
 gi|52787102|ref|YP_092931.1| YutI [Bacillus licheniformis ATCC 14580]
 gi|319647633|ref|ZP_08001851.1| nitrogen fixation protein [Bacillus sp. BT1B_CT2]
 gi|52004927|gb|AAU24869.1| Conserved protein YutI [Bacillus licheniformis ATCC 14580]
 gi|52349604|gb|AAU42238.1| YutI [Bacillus licheniformis ATCC 14580]
 gi|317389974|gb|EFV70783.1| nitrogen fixation protein [Bacillus sp. BT1B_CT2]
          Length = 79

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + ++++EVLD  +RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   
Sbjct: 6   EMKEQVQEVLDK-LRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIERA 64

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V ++  V
Sbjct: 65  LLEEVPGVIEVEQV 78


>gi|328953813|ref|YP_004371147.1| nitrogen-fixing NifU domain-containing protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454137|gb|AEB09966.1| nitrogen-fixing NifU domain-containing protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 72

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++   E    ++RP + RDGGD+       G+V + + GAC GCP +  TLK G+  +L 
Sbjct: 1   MKEAVEKSLAKIRPMLQRDGGDVELVEVEHGVVKVKLTGACKGCPMSQMTLKNGIERLLK 60

Query: 178 HFVPEVKDIRTV 189
             VP +  + +V
Sbjct: 61  QEVPGIVSVESV 72


>gi|282900620|ref|ZP_06308562.1| Nitrogen-fixing NifU-like protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194420|gb|EFA69375.1| Nitrogen-fixing NifU-like protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 76

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   
Sbjct: 2   ELTLENVETVLDEMRPYLISDGGNVEVVELDGPIVKLRLQGACGSCPSSTMTLRMGIERR 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 62  LKEMIPEIGEVEQV 75


>gi|300867628|ref|ZP_07112276.1| nitrogen-fixing NifU-like [Oscillatoria sp. PCC 6506]
 gi|300334389|emb|CBN57446.1| nitrogen-fixing NifU-like [Oscillatoria sp. PCC 6506]
          Length = 79

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +PE
Sbjct: 12  EQVLDELRPYLMSDGGNVELVEIEGPVVQLRLQGACGSCPSSAMTLRMGIERRLRETIPE 71

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 72  IAEVEQV 78


>gi|159902957|ref|YP_001550301.1| NifU-like protein [Prochlorococcus marinus str. MIT 9211]
 gi|159888133|gb|ABX08347.1| NifU-like protein [Prochlorococcus marinus str. MIT 9211]
          Length = 81

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           +    + +   E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 3   QETMPLTKDNVEKVLDELRPFLMADGGNVEIVEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +PEV ++  +
Sbjct: 63  IERKLREMIPEVSEVVQI 80


>gi|15923926|ref|NP_371460.1| hypothetical protein SAV0936 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926525|ref|NP_374058.1| hypothetical protein SA0797 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282547|ref|NP_645635.1| hypothetical protein MW0818 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483096|ref|YP_040320.1| hypothetical protein SAR0898 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485712|ref|YP_042933.1| hypothetical protein SAS0806 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|82750551|ref|YP_416292.1| hypothetical protein SAB0802c [Staphylococcus aureus RF122]
 gi|87159950|ref|YP_493539.1| hypothetical protein SAUSA300_0839 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194630|ref|YP_499426.1| hypothetical protein SAOUHSC_00873 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267370|ref|YP_001246313.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393423|ref|YP_001316098.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151221019|ref|YP_001331841.1| hypothetical protein NWMN_0807 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979262|ref|YP_001441521.1| hypothetical protein SAHV_0931 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509138|ref|YP_001574797.1| hypothetical protein USA300HOU_0897 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141927|ref|ZP_03566420.1| hypothetical protein SauraJ_09890 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316824|ref|ZP_04840037.1| hypothetical protein SauraC_11885 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731543|ref|ZP_04865708.1| NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732709|ref|ZP_04866874.1| NifU family protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005726|ref|ZP_05144327.2| hypothetical protein SauraM_04635 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424985|ref|ZP_05601412.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427651|ref|ZP_05604050.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257430286|ref|ZP_05606669.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432983|ref|ZP_05609343.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435887|ref|ZP_05611935.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257795329|ref|ZP_05644308.1| nitrogen fixation protein NifU [Staphylococcus aureus A9781]
 gi|258406978|ref|ZP_05680131.1| nitrogen fixation protein NifU [Staphylococcus aureus A9763]
 gi|258421946|ref|ZP_05684867.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258424377|ref|ZP_05687257.1| nitrogen fixation protein [Staphylococcus aureus A9635]
 gi|258435343|ref|ZP_05689082.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258441555|ref|ZP_05690915.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus A8115]
 gi|258447254|ref|ZP_05695403.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258450014|ref|ZP_05698112.1| nitrogen fixation protein NifU [Staphylococcus aureus A6224]
 gi|258452112|ref|ZP_05700128.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258455527|ref|ZP_05703486.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262049630|ref|ZP_06022498.1| hypothetical protein SAD30_1213 [Staphylococcus aureus D30]
 gi|262052935|ref|ZP_06025116.1| hypothetical protein SA930_0147 [Staphylococcus aureus 930918-3]
 gi|269202551|ref|YP_003281820.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893963|ref|ZP_06302194.1| thioredoxin [Staphylococcus aureus A8117]
 gi|282903473|ref|ZP_06311364.1| NifU domain protein [Staphylococcus aureus subsp. aureus C160]
 gi|282905251|ref|ZP_06313108.1| thioredoxin-family protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908231|ref|ZP_06316062.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282910512|ref|ZP_06318316.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282913708|ref|ZP_06321497.1| NifU domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282916186|ref|ZP_06323948.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus D139]
 gi|282918634|ref|ZP_06326371.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C427]
 gi|282922215|ref|ZP_06329910.1| thioredoxin-like protein [Staphylococcus aureus A9765]
 gi|282923624|ref|ZP_06331304.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C101]
 gi|282927159|ref|ZP_06334781.1| thioredoxin-like protein [Staphylococcus aureus A10102]
 gi|283770001|ref|ZP_06342893.1| thioredoxin protein [Staphylococcus aureus subsp. aureus H19]
 gi|283957674|ref|ZP_06375127.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284023863|ref|ZP_06378261.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           132]
 gi|293500750|ref|ZP_06666601.1| thioredoxin protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509700|ref|ZP_06668411.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus M809]
 gi|293524288|ref|ZP_06670975.1| NifU domain protein [Staphylococcus aureus subsp. aureus M1015]
 gi|294850211|ref|ZP_06790947.1| thioredoxin-like protein [Staphylococcus aureus A9754]
 gi|295405741|ref|ZP_06815550.1| thioredoxin-like protein [Staphylococcus aureus A8819]
 gi|295427419|ref|ZP_06820054.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275869|ref|ZP_06858376.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297208429|ref|ZP_06924859.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245332|ref|ZP_06929203.1| hypothetical protein SLAG_01427 [Staphylococcus aureus A8796]
 gi|297590221|ref|ZP_06948860.1| NifU domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|300912505|ref|ZP_07129948.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381511|ref|ZP_07364161.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13700740|dbj|BAB42036.1| SA0797 [Staphylococcus aureus subsp. aureus N315]
 gi|14246705|dbj|BAB57098.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21203984|dbj|BAB94683.1| MW0818 [Staphylococcus aureus subsp. aureus MW2]
 gi|49241225|emb|CAG39904.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244155|emb|CAG42581.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|82656082|emb|CAI80490.1| nitrogen fixation protein [Staphylococcus aureus RF122]
 gi|87125924|gb|ABD20438.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202188|gb|ABD29998.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147740439|gb|ABQ48737.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945875|gb|ABR51811.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150373819|dbj|BAF67079.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721397|dbj|BAF77814.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367947|gb|ABX28918.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724786|gb|EES93515.1| NifU family protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729320|gb|EES98049.1| NifU family protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|257272555|gb|EEV04678.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275844|gb|EEV07317.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257279063|gb|EEV09674.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282398|gb|EEV12533.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285078|gb|EEV15197.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257789301|gb|EEV27641.1| nitrogen fixation protein NifU [Staphylococcus aureus A9781]
 gi|257841517|gb|EEV65958.1| nitrogen fixation protein NifU [Staphylococcus aureus A9763]
 gi|257842279|gb|EEV66707.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257845390|gb|EEV69424.1| nitrogen fixation protein [Staphylococcus aureus A9635]
 gi|257849004|gb|EEV72987.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257852345|gb|EEV76271.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus A8115]
 gi|257854002|gb|EEV76956.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257856934|gb|EEV79837.1| nitrogen fixation protein NifU [Staphylococcus aureus A6224]
 gi|257860327|gb|EEV83159.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257862345|gb|EEV85114.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|259159186|gb|EEW44249.1| hypothetical protein SA930_0147 [Staphylococcus aureus 930918-3]
 gi|259162272|gb|EEW46846.1| hypothetical protein SAD30_1213 [Staphylococcus aureus D30]
 gi|262074841|gb|ACY10814.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940438|emb|CBI48815.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314492|gb|EFB44882.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C101]
 gi|282317768|gb|EFB48140.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus C427]
 gi|282319626|gb|EFB49974.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus D139]
 gi|282322740|gb|EFB53062.1| NifU domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282325904|gb|EFB56212.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282327896|gb|EFB58178.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282331658|gb|EFB61170.1| thioredoxin-family protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590848|gb|EFB95923.1| thioredoxin-like protein [Staphylococcus aureus A10102]
 gi|282593505|gb|EFB98499.1| thioredoxin-like protein [Staphylococcus aureus A9765]
 gi|282596428|gb|EFC01389.1| NifU domain protein [Staphylococcus aureus subsp. aureus C160]
 gi|282763449|gb|EFC03578.1| thioredoxin [Staphylococcus aureus A8117]
 gi|283460148|gb|EFC07238.1| thioredoxin protein [Staphylococcus aureus subsp. aureus H19]
 gi|283470135|emb|CAQ49346.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283791125|gb|EFC29940.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285816615|gb|ADC37102.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus
           04-02981]
 gi|290921251|gb|EFD98312.1| NifU domain protein [Staphylococcus aureus subsp. aureus M1015]
 gi|291095755|gb|EFE26016.1| thioredoxin protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467797|gb|EFF10312.1| nitrogen-fixing NifU domain-containing protein [Staphylococcus
           aureus subsp. aureus M809]
 gi|294822985|gb|EFG39418.1| thioredoxin-like protein [Staphylococcus aureus A9754]
 gi|294969176|gb|EFG45196.1| thioredoxin-like protein [Staphylococcus aureus A8819]
 gi|295128807|gb|EFG58438.1| thioredoxin-like protein [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887168|gb|EFH26071.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177635|gb|EFH36885.1| hypothetical protein SLAG_01427 [Staphylococcus aureus A8796]
 gi|297576520|gb|EFH95235.1| NifU domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|298694175|gb|ADI97397.1| nitrogen fixation protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300886751|gb|EFK81953.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|302332549|gb|ADL22742.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302750764|gb|ADL64941.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339874|gb|EFM05818.1| NifU domain protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312438702|gb|ADQ77773.1| NifU domain protein [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829333|emb|CBX34175.1| nifU-like domain protein [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315130484|gb|EFT86471.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315194468|gb|EFU24860.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315197289|gb|EFU27627.1| possible NifU family protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141247|gb|EFW33094.1| NifU-like domain protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143019|gb|EFW34810.1| NifU-like domain protein [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440910|gb|EGA98618.1| NifU domain-containing protein [Staphylococcus aureus O11]
 gi|323443798|gb|EGB01410.1| NifU domain-containing protein [Staphylococcus aureus O46]
 gi|329313603|gb|AEB88016.1| Nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726251|gb|EGG62721.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21189]
 gi|329728166|gb|EGG64605.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21172]
 gi|329733972|gb|EGG70294.1| NifU-like protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 80

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            D+ +  ++ EV+  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   EDTTMFDQVAEVI-ERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|255576215|ref|XP_002529001.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223531541|gb|EEF33371.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 226

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + VRP +  DGG++        +V L ++GAC  CPS+  T+K G+   L   +PE
Sbjct: 82  ESVLDEVRPYLIADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLMEKIPE 141

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 142 IVAVEPI 148



 Score = 35.5 bits (80), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 38/114 (33%), Gaps = 13/114 (11%)

Query: 74  RPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAV 133
              +   I    +   P I    +  +  ++ G     E+   V++ I+  L        
Sbjct: 124 VMTMKMGIERRLMEKIPEIV--AVEPIADEETGLELNEENIEKVLEEIRPYLVGAA---- 177

Query: 134 ARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
              GG +      + I  + + G  +G      T++  V   L   +P +  ++
Sbjct: 178 ---GGSLELVAIEEPIAKIRITGPAAG----VMTVRVAVTQKLREKIPAIAAVQ 224


>gi|323488633|ref|ZP_08093875.1| NifU-like protein [Planococcus donghaensis MPA1U2]
 gi|323397651|gb|EGA90455.1| NifU-like protein [Planococcus donghaensis MPA1U2]
          Length = 78

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +  ++ EVLD  +RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L
Sbjct: 6   LEDQVMEVLDK-LRPFLLRDGGDCELVDIEDGIVKLRLLGACGSCPSSTITLKAGIERAL 64

Query: 177 NHFVPEVKDIRTV 189
              VP + ++  V
Sbjct: 65  VEEVPGIVEVEQV 77


>gi|56751077|ref|YP_171778.1| putative NifU-like protein [Synechococcus elongatus PCC 6301]
 gi|81299261|ref|YP_399469.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
 gi|24414813|emb|CAD55626.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
 gi|56686036|dbj|BAD79258.1| putative NifU-like protein [Synechococcus elongatus PCC 6301]
 gi|81168142|gb|ABB56482.1| putative NifU-like protein [Synechococcus elongatus PCC 7942]
          Length = 81

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV L + GAC  CPS++ TL+ G+   L   +PE
Sbjct: 14  ETVLDELRPYLIADGGNVELVELDGPIVKLRLNGACGSCPSSTMTLRMGIERKLRESIPE 73

Query: 183 VKDIRTV 189
           + ++  V
Sbjct: 74  ISEVEQV 80


>gi|229543324|ref|ZP_04432384.1| nitrogen-fixing NifU domain protein [Bacillus coagulans 36D1]
 gi|229327744|gb|EEN93419.1| nitrogen-fixing NifU domain protein [Bacillus coagulans 36D1]
          Length = 78

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             + ++++EVLD  +RP + RDGGD       DGIV L + GAC  CPS++ TLK G+  
Sbjct: 4   DTITEQVQEVLDK-LRPFLLRDGGDCELIDVEDGIVKLRLLGACGSCPSSTITLKAGIER 62

Query: 175 ILNHFVPEVKDIRTV 189
            L   VP V ++  V
Sbjct: 63  ALFEEVPGVMEVEQV 77


>gi|116781227|gb|ABK22014.1| unknown [Picea sitchensis]
          Length = 238

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 49/107 (45%)

Query: 83  EHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVF 142
            H + G+ +  +       + +  +        A+     E++ + VRP +  DGG++  
Sbjct: 54  RHLVLGNTLHQSRQTRGKHVIEAIATPPTTGGLALTVENIEMILDEVRPYLMADGGNVEL 113

Query: 143 KGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
                 +V L ++GAC  CPS+  T+K G+   L   +PE+  ++ V
Sbjct: 114 HEIDGNVVTLKLQGACGSCPSSMTTMKTGIEGRLMEKIPEIIAVKQV 160



 Score = 36.3 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 37/92 (40%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGG-DIVFKGYRDGIVFLSMR 155
               ++  +     +E+   + +   E +   +RP ++  GG D+ F    D +V + + 
Sbjct: 149 EKIPEIIAVKQVFDMETGLELTEENVEKILAEIRPYLSGTGGGDLEFVKIDDPVVKVRIS 208

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G      +   T++  +   L   +P +  ++
Sbjct: 209 GP----AAEVMTVRVALTQKLREKIPAIAAVQ 236


>gi|118487917|gb|ABK95780.1| unknown [Populus trichocarpa]
          Length = 224

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   
Sbjct: 72  PLTEENVEKVLDEVRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETK 131

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ D+  +
Sbjct: 132 LRDKIPEIMDVEQI 145



 Score = 38.6 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 34/87 (39%), Gaps = 5/87 (5%)

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCP 162
           D+      E+   + +   E     +RP +A  GG +       D +V + + G  +G  
Sbjct: 141 DVEQIMDTETGLELNEENVEKALAEIRPYLAGTGGGVLELVQINDYVVKVRLSGPAAG-- 198

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
               T++  +   L   +P +  ++ +
Sbjct: 199 --VMTVRVALTQKLRETIPAIAAVQLI 223


>gi|152012745|gb|AAI50438.1| Hirip5 protein [Danio rerio]
          Length = 157

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKE---AEISPLASRIFSIPGIASVYFG 57
           MFIQT+DTPNP +LKF+PG+ VL  G + F+  ++   A+ +P       +  I  +   
Sbjct: 51  MFIQTQDTPNPNSLKFLPGRAVLDSGTMDFAGPRDAPRADTAPSEDDDEVVAMIKELLDT 110

Query: 58  YDFITVGKD---QYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDM 100
               TV +D   + +W+ ++P V   IM+ F SG P+++       
Sbjct: 111 RIRPTVQEDGSGETEWKVIKPDVFATIMDFFTSGLPVVNEADAPSS 156


>gi|72383588|ref|YP_292943.1| NifU-like protein [Prochlorococcus marinus str. NATL2A]
 gi|124025184|ref|YP_001014300.1| NifU-like protein [Prochlorococcus marinus str. NATL1A]
 gi|72003438|gb|AAZ59240.1| NifU-like protein [Prochlorococcus marinus str. NATL2A]
 gi|123960252|gb|ABM75035.1| NifU-like protein [Prochlorococcus marinus str. NATL1A]
          Length = 81

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREMIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVIQV 80


>gi|226314372|ref|YP_002774268.1| iron-sulfur cluster assembly protein [Brevibacillus brevis NBRC
           100599]
 gi|226097322|dbj|BAH45764.1| putative iron-sulfur cluster assembly protein [Brevibacillus brevis
           NBRC 100599]
          Length = 89

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E +  ++ +++EVLD  +RP + RDGGD+      DGIV L + GAC  CPS++ TLK G
Sbjct: 12  ECNMDIMDQVQEVLDK-LRPYLQRDGGDVQLVDVEDGIVKLRLMGACGSCPSSTITLKAG 70

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +P +K+++ V
Sbjct: 71  IERALVEEIPGIKEVQQV 88


>gi|302392635|ref|YP_003828455.1| nitrogen-fixing NifU domain protein [Acetohalobium arabaticum DSM
           5501]
 gi|302204712|gb|ADL13390.1| nitrogen-fixing NifU domain protein [Acetohalobium arabaticum DSM
           5501]
          Length = 72

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++   E   +++RP++  DGG +      +G+V + + GAC GCP +  TLK G+  +L 
Sbjct: 1   MKEEVEAALDKIRPSLEADGGGVELIDVEEGVVKVKLTGACGGCPMSQMTLKNGIERVLK 60

Query: 178 HFVPEVKDIRTV 189
             +PEV+ + +V
Sbjct: 61  EEIPEVEKVESV 72


>gi|297803520|ref|XP_002869644.1| hypothetical protein ARALYDRAFT_492226 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297315480|gb|EFH45903.1| hypothetical protein ARALYDRAFT_492226 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 238

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + 
Sbjct: 85  PLTEENVERVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESR 144

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 145 LRDKIPEIMSVEQ 157



 Score = 37.9 bits (86), Expect = 0.73,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 4/70 (5%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++VL           GG +        IV + + G  +G      T++  +   L 
Sbjct: 170 DENIEKVLSELRPYLSGTGGGGLELVEIDGYIVKVRLSGPAAG----VMTVRVALTQKLR 225

Query: 178 HFVPEVKDIR 187
             +P +  ++
Sbjct: 226 ENIPSIGAVQ 235


>gi|21554503|gb|AAM63593.1| nitrogen fixation like protein [Arabidopsis thaliana]
          Length = 236

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + 
Sbjct: 83  PLTEENVERVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESR 142

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 143 LRDKIPEIMSVEQ 155



 Score = 37.1 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 26/70 (37%), Gaps = 4/70 (5%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++VL           GG +        +V + + G  +G      T++  +   L 
Sbjct: 168 DENIEKVLSELRPYLSGTGGGGLELVEIDGYVVKVRLTGPAAG----VMTVRVALTQKLR 223

Query: 178 HFVPEVKDIR 187
             +P +  ++
Sbjct: 224 ETIPSIGAVQ 233


>gi|4538920|emb|CAB39656.1| nitrogen fixation like protein [Arabidopsis thaliana]
 gi|7269442|emb|CAB79446.1| nitrogen fixation like protein [Arabidopsis thaliana]
          Length = 224

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + 
Sbjct: 71  PLTEENVERVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESR 130

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 131 LRDKIPEIMSVEQ 143



 Score = 37.1 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 26/70 (37%), Gaps = 4/70 (5%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++VL           GG +        +V + + G  +G      T++  +   L 
Sbjct: 156 DENIEKVLSELRPYLSGTGGGGLELVEIDGYVVKVRLTGPAAG----VMTVRVALTQKLR 211

Query: 178 HFVPEVKDIR 187
             +P +  ++
Sbjct: 212 ETIPSIGAVQ 221


>gi|18416645|ref|NP_567735.1| NFU3; structural molecule [Arabidopsis thaliana]
 gi|75147908|sp|Q84RQ7|NIFU3_ARATH RecName: Full=NifU-like protein 3, chloroplastic; Short=AtCNfu3;
           Short=AtCnfU-IVa; Flags: Precursor
 gi|28207820|emb|CAD55560.1| NFU3 protein [Arabidopsis thaliana]
 gi|88196759|gb|ABD43022.1| At4g25910 [Arabidopsis thaliana]
 gi|222423670|dbj|BAH19802.1| AT4G25910 [Arabidopsis thaliana]
 gi|332659732|gb|AEE85132.1| NifU-like protein 3 [Arabidopsis thaliana]
          Length = 236

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + 
Sbjct: 83  PLTEENVERVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESR 142

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 143 LRDKIPEIMSVEQ 155



 Score = 37.1 bits (84), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 26/70 (37%), Gaps = 4/70 (5%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++VL           GG +        +V + + G  +G      T++  +   L 
Sbjct: 168 DENIEKVLSELRPYLSGTGGGGLELVEIDGYVVKVRLTGPAAG----VMTVRVALTQKLR 223

Query: 178 HFVPEVKDIR 187
             +P +  ++
Sbjct: 224 ETIPSIGAVQ 233


>gi|317121652|ref|YP_004101655.1| nitrogen-fixing NifU domain protein [Thermaerobacter marianensis
           DSM 12885]
 gi|315591632|gb|ADU50928.1| nitrogen-fixing NifU domain protein [Thermaerobacter marianensis
           DSM 12885]
          Length = 73

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           ++ + E     +RPA+  DGGDI      +  +V + + GAC GCP +  TLK G+  IL
Sbjct: 1   MRELVEQALESIRPAIQMDGGDIELVDVDENGVVRVRLIGACVGCPMSIMTLKAGIERIL 60

Query: 177 NHFVPEVKDIRTV 189
              VP V D+  V
Sbjct: 61  RERVPGVTDVEAV 73


>gi|57651628|ref|YP_185809.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus
           COL]
 gi|57285814|gb|AAW37908.1| NifU domain protein [Staphylococcus aureus subsp. aureus COL]
          Length = 73

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 38/65 (58%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  VP V 
Sbjct: 8   VIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVI 67

Query: 185 DIRTV 189
           ++  V
Sbjct: 68  EVEQV 72


>gi|33860975|ref|NP_892536.1| NifU-like protein [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|33639707|emb|CAE18877.1| NifU-like protein [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
          Length = 81

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   
Sbjct: 7   PLTNENVETVLDELRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMGIERK 66

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 67  LKEMIPEISEVVQV 80


>gi|116073290|ref|ZP_01470552.1| NifU-like protein [Synechococcus sp. RS9916]
 gi|116068595|gb|EAU74347.1| NifU-like protein [Synechococcus sp. RS9916]
          Length = 81

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMREAIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|260436644|ref|ZP_05790614.1| NifU domain protein [Synechococcus sp. WH 8109]
 gi|260414518|gb|EEX07814.1| NifU domain protein [Synechococcus sp. WH 8109]
          Length = 76

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 9   EKVLDELRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKMRESIPE 68

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 69  VSEVVQV 75


>gi|33239869|ref|NP_874811.1| NifU-like protein [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237395|gb|AAP99463.1| Thioredoxin family protein [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 81

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   L   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEIVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKLCEMIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVIQV 80


>gi|302792717|ref|XP_002978124.1| hypothetical protein SELMODRAFT_108525 [Selaginella moellendorffii]
 gi|300154145|gb|EFJ20781.1| hypothetical protein SELMODRAFT_108525 [Selaginella moellendorffii]
          Length = 185

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 42/85 (49%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSA 164
                  +   A+ +   E++ + VRP +  DGG++  +     +V L ++GAC  CPS+
Sbjct: 23  TQETAATDDGLALTEENVEMVLDEVRPYLMSDGGNVALEEIDGLVVKLKLQGACGSCPSS 82

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
             T+K G+   L   +PE+  +  V
Sbjct: 83  LMTMKMGIEARLKEKIPEIIGVEQV 107


>gi|154343762|ref|XP_001567825.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134065159|emb|CAM40585.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 431

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDN 127
            DW  L+  V  ++ +H  SG+P      +     +          DS +V  IKE++  
Sbjct: 222 TDWSELKFHVSALLTDHICSGNPH-----VDPNAPNPHADTVAEAGDSEIVLMIKELVAT 276

Query: 128 RVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
            +RP +  DGGD+ F G+    G + + + GAC  C ++   L   +     H++PEVK 
Sbjct: 277 TIRPQLQEDGGDLRFVGFDPVLGDMRVELLGACRTCKNSKTALVDLIERTTRHWIPEVKA 336

Query: 186 IRTV 189
           ++ V
Sbjct: 337 VKEV 340



 Score = 40.9 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 36/118 (30%), Gaps = 3/118 (2%)

Query: 2   FIQTEDTPNPATLKFIPGQV-VLVE--GAIHFSNAKEAEISPLASRIFSIPGIASVYFGY 58
           F++ + TPN A  KF    +  L      + F+           + + ++P +  V  G 
Sbjct: 49  FVRFQPTPNDACYKFYVDHMQFLPPHAHTMLFNRTNSYLSPLAHALLEALPMVEEVTVGA 108

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
            F+TV + +            M        +           +     + D +  D  
Sbjct: 109 SFVTVKRVEVADTEAAARYFAMTFHGVQQSNEADEAAAAARSQALQQHAADVMNEDCE 166


>gi|282875569|ref|ZP_06284440.1| NifU-like protein [Staphylococcus epidermidis SK135]
 gi|281295596|gb|EFA88119.1| NifU-like protein [Staphylococcus epidermidis SK135]
          Length = 80

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +S +  ++ EV+  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENSTMFDQVAEVI-ERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|168012112|ref|XP_001758746.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689883|gb|EDQ76252.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 153

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 40/74 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E++ + VRP +  DGG++        +V L ++GAC  CPS++ T++ G+   
Sbjct: 2   ELTEENVELVLDEVRPYLISDGGNVALHEIDGLVVKLKLQGACGSCPSSTMTMRMGIERR 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+  +  +
Sbjct: 62  LIERIPEIVAVEQI 75



 Score = 37.9 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 31/83 (37%), Gaps = 5/83 (6%)

Query: 106 GSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSA 164
                 E+  A+ +   E +   +RP +   GG  +        +V + + G      ++
Sbjct: 73  EQIMDEETGLALTEENVEAVLGEIRPYLVGTGGGELELVKIDGPVVKVRLGGP----AAS 128

Query: 165 SETLKYGVANILNHFVPEVKDIR 187
             T++  V   L   +P +  ++
Sbjct: 129 VMTVRVAVTQKLREKIPMIAAVQ 151


>gi|120554445|ref|YP_958796.1| HesB/YadR/YfhF-family protein [Marinobacter aquaeolei VT8]
 gi|120324294|gb|ABM18609.1| HesB/YadR/YfhF-family protein [Marinobacter aquaeolei VT8]
          Length = 195

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 3/116 (2%)

Query: 75  PPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVA 134
              +  + + ++        G L     +          D+ + +R+  VL + + P +A
Sbjct: 70  HNSVPFLEDAYVDYSKDQMGGQLTIKAPNAKVPQVA--DDAPLPERVNYVLASEINPNLA 127

Query: 135 RDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             GGD+      D  V +    G C GC + S TLK GV   L   VPE+  +R V
Sbjct: 128 AHGGDVSLVEIVDESVAVLRFGGGCQGCSAVSLTLKQGVEKTLKERVPEISAVRDV 183


>gi|186681985|ref|YP_001865181.1| NifU domain-containing protein [Nostoc punctiforme PCC 73102]
 gi|186464437|gb|ACC80238.1| nitrogen-fixing NifU domain protein [Nostoc punctiforme PCC 73102]
          Length = 76

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS++ TL+ G+   L   +PE
Sbjct: 9   ETVLDEMRPYLMSDGGNVELVELDGPVVKLRLQGACGSCPSSAMTLRMGIERRLKEMIPE 68

Query: 183 VKDIRTV 189
           + +I  V
Sbjct: 69  IAEIEQV 75


>gi|116072270|ref|ZP_01469537.1| NifU-like protein [Synechococcus sp. BL107]
 gi|116064792|gb|EAU70551.1| NifU-like protein [Synechococcus sp. BL107]
          Length = 81

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  ETVLDELRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKMRESIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|57864812|gb|AAW56987.1| nitrogen fixation protein U [Cyanothece sp. ATCC 51142]
          Length = 285

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 2/115 (1%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
             L  I +                 ++    S     ++   +  I++VL+  +RP +A+
Sbjct: 172 SCLADIDDMIADILQEKATAVAVATEVVKAKSETKPLTNLQKITLIQQVLEEEIRPFLAK 231

Query: 136 DGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
           DGGD+        +V ++++GAC  C S++ TLK G+   L   V PE+  +  V
Sbjct: 232 DGGDLELIDIEGDLVKVTLQGACGSCASSTATLKGGIEARLKERVSPELT-VIAV 285


>gi|110738975|dbj|BAF01408.1| nitrogen fixation like protein [Arabidopsis thaliana]
 gi|227206276|dbj|BAH57193.1| AT4G25910 [Arabidopsis thaliana]
          Length = 155

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP++  DGG++        +V L ++GAC  CPS+S TLK G+ + 
Sbjct: 2   PLTEENVERVLDEVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESR 61

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 62  LRDKIPEIMSVEQ 74



 Score = 36.7 bits (83), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 26/70 (37%), Gaps = 4/70 (5%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
            + I++VL           GG +        +V + + G  +G      T++  +   L 
Sbjct: 87  DENIEKVLSELRPYLSGTGGGGLELVEIDGYVVKVRLTGPAAG----VMTVRVALTQKLR 142

Query: 178 HFVPEVKDIR 187
             +P +  ++
Sbjct: 143 ETIPSIGAVQ 152


>gi|78778799|ref|YP_396911.1| NifU-like protein [Prochlorococcus marinus str. MIT 9312]
 gi|123968006|ref|YP_001008864.1| NifU-like protein [Prochlorococcus marinus str. AS9601]
 gi|126695776|ref|YP_001090662.1| NifU-like protein [Prochlorococcus marinus str. MIT 9301]
 gi|157412831|ref|YP_001483697.1| NifU-like protein [Prochlorococcus marinus str. MIT 9215]
 gi|254525524|ref|ZP_05137576.1| NifU domain protein [Prochlorococcus marinus str. MIT 9202]
 gi|78712298|gb|ABB49475.1| NifU-like protein [Prochlorococcus marinus str. MIT 9312]
 gi|91070321|gb|ABE11238.1| NifU-like protein [uncultured Prochlorococcus marinus clone
           HF10-88F10]
 gi|123198116|gb|ABM69757.1| NifU-like protein [Prochlorococcus marinus str. AS9601]
 gi|126542819|gb|ABO17061.1| NifU-like protein [Prochlorococcus marinus str. MIT 9301]
 gi|157387406|gb|ABV50111.1| NifU-like protein [Prochlorococcus marinus str. MIT 9215]
 gi|221536948|gb|EEE39401.1| NifU domain protein [Prochlorococcus marinus str. MIT 9202]
          Length = 81

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+ S   + +++VLD  +RP +  DGG++        IV + ++GAC  CPS++ TLK G
Sbjct: 4   ETLSLTNENVEKVLDE-LRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMG 62

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +PE+ ++  V
Sbjct: 63  IERKLKEMIPEISEVVQV 80


>gi|119511776|ref|ZP_01630878.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
 gi|119463549|gb|EAW44484.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
          Length = 76

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   
Sbjct: 2   ELTTENVETVLDEMRPYLMSDGGNVELVELDGPIVKLRLQGACGSCPSSAMTLRMGIERR 61

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ +I  V
Sbjct: 62  LKEMIPEIAEIEQV 75


>gi|172035474|ref|YP_001801975.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142]
 gi|171696928|gb|ACB49909.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142]
          Length = 293

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 2/115 (1%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
             L  I +                 ++    S     ++   +  I++VL+  +RP +A+
Sbjct: 180 SCLADIDDMIADILQEKATAVAVATEVVKAKSETKPLTNLQKITLIQQVLEEEIRPFLAK 239

Query: 136 DGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
           DGGD+        +V ++++GAC  C S++ TLK G+   L   V PE+  +  V
Sbjct: 240 DGGDLELIDIEGDLVKVTLQGACGSCASSTATLKGGIEARLKERVSPELT-VIAV 293


>gi|123965714|ref|YP_001010795.1| NifU-like protein [Prochlorococcus marinus str. MIT 9515]
 gi|123200080|gb|ABM71688.1| NifU-like protein [Prochlorococcus marinus str. MIT 9515]
          Length = 81

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   
Sbjct: 7   PLTNENVEKVLDELRPFLISDGGNVEIAEIDGPIVKVRLQGACGSCPSSTMTLKMGIERK 66

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ ++  V
Sbjct: 67  LKEMIPEISEVVQV 80


>gi|302342797|ref|YP_003807326.1| nitrogen-fixing NifU domain protein [Desulfarculus baarsii DSM
           2075]
 gi|301639410|gb|ADK84732.1| nitrogen-fixing NifU domain protein [Desulfarculus baarsii DSM
           2075]
          Length = 73

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + QR++E LD  +RPA+ +DGGD+      D  +V + ++GAC GCP +  TLK G+  +
Sbjct: 1   MKQRVQEALDK-IRPALQKDGGDVKLVDVSDDGVVKVQLQGACHGCPMSQMTLKMGIEKV 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VPEV+ + +V
Sbjct: 60  LKQNVPEVQKVESV 73


>gi|77919925|ref|YP_357740.1| NifU-like protein [Pelobacter carbinolicus DSM 2380]
 gi|77546008|gb|ABA89570.1| NifU-like protein [Pelobacter carbinolicus DSM 2380]
          Length = 103

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 96  GLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSM 154
                +LDD G     E    ++ +I        RP++  DGGD+      +  +V + +
Sbjct: 15  NAATTELDDKGRCQMKEQVLEILDKI--------RPSLQADGGDVELVDISEDGVVKVRL 66

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +GAC  CP ++ TLK G+   L   VP VK++ 
Sbjct: 67  KGACGSCPMSTMTLKMGIERTLKAQVPGVKEVV 99


>gi|149036648|gb|EDL91266.1| histone cell cycle regulation defective interacting protein 5
           (predicted), isoform CRA_b [Rattus norvegicus]
          Length = 79

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 45/65 (69%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +    RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G+ N+L  ++PEV+
Sbjct: 1   MSCGRRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVE 60

Query: 185 DIRTV 189
            +  V
Sbjct: 61  GVEQV 65


>gi|37522446|ref|NP_925823.1| hypothetical protein gsl2877 [Gloeobacter violaceus PCC 7421]
 gi|35213447|dbj|BAC90818.1| gsl2877 [Gloeobacter violaceus PCC 7421]
          Length = 85

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 42/83 (50%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
              F +    + +   E++ + +RP +  DGG++        IV L ++GAC  CPS++ 
Sbjct: 2   RETFEDEVLELNRDNVELVLDELRPYLMSDGGNVELVEIEGPIVKLRLQGACGSCPSSTY 61

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK G+   +   +P V ++  V
Sbjct: 62  TLKLGIERRMRELIPAVAEVEQV 84


>gi|148238937|ref|YP_001224324.1| NifU-like protein [Synechococcus sp. WH 7803]
 gi|147847476|emb|CAK23027.1| NifU-like protein [Synechococcus sp. WH 7803]
          Length = 81

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
               +     E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+
Sbjct: 4   ETMPLTSENVEKVLDELRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGI 63

Query: 173 ANILNHFVPEVKDIRTV 189
              +   +PEV ++  V
Sbjct: 64  ERKMREAIPEVSEVVQV 80


>gi|51892183|ref|YP_074874.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855872|dbj|BAD40030.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 77

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E   + +RPA+  DGG++      DG+  + M GAC GCP ++ TLK G+   +   VPE
Sbjct: 11  ERALDLIRPAIRMDGGEVELVAVEDGVARIRMVGACGGCPMSTMTLKMGIERAVRQQVPE 70

Query: 183 VKDIRTV 189
           ++ +  V
Sbjct: 71  IRAVEAV 77


>gi|258514732|ref|YP_003190954.1| nitrogen-fixing NifU domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778437|gb|ACV62331.1| nitrogen-fixing NifU domain protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 73

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++KEVL   VRP + RDGGD+         IV + ++GACSGCP A  TLK G+  +
Sbjct: 1   MHEKVKEVLGK-VRPYLQRDGGDVELVDITADGIVRVKLKGACSGCPGALITLKQGIERV 59

Query: 176 LNHFVPEVKDIRT 188
           L   +PEVK +  
Sbjct: 60  LKQEIPEVKGVEQ 72


>gi|163784585|ref|ZP_02179431.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880146|gb|EDP73804.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 89

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +  ++RPA+  DGGD+       DG V++ + GACSGC  +  TLK G+   L   +P
Sbjct: 15  EEVLEKIRPALRFDGGDVELVDIGEDGTVYVRLMGACSGCAMSLMTLKGGIEQRLKQEIP 74

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 75  EVKEVVAV 82


>gi|70727016|ref|YP_253930.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus
           JCSC1435]
 gi|223043066|ref|ZP_03613114.1| nitrogen fixation protein NifU [Staphylococcus capitis SK14]
 gi|228474235|ref|ZP_04058970.1| nitrogen fixation protein NifU [Staphylococcus hominis SK119]
 gi|239636541|ref|ZP_04677543.1| nitrogen fixation protein NifU [Staphylococcus warneri L37603]
 gi|242373103|ref|ZP_04818677.1| nitrogen fixation protein NifU [Staphylococcus epidermidis
           M23864:W1]
 gi|289551248|ref|YP_003472152.1| nitrogen-fixing NifU domain protein [Staphylococcus lugdunensis
           HKU09-01]
 gi|314933148|ref|ZP_07840513.1| NifU domain protein [Staphylococcus caprae C87]
 gi|314936844|ref|ZP_07844191.1| NifU domain protein [Staphylococcus hominis subsp. hominis C80]
 gi|315658750|ref|ZP_07911619.1| NifU domain protein [Staphylococcus lugdunensis M23590]
 gi|68447740|dbj|BAE05324.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus
           JCSC1435]
 gi|222443920|gb|EEE50017.1| nitrogen fixation protein NifU [Staphylococcus capitis SK14]
 gi|228271594|gb|EEK12941.1| nitrogen fixation protein NifU [Staphylococcus hominis SK119]
 gi|239597896|gb|EEQ80391.1| nitrogen fixation protein NifU [Staphylococcus warneri L37603]
 gi|242349257|gb|EES40858.1| nitrogen fixation protein NifU [Staphylococcus epidermidis
           M23864:W1]
 gi|289180780|gb|ADC88025.1| nitrogen-fixing NifU domain protein [Staphylococcus lugdunensis
           HKU09-01]
 gi|313653298|gb|EFS17055.1| NifU domain protein [Staphylococcus caprae C87]
 gi|313655463|gb|EFS19208.1| NifU domain protein [Staphylococcus hominis subsp. hominis C80]
 gi|315496205|gb|EFU84531.1| NifU domain protein [Staphylococcus lugdunensis M23590]
 gi|330684919|gb|EGG96601.1| NifU-like protein [Staphylococcus epidermidis VCU121]
          Length = 80

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            ++ +  ++ EV+  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENATMFDQVAEVI-ERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|288553995|ref|YP_003425930.1| hypothetical protein BpOF4_04870 [Bacillus pseudofirmus OF4]
 gi|288545155|gb|ADC49038.1| hypothetical protein BpOF4_04870 [Bacillus pseudofirmus OF4]
          Length = 79

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           + +V++++EVLD  +RP + RDGGD+      DGIV + + GAC  CPS++ TLK G+  
Sbjct: 5   TEMVEQVQEVLDK-LRPFLLRDGGDVELVEVEDGIVKVRLLGACGSCPSSTITLKAGIER 63

Query: 175 ILNHFVPEVKDIRTV 189
            L   VP VK+I  V
Sbjct: 64  ALLEEVPGVKEIEQV 78


>gi|225448154|ref|XP_002264418.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297739542|emb|CBI29724.3| unnamed protein product [Vitis vinifera]
          Length = 227

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS+  T+K G+   L   +PE
Sbjct: 83  ESVLDEIRPYLISDGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLMEKIPE 142

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 143 IVAVEPI 149



 Score = 37.5 bits (85), Expect = 0.98,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 35/92 (38%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPA-VARDGGDIVFKGYRDGIVFLSMR 155
               ++  +      E+   + +   E +   +RP  V   GG +   G  + IV + + 
Sbjct: 138 EKIPEIVAVEPIADEETGLELNEENIEKVLEEIRPYLVGAAGGSLELVGIDEPIVKVRIT 197

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  V   L   +P +  ++
Sbjct: 198 GPAAG----VMTVRVAVTQKLREKIPAIAAVQ 225


>gi|323699074|ref|ZP_08110986.1| nitrogen-fixing NifU domain protein [Desulfovibrio sp. ND132]
 gi|323459006|gb|EGB14871.1| nitrogen-fixing NifU domain protein [Desulfovibrio desulfuricans
           ND132]
          Length = 73

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           +Q+  E + ++VRP +  DGGD+      D  IV + + GAC GCP +  TLK G+  I+
Sbjct: 1   MQKKVEAVLDKVRPMLQGDGGDVELVEVTDNGIVKVRLTGACKGCPMSQMTLKNGIERII 60

Query: 177 NHFVPEVKDIRTV 189
              +PEVK +  V
Sbjct: 61  LKEIPEVKGVEAV 73


>gi|194319991|pdb|2Z51|A Chain A, Crystal Structure Of Arabidopsis Cnfu Involved In Iron-
           Sulfur Cluster Biosynthesis
          Length = 154

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 38/73 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + +RP +  DGG++        +V + ++GAC  CPS++ T+K G+   
Sbjct: 3   PLTEENVESVLDEIRPYLMSDGGNVALHEIDGNVVRVKLQGACGSCPSSTMTMKMGIERR 62

Query: 176 LNHFVPEVKDIRT 188
           L   +PE+  +  
Sbjct: 63  LMEKIPEIVAVEA 75



 Score = 34.4 bits (77), Expect = 8.0,   Method: Composition-based stats.
 Identities = 21/160 (13%), Positives = 47/160 (29%), Gaps = 15/160 (9%)

Query: 32  NAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDW--EHLRPPVLGMIMEHFISGD 89
           N +          +     +A      + + V               +   I    +   
Sbjct: 8   NVESVLDEIRPYLMSDGGNVALHEIDGNVVRVKLQGACGSCPSSTMTMKMGIERRLMEKI 67

Query: 90  PIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI 149
           P I    +  +  ++ G     E+   V++ I+  L            G +      D I
Sbjct: 68  PEIV--AVEALPDEETGLELNEENIEKVLEEIRPYLIGTA-------DGSLDLVEIEDPI 118

Query: 150 VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           V + + G  +G      T++  V   L   +P +  ++ +
Sbjct: 119 VKIRITGPAAG----VMTVRVAVTQKLREKIPSIAAVQLI 154


>gi|301168132|emb|CBW27720.1| conserved hypothetical protein [Bacteriovorax marinus SJ]
          Length = 85

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 45/72 (62%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++++I+ + D +VRPA+A  GG++      +G +F+ + G C GC S+S TLK G+  ++
Sbjct: 1   MIRKIENLFDEQVRPALAAHGGNVEVIDIDNGKLFVKLSGGCQGCSSSSATLKDGIERMV 60

Query: 177 NHFVPEVKDIRT 188
               PE++++  
Sbjct: 61  KQNFPEIEEVVD 72


>gi|78185152|ref|YP_377587.1| NifU-like protein [Synechococcus sp. CC9902]
 gi|78169446|gb|ABB26543.1| NifU-like protein [Synechococcus sp. CC9902]
          Length = 81

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVEIDGPIVKVRLQGACGSCPSSTMTLKMGIERKMRESIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|313902071|ref|ZP_07835484.1| nitrogen-fixing NifU domain protein [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467680|gb|EFR63181.1| nitrogen-fixing NifU domain protein [Thermaerobacter subterraneus
           DSM 13965]
          Length = 73

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 127 NRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
             +RPA+  DGGDI      +  +V + + GAC GCP +  TLK G+  IL   VP V D
Sbjct: 10  ESIRPAIQMDGGDIELVDVDENGVVRVRLIGACVGCPMSIMTLKAGIERILRERVPGVTD 69

Query: 186 IRTV 189
           +  V
Sbjct: 70  VEAV 73


>gi|225848086|ref|YP_002728249.1| hypothetical protein SULAZ_0254 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643275|gb|ACN98325.1| conserved domain protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 79

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + ++  E +  +VRP +  DGGD+      +   V++ + G+CSGC  +  TLK GV   
Sbjct: 3   IDRQKVEEVLEQVRPYLRFDGGDVELVDVSEDGTVYVRLMGSCSGCAMSLWTLKGGVEAR 62

Query: 176 LNHFVPEVKDIRTV 189
           L   +PEVK++  V
Sbjct: 63  LKQAIPEVKEVVAV 76


>gi|85859635|ref|YP_461837.1| nifU-like domain-containing protein [Syntrophus aciditrophicus SB]
 gi|85722726|gb|ABC77669.1| nifU-like domain protein [Syntrophus aciditrophicus SB]
          Length = 73

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           +  +++E +D  VRP +  DGGD+      +  +V + + GAC GC  +  TLK G+   
Sbjct: 1   MKDKVQEAIDQ-VRPGLQADGGDVELVDVTEDGVVKVRLVGACRGCAMSQMTLKMGIERF 59

Query: 176 LNHFVPEVKDIRTV 189
           L   +PEVK++  V
Sbjct: 60  LKERIPEVKEVVAV 73


>gi|90655381|gb|ABD96222.1| NifU-like protein [uncultured marine type-A Synechococcus GOM 3M9]
          Length = 81

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKMREAIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|27467548|ref|NP_764185.1| nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC
           12228]
 gi|57866465|ref|YP_188114.1| NifU domain-containing protein [Staphylococcus epidermidis RP62A]
 gi|242242226|ref|ZP_04796671.1| NifU family protein [Staphylococcus epidermidis W23144]
 gi|251810309|ref|ZP_04824782.1| NifU family protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|293368312|ref|ZP_06614940.1| NifU domain protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|27315092|gb|AAO04227.1|AE016746_17 nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC
           12228]
 gi|57637123|gb|AAW53911.1| NifU domain protein [Staphylococcus epidermidis RP62A]
 gi|242234321|gb|EES36633.1| NifU family protein [Staphylococcus epidermidis W23144]
 gi|251806191|gb|EES58848.1| NifU family protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|291317559|gb|EFE57977.1| NifU domain protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319401786|gb|EFV89994.1| nifU-like domain protein [Staphylococcus epidermidis FRI909]
 gi|329726827|gb|EGG63287.1| NifU-like protein [Staphylococcus epidermidis VCU144]
 gi|329736812|gb|EGG73077.1| NifU-like protein [Staphylococcus epidermidis VCU028]
 gi|329737604|gb|EGG73850.1| NifU-like protein [Staphylococcus epidermidis VCU045]
          Length = 80

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  +  ++ EV+  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENPTMFDQVAEVI-ERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|62734078|gb|AAX96187.1| Similar to seven transmembrane protein Mlo4 [Oryza sativa Japonica
           Group]
          Length = 980

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 576 EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 635

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 636 IVAVEPI 642



 Score = 39.4 bits (90), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP ++  GG  + F    + IV + + 
Sbjct: 631 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLSGTGGGELEFVAIEEPIVKVRLT 690

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 691 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 718


>gi|167041235|gb|ABZ05992.1| putative HesB-like domain protein [uncultured marine microorganism
           HF4000_001N02]
          Length = 189

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             + Q++ +++   + PAVA  GG +   G  +    ++  G C GC  A  TLK GV  
Sbjct: 104 DELSQKVADIITQEINPAVASHGGVVELVGVDEDKAIIAFGGGCQGCGMADVTLKQGVEV 163

Query: 175 ILNHFVPEVKDIRT 188
           ++   VPE+ ++  
Sbjct: 164 MIKDKVPEIIEVID 177


>gi|88809237|ref|ZP_01124746.1| NifU-like protein [Synechococcus sp. WH 7805]
 gi|88787179|gb|EAR18337.1| NifU-like protein [Synechococcus sp. WH 7805]
          Length = 81

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRETIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|58177342|pdb|1XHJ|A Chain A, Solution Structure Of The Staphylococcus Epidermidis
           Protein Se0630. Northest Structural Genomics Consortium
           Target Ser8
          Length = 88

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  +  ++ EV+  R+RP + RDGGD       DGIV L + GAC  CPS++ TLK G+
Sbjct: 4   ENPTMFDQVAEVI-ERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGI 62

Query: 173 ANILNHFVPEVKDIRTV 189
              L+  VP V ++  V
Sbjct: 63  ERALHEEVPGVIEVEQV 79


>gi|303245787|ref|ZP_07332070.1| nitrogen-fixing NifU domain protein [Desulfovibrio fructosovorans
           JJ]
 gi|302493050|gb|EFL52915.1| nitrogen-fixing NifU domain protein [Desulfovibrio fructosovorans
           JJ]
          Length = 73

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           +Q   E    ++RP++  DGGD+      DG IV + + GAC GCP +  TLK G+  IL
Sbjct: 1   MQEKVEAALAKIRPSLQADGGDVELVEVTDGGIVKVRLTGACKGCPMSQMTLKNGIERIL 60

Query: 177 NHFVPEVKDIRTV 189
              VP VK +  V
Sbjct: 61  MQSVPGVKAVEAV 73


>gi|302766397|ref|XP_002966619.1| hypothetical protein SELMODRAFT_230831 [Selaginella moellendorffii]
 gi|300166039|gb|EFJ32646.1| hypothetical protein SELMODRAFT_230831 [Selaginella moellendorffii]
          Length = 144

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 37/66 (56%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           ++ + VRP +  DGG++  +     +V L ++GAC  CPS+  T+K G+   L   +PE+
Sbjct: 1   MVLDEVRPYLMSDGGNVALEEIDGLVVKLKLQGACGSCPSSLMTMKMGIEARLKEKIPEI 60

Query: 184 KDIRTV 189
             +  V
Sbjct: 61  IGVEQV 66


>gi|229916513|ref|YP_002885159.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b]
 gi|229467942|gb|ACQ69714.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b]
          Length = 75

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +  +++EVLD  +RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+   
Sbjct: 2   EMFDQVQEVLDK-LRPFLLRDGGDVELVDVEEGIVKLRLMGACGSCPSSTITLKAGIERA 60

Query: 176 LNHFVPEVKDIRTV 189
           L   VP + ++  V
Sbjct: 61  LIEEVPGIVEVEQV 74


>gi|224126131|ref|XP_002329668.1| predicted protein [Populus trichocarpa]
 gi|222870549|gb|EEF07680.1| predicted protein [Populus trichocarpa]
          Length = 149

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   
Sbjct: 6   PLTEENVEKVLDEVRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETK 65

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ D+  +
Sbjct: 66  LRDKIPEIMDVEQI 79


>gi|258405531|ref|YP_003198273.1| nitrogen-fixing NifU domain-containing protein [Desulfohalobium
           retbaense DSM 5692]
 gi|257797758|gb|ACV68695.1| nitrogen-fixing NifU domain protein [Desulfohalobium retbaense DSM
           5692]
          Length = 73

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           + ++I+  LD  VRP +  DGGDI       + IV + ++GAC GCP +  TLK GV  +
Sbjct: 1   MREKIEAALDK-VRPVLQADGGDIELVEITDNNIVRVRLQGACKGCPMSQMTLKNGVERV 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VPE+K + +V
Sbjct: 60  LLKEVPEIKGVESV 73


>gi|237756555|ref|ZP_04585079.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691283|gb|EEP60367.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 78

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           + ++  E +  +VRP +  DGGD+       DG V++ + GACSGC  +  TLK GV   
Sbjct: 3   IDRQKVEEVLEQVRPYLRFDGGDVELVDVGEDGTVYVRLMGACSGCHMSLWTLKGGVEAR 62

Query: 176 LNHFVPEVKDIRTV 189
           L   +PEVK++  V
Sbjct: 63  LKQAIPEVKEVVAV 76


>gi|226495405|ref|NP_001148901.1| NFU3 [Zea mays]
 gi|195623070|gb|ACG33365.1| NFU3 [Zea mays]
          Length = 226

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 81  EMVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 140

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 141 IVAVEPI 147



 Score = 39.8 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP +A  GG  + F    + IV + + 
Sbjct: 136 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLAGTGGGELEFVTIEEPIVKVRLT 195

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 196 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 223


>gi|226225813|ref|YP_002759919.1| hypothetical protein GAU_0407 [Gemmatimonas aurantiaca T-27]
 gi|226089004|dbj|BAH37449.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 296

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 32/66 (48%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
            +   +RP     GGD+         VF+ + G+C+GC  +S TL+ G+   L   VPE+
Sbjct: 108 RVVENLRPYTQSHGGDVTLVDVTSDTVFVKLSGSCNGCSMSSVTLRNGIEEALKEQVPEI 167

Query: 184 KDIRTV 189
             I  V
Sbjct: 168 TRIEVV 173


>gi|33866219|ref|NP_897778.1| NifU-like protein [Synechococcus sp. WH 8102]
 gi|78212340|ref|YP_381119.1| NifU-like protein [Synechococcus sp. CC9605]
 gi|33639194|emb|CAE08202.1| NifU-like protein [Synechococcus sp. WH 8102]
 gi|78196799|gb|ABB34564.1| NifU-like protein [Synechococcus sp. CC9605]
          Length = 81

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        IV + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKMRESIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|238014236|gb|ACR38153.1| unknown [Zea mays]
          Length = 226

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 81  EMVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 140

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 141 IVAVEPI 147



 Score = 39.8 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP +A  GG  + F    + IV + + 
Sbjct: 136 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLAGTGGGELEFVTIEEPIVKVRLT 195

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 196 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 223


>gi|298492022|ref|YP_003722199.1| nitrogen-fixing NifU domain-containing protein ['Nostoc azollae'
           0708]
 gi|298233940|gb|ADI65076.1| nitrogen-fixing NifU domain protein ['Nostoc azollae' 0708]
          Length = 79

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + +RP +  DGG++        IV L ++GAC  CPS++ TL+ G+   
Sbjct: 5   ELTLENVETVLDEMRPYLMSDGGNVEVVELDGPIVKLRLQGACGSCPSSAMTLRMGIERR 64

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ +I  V
Sbjct: 65  LKELIPEIAEIEQV 78


>gi|224126127|ref|XP_002329667.1| predicted protein [Populus trichocarpa]
 gi|222870548|gb|EEF07679.1| predicted protein [Populus trichocarpa]
          Length = 167

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP + RDGG++        +V L ++GAC  CPS+S TLK G+   
Sbjct: 15  PLTEENVEKVLDEVRPGLMRDGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIETK 74

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ D+  +
Sbjct: 75  LRDKIPEIMDVEQI 88



 Score = 37.9 bits (86), Expect = 0.79,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 34/87 (39%), Gaps = 5/87 (5%)

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCP 162
           D+      E+   + +   E     +RP +A  GG +       D +V + + G  +G  
Sbjct: 84  DVEQIMDTETGLELNEENVEKALAEIRPYLAGTGGGVLELVQINDYVVKVRLSGPAAG-- 141

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
               T++  +   L   +P +  ++ +
Sbjct: 142 --VMTVRVALTQKLRETIPAIAAVQLI 166


>gi|193215039|ref|YP_001996238.1| nitrogen-fixing NifU domain-containing protein [Chloroherpeton
           thalassium ATCC 35110]
 gi|193088516|gb|ACF13791.1| nitrogen-fixing NifU domain protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 95

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMR 155
               + + +    ++  +  +  R+ E L++ +RP +  DGGD    G   + +V L + 
Sbjct: 2   SAKNEGNPVQDKQYLPGNDPIYARVTEALNS-IRPYLQADGGDCELVGITDEQVVDLRLV 60

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           GAC  CP ++ TL+ GV   +   VPE+  +  
Sbjct: 61  GACGSCPMSAMTLRAGVEQAIKRAVPEIVRVEA 93


>gi|152977236|ref|YP_001376753.1| NifU domain-containing protein [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025988|gb|ABS23758.1| nitrogen-fixing NifU domain protein [Bacillus cytotoxicus NVH
           391-98]
          Length = 78

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  + +++ EVLD  +RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+
Sbjct: 2   ENPNMQEQVLEVLDK-LRPFLLRDGGDVELVDIEDGIVKLRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP V ++  V
Sbjct: 61  ERALLEEVPGVIEVEQV 77


>gi|84997065|ref|XP_953254.1| hypothetical protein [Theileria annulata strain Ankara]
 gi|65304250|emb|CAI76629.1| hypothetical protein, conserved [Theileria annulata]
          Length = 179

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 69/165 (41%), Gaps = 3/165 (1%)

Query: 27  AIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFI 86
           +++F        +PL   +      +S+            Q    ++       I  +++
Sbjct: 2   SLYFLKDLLKRTNPLLRSLIPY-HTSSIILSDSICISNLTQNPLNYINFKYNNKINRNYL 60

Query: 87  SGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
           +   + +           +    + + +   V+ IK ++D R+RP + +DGGD+ F  Y 
Sbjct: 61  TASSLNYPNRSFSTVTKAVVPETYSDEEIETVESIKLLIDKRIRPVIQQDGGDVFFVSYD 120

Query: 147 DGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
                V++ + GAC GC  +  TLK+ +  +L H++ E+  +  V
Sbjct: 121 PSTGYVYVRLSGACVGCIQSDITLKHMIQGMLCHYLEEITAVYNV 165


>gi|294897644|ref|XP_002776034.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
 gi|239882510|gb|EER07850.1| HIRA-interacting protein, putative [Perkinsus marinus ATCC 50983]
          Length = 154

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/145 (26%), Positives = 71/145 (48%), Gaps = 8/145 (5%)

Query: 48  IPGIASVYFGYDFITVGK-DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMG 106
           I G+  V   +  + V K    DW  ++P V  ++   F               + +   
Sbjct: 1   IEGVERVVLTHHNVAVSKVSSIDWCFVKPKVESVLSNFFAVPGLQSVYRYALQFETEVEE 60

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
           +       + +++RI EVLD+R+RP +  DGGD+    + +    + + ++GAC+GCP +
Sbjct: 61  A-----EKAKLMERIAEVLDDRIRPVLQDDGGDVDVADFDEETGVLSVRLKGACAGCPMS 115

Query: 165 SETLKYGVANILNHFVPEVKDIRTV 189
           S TL++ + N+L   VPEVK +  +
Sbjct: 116 SVTLRFRIENMLVQSVPEVKKVINI 140


>gi|254786162|ref|YP_003073591.1| gluconate transport associated thioredoxin-like protein YhgI
           [Teredinibacter turnerae T7901]
 gi|259511746|sp|C5BJC0|NFUA_TERTT RecName: Full=Fe/S biogenesis protein nfuA
 gi|237684627|gb|ACR11891.1| putative gluconate transport associated thioredoxin-like protein
           YhgI [Teredinibacter turnerae T7901]
          Length = 194

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 48/142 (33%), Gaps = 12/142 (8%)

Query: 59  DFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD----------MGSG 108
                   + +       + G    +F        +    D   D               
Sbjct: 43  CIAYCRPGEAEEADHVMELSGF-NAYFEDRSVPFLDEAKVDYAPDKMGGQLTIRAPNSKM 101

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASET 167
             I  DS +  +I  VL N V P +A  GG++  +   D  +  L   G C GC +   T
Sbjct: 102 PKISDDSPIEDKINYVLYNEVNPGLASHGGNVSLERLTDDGMAILRFGGGCQGCSAVDMT 161

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK GV   L   +PE+  +R V
Sbjct: 162 LKQGVEKTLMERIPELAGVRDV 183


>gi|188996345|ref|YP_001930596.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931412|gb|ACD66042.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 79

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           + ++  E +  +VRP +  DGGD+       DG V++ + GACSGC  +  TLK GV   
Sbjct: 3   IDRQKVEEVLEQVRPYLRFDGGDVELVDVGEDGTVYVRLMGACSGCHMSLWTLKGGVETR 62

Query: 176 LNHFVPEVKDIRTV 189
           L   +PEVK++  +
Sbjct: 63  LKQAIPEVKEVVAI 76


>gi|332798963|ref|YP_004460462.1| nitrogen-fixing NifU domain-containing protein [Tepidanaerobacter
           sp. Re1]
 gi|332696698|gb|AEE91155.1| nitrogen-fixing NifU domain-containing protein [Tepidanaerobacter
           sp. Re1]
          Length = 74

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVANI 175
           ++   EV+ N++RP++  DGGD+      +  GIV + + GAC GCP A+ TLK G+   
Sbjct: 1   MKEKVEVVLNKIRPSLQADGGDVELVDVDEVAGIVKVRLTGACGGCPFATMTLKNGIEEA 60

Query: 176 LNHFVPEVKDIRTV 189
           L   +PEVK+++ V
Sbjct: 61  LKEEIPEVKEVQQV 74


>gi|30022992|ref|NP_834623.1| NifU protein [Bacillus cereus ATCC 14579]
 gi|30264992|ref|NP_847369.1| NifU domain-containing protein [Bacillus anthracis str. Ames]
 gi|42784132|ref|NP_981379.1| NifU domain-containing protein [Bacillus cereus ATCC 10987]
 gi|47530492|ref|YP_021841.1| NifU domain-containing protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47566983|ref|ZP_00237700.1| NifU protein-related protein [Bacillus cereus G9241]
 gi|49187811|ref|YP_031064.1| NifU domain-containing protein [Bacillus anthracis str. Sterne]
 gi|49481022|ref|YP_038969.1| NifU domain-containing protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52140580|ref|YP_086250.1| NifU domain-containing protein [Bacillus cereus E33L]
 gi|75758910|ref|ZP_00739021.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|118480036|ref|YP_897187.1| NifU-like domain-containing protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|163942665|ref|YP_001647549.1| NifU domain-containing protein [Bacillus weihenstephanensis KBAB4]
 gi|165870953|ref|ZP_02215605.1| nifU domain protein [Bacillus anthracis str. A0488]
 gi|167634861|ref|ZP_02393179.1| nifU domain protein [Bacillus anthracis str. A0442]
 gi|167639907|ref|ZP_02398175.1| nifU domain protein [Bacillus anthracis str. A0193]
 gi|170685656|ref|ZP_02876879.1| nifU domain protein [Bacillus anthracis str. A0465]
 gi|170706993|ref|ZP_02897450.1| nifU domain protein [Bacillus anthracis str. A0389]
 gi|177652329|ref|ZP_02934832.1| nifU domain protein [Bacillus anthracis str. A0174]
 gi|190567150|ref|ZP_03020065.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|196033148|ref|ZP_03100561.1| nifU domain protein [Bacillus cereus W]
 gi|196040592|ref|ZP_03107892.1| nifU domain protein [Bacillus cereus NVH0597-99]
 gi|196043939|ref|ZP_03111176.1| nifU domain protein [Bacillus cereus 03BB108]
 gi|206970391|ref|ZP_03231344.1| nifU domain protein [Bacillus cereus AH1134]
 gi|206976476|ref|ZP_03237383.1| nifU domain protein [Bacillus cereus H3081.97]
 gi|217962417|ref|YP_002340989.1| nifU domain protein [Bacillus cereus AH187]
 gi|218235090|ref|YP_002369752.1| nifU domain protein [Bacillus cereus B4264]
 gi|218900105|ref|YP_002448516.1| nifU domain protein [Bacillus cereus G9842]
 gi|218906144|ref|YP_002453978.1| nifU domain protein [Bacillus cereus AH820]
 gi|222098402|ref|YP_002532460.1| nitrogen-fixing nifu domain protein [Bacillus cereus Q1]
 gi|225866921|ref|YP_002752299.1| nifU domain protein [Bacillus cereus 03BB102]
 gi|227817723|ref|YP_002817732.1| nifU domain protein [Bacillus anthracis str. CDC 684]
 gi|228903455|ref|ZP_04067581.1| hypothetical protein bthur0014_46170 [Bacillus thuringiensis IBL
           4222]
 gi|228910790|ref|ZP_04074599.1| hypothetical protein bthur0013_49320 [Bacillus thuringiensis IBL
           200]
 gi|228917578|ref|ZP_04081122.1| hypothetical protein bthur0012_47840 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228923687|ref|ZP_04086965.1| hypothetical protein bthur0011_46620 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228929976|ref|ZP_04092987.1| hypothetical protein bthur0010_46580 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228936248|ref|ZP_04099047.1| hypothetical protein bthur0009_46860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228942118|ref|ZP_04104658.1| hypothetical protein bthur0008_47490 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228948675|ref|ZP_04110953.1| hypothetical protein bthur0007_47990 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228955216|ref|ZP_04117224.1| hypothetical protein bthur0006_45740 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228961200|ref|ZP_04122821.1| hypothetical protein bthur0005_46480 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228968061|ref|ZP_04129067.1| hypothetical protein bthur0004_48450 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228975048|ref|ZP_04135607.1| hypothetical protein bthur0003_47960 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981687|ref|ZP_04141982.1| hypothetical protein bthur0002_48460 [Bacillus thuringiensis Bt407]
 gi|228988194|ref|ZP_04148291.1| hypothetical protein bthur0001_48520 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229014137|ref|ZP_04171258.1| hypothetical protein bmyco0001_45420 [Bacillus mycoides DSM 2048]
 gi|229020189|ref|ZP_04176962.1| hypothetical protein bcere0030_46810 [Bacillus cereus AH1273]
 gi|229026415|ref|ZP_04182772.1| hypothetical protein bcere0029_46920 [Bacillus cereus AH1272]
 gi|229049643|ref|ZP_04194200.1| hypothetical protein bcere0027_46010 [Bacillus cereus AH676]
 gi|229062619|ref|ZP_04199928.1| hypothetical protein bcere0026_46850 [Bacillus cereus AH603]
 gi|229072441|ref|ZP_04205643.1| hypothetical protein bcere0025_46020 [Bacillus cereus F65185]
 gi|229076327|ref|ZP_04209292.1| hypothetical protein bcere0024_46310 [Bacillus cereus Rock4-18]
 gi|229082198|ref|ZP_04214662.1| hypothetical protein bcere0023_48160 [Bacillus cereus Rock4-2]
 gi|229094055|ref|ZP_04225139.1| hypothetical protein bcere0021_47700 [Bacillus cereus Rock3-42]
 gi|229099409|ref|ZP_04230339.1| hypothetical protein bcere0020_46280 [Bacillus cereus Rock3-29]
 gi|229105568|ref|ZP_04236202.1| hypothetical protein bcere0019_46970 [Bacillus cereus Rock3-28]
 gi|229112395|ref|ZP_04241933.1| hypothetical protein bcere0018_46350 [Bacillus cereus Rock1-15]
 gi|229118422|ref|ZP_04247776.1| hypothetical protein bcere0017_46890 [Bacillus cereus Rock1-3]
 gi|229124488|ref|ZP_04253673.1| hypothetical protein bcere0016_47720 [Bacillus cereus 95/8201]
 gi|229130213|ref|ZP_04259172.1| hypothetical protein bcere0015_46490 [Bacillus cereus BDRD-Cer4]
 gi|229141670|ref|ZP_04270200.1| hypothetical protein bcere0013_47600 [Bacillus cereus BDRD-ST26]
 gi|229147497|ref|ZP_04275844.1| hypothetical protein bcere0012_46260 [Bacillus cereus BDRD-ST24]
 gi|229153141|ref|ZP_04281320.1| hypothetical protein bcere0011_46710 [Bacillus cereus m1550]
 gi|229158547|ref|ZP_04286606.1| hypothetical protein bcere0010_47200 [Bacillus cereus ATCC 4342]
 gi|229163931|ref|ZP_04291871.1| hypothetical protein bcere0009_46940 [Bacillus cereus R309803]
 gi|229169674|ref|ZP_04297374.1| hypothetical protein bcere0007_46180 [Bacillus cereus AH621]
 gi|229175651|ref|ZP_04303159.1| hypothetical protein bcere0006_47280 [Bacillus cereus MM3]
 gi|229181250|ref|ZP_04308580.1| hypothetical protein bcere0005_45920 [Bacillus cereus 172560W]
 gi|229187187|ref|ZP_04314332.1| hypothetical protein bcere0004_47230 [Bacillus cereus BGSC 6E1]
 gi|229193231|ref|ZP_04320182.1| hypothetical protein bcere0002_48780 [Bacillus cereus ATCC 10876]
 gi|229199099|ref|ZP_04325782.1| hypothetical protein bcere0001_46120 [Bacillus cereus m1293]
 gi|229604077|ref|YP_002869195.1| nifU domain protein [Bacillus anthracis str. A0248]
 gi|254687285|ref|ZP_05151142.1| nifU domain protein [Bacillus anthracis str. CNEVA-9066]
 gi|254725297|ref|ZP_05187080.1| nifU domain protein [Bacillus anthracis str. A1055]
 gi|254735378|ref|ZP_05193086.1| nifU domain protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254740645|ref|ZP_05198336.1| nifU domain protein [Bacillus anthracis str. Kruger B]
 gi|254753093|ref|ZP_05205129.1| nifU domain protein [Bacillus anthracis str. Vollum]
 gi|254761435|ref|ZP_05213456.1| nifU domain protein [Bacillus anthracis str. Australia 94]
 gi|296505392|ref|YP_003667092.1| NifU protein [Bacillus thuringiensis BMB171]
 gi|301056437|ref|YP_003794648.1| nitrogen-fixing NifU domain-containing protein [Bacillus anthracis
           CI]
 gi|29898552|gb|AAP11824.1| NifU protein [Bacillus cereus ATCC 14579]
 gi|30259669|gb|AAP28855.1| nifU domain protein [Bacillus anthracis str. Ames]
 gi|42740063|gb|AAS43987.1| nifU domain protein [Bacillus cereus ATCC 10987]
 gi|47505640|gb|AAT34316.1| nifU domain protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|47556301|gb|EAL14635.1| NifU protein-related protein [Bacillus cereus G9241]
 gi|49181738|gb|AAT57114.1| nifU domain protein [Bacillus anthracis str. Sterne]
 gi|49332578|gb|AAT63224.1| nitrogen-fixing NifU domain protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974049|gb|AAU15599.1| nitrogen-fixing NifU domain protein [Bacillus cereus E33L]
 gi|74493584|gb|EAO56689.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|118419261|gb|ABK87680.1| NifU-like domain protein [Bacillus thuringiensis str. Al Hakam]
 gi|163864862|gb|ABY45921.1| nitrogen-fixing NifU domain protein [Bacillus weihenstephanensis
           KBAB4]
 gi|164713462|gb|EDR18987.1| nifU domain protein [Bacillus anthracis str. A0488]
 gi|167511988|gb|EDR87366.1| nifU domain protein [Bacillus anthracis str. A0193]
 gi|167529611|gb|EDR92360.1| nifU domain protein [Bacillus anthracis str. A0442]
 gi|170128096|gb|EDS96966.1| nifU domain protein [Bacillus anthracis str. A0389]
 gi|170670120|gb|EDT20860.1| nifU domain protein [Bacillus anthracis str. A0465]
 gi|172082335|gb|EDT67401.1| nifU domain protein [Bacillus anthracis str. A0174]
 gi|190561654|gb|EDV15624.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|195994577|gb|EDX58532.1| nifU domain protein [Bacillus cereus W]
 gi|196025275|gb|EDX63945.1| nifU domain protein [Bacillus cereus 03BB108]
 gi|196028724|gb|EDX67331.1| nifU domain protein [Bacillus cereus NVH0597-99]
 gi|206734968|gb|EDZ52137.1| nifU domain protein [Bacillus cereus AH1134]
 gi|206745400|gb|EDZ56800.1| nifU domain protein [Bacillus cereus H3081.97]
 gi|217063374|gb|ACJ77624.1| nifU domain protein [Bacillus cereus AH187]
 gi|218163047|gb|ACK63039.1| nifU domain protein [Bacillus cereus B4264]
 gi|218538404|gb|ACK90802.1| nifU domain protein [Bacillus cereus AH820]
 gi|218541315|gb|ACK93709.1| nifU domain protein [Bacillus cereus G9842]
 gi|221242461|gb|ACM15171.1| nitrogen-fixing NifU domain protein [Bacillus cereus Q1]
 gi|225790034|gb|ACO30251.1| nifU domain protein [Bacillus cereus 03BB102]
 gi|227002453|gb|ACP12196.1| nifU domain protein [Bacillus anthracis str. CDC 684]
 gi|228584370|gb|EEK42505.1| hypothetical protein bcere0001_46120 [Bacillus cereus m1293]
 gi|228590208|gb|EEK48076.1| hypothetical protein bcere0002_48780 [Bacillus cereus ATCC 10876]
 gi|228596197|gb|EEK53872.1| hypothetical protein bcere0004_47230 [Bacillus cereus BGSC 6E1]
 gi|228602143|gb|EEK59634.1| hypothetical protein bcere0005_45920 [Bacillus cereus 172560W]
 gi|228607792|gb|EEK65106.1| hypothetical protein bcere0006_47280 [Bacillus cereus MM3]
 gi|228613713|gb|EEK70838.1| hypothetical protein bcere0007_46180 [Bacillus cereus AH621]
 gi|228619552|gb|EEK76438.1| hypothetical protein bcere0009_46940 [Bacillus cereus R309803]
 gi|228624861|gb|EEK81629.1| hypothetical protein bcere0010_47200 [Bacillus cereus ATCC 4342]
 gi|228630240|gb|EEK86890.1| hypothetical protein bcere0011_46710 [Bacillus cereus m1550]
 gi|228635923|gb|EEK92406.1| hypothetical protein bcere0012_46260 [Bacillus cereus BDRD-ST24]
 gi|228641738|gb|EEK98039.1| hypothetical protein bcere0013_47600 [Bacillus cereus BDRD-ST26]
 gi|228653146|gb|EEL09025.1| hypothetical protein bcere0015_46490 [Bacillus cereus BDRD-Cer4]
 gi|228658828|gb|EEL14483.1| hypothetical protein bcere0016_47720 [Bacillus cereus 95/8201]
 gi|228664992|gb|EEL20480.1| hypothetical protein bcere0017_46890 [Bacillus cereus Rock1-3]
 gi|228671043|gb|EEL26349.1| hypothetical protein bcere0018_46350 [Bacillus cereus Rock1-15]
 gi|228677838|gb|EEL32081.1| hypothetical protein bcere0019_46970 [Bacillus cereus Rock3-28]
 gi|228684033|gb|EEL37981.1| hypothetical protein bcere0020_46280 [Bacillus cereus Rock3-29]
 gi|228689267|gb|EEL43086.1| hypothetical protein bcere0021_47700 [Bacillus cereus Rock3-42]
 gi|228701116|gb|EEL53638.1| hypothetical protein bcere0023_48160 [Bacillus cereus Rock4-2]
 gi|228706762|gb|EEL58970.1| hypothetical protein bcere0024_46310 [Bacillus cereus Rock4-18]
 gi|228710417|gb|EEL62390.1| hypothetical protein bcere0025_46020 [Bacillus cereus F65185]
 gi|228716589|gb|EEL68286.1| hypothetical protein bcere0026_46850 [Bacillus cereus AH603]
 gi|228722556|gb|EEL73944.1| hypothetical protein bcere0027_46010 [Bacillus cereus AH676]
 gi|228734878|gb|EEL85516.1| hypothetical protein bcere0029_46920 [Bacillus cereus AH1272]
 gi|228741085|gb|EEL91310.1| hypothetical protein bcere0030_46810 [Bacillus cereus AH1273]
 gi|228747091|gb|EEL96973.1| hypothetical protein bmyco0001_45420 [Bacillus mycoides DSM 2048]
 gi|228771491|gb|EEM19960.1| hypothetical protein bthur0001_48520 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228777799|gb|EEM26071.1| hypothetical protein bthur0002_48460 [Bacillus thuringiensis Bt407]
 gi|228784569|gb|EEM32589.1| hypothetical protein bthur0003_47960 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228791616|gb|EEM39212.1| hypothetical protein bthur0004_48450 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228798494|gb|EEM45486.1| hypothetical protein bthur0005_46480 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228804349|gb|EEM50960.1| hypothetical protein bthur0006_45740 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228810982|gb|EEM57325.1| hypothetical protein bthur0007_47990 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228817452|gb|EEM63537.1| hypothetical protein bthur0008_47490 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228823364|gb|EEM69197.1| hypothetical protein bthur0009_46860 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228829656|gb|EEM75282.1| hypothetical protein bthur0010_46580 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228835816|gb|EEM81179.1| hypothetical protein bthur0011_46620 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228842058|gb|EEM87161.1| hypothetical protein bthur0012_47840 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228848741|gb|EEM93586.1| hypothetical protein bthur0013_49320 [Bacillus thuringiensis IBL
           200]
 gi|228856185|gb|EEN00719.1| hypothetical protein bthur0014_46170 [Bacillus thuringiensis IBL
           4222]
 gi|229268485|gb|ACQ50122.1| nifU domain protein [Bacillus anthracis str. A0248]
 gi|296326444|gb|ADH09372.1| NifU protein [Bacillus thuringiensis BMB171]
 gi|300378606|gb|ADK07510.1| nitrogen-fixing NifU domain protein [Bacillus cereus biovar
           anthracis str. CI]
 gi|324328882|gb|ADY24142.1| nitrogen-fixing NifU domain-containing protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
 gi|326942769|gb|AEA18665.1| NifU protein [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 78

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  + +++ EVLD  +RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+
Sbjct: 2   ENPHMQEQVLEVLDK-LRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP V ++  V
Sbjct: 61  ERALLEEVPGVIEVEQV 77


>gi|113954347|ref|YP_729865.1| NifU domain-containing protein [Synechococcus sp. CC9311]
 gi|113881698|gb|ABI46656.1| NifU domain protein [Synechococcus sp. CC9311]
          Length = 81

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V + ++GAC  CPS++ TLK G+   +   +PE
Sbjct: 14  EKVLDELRPFLMADGGNVEVVEIDGPVVKVRLQGACGSCPSSTMTLKMGIERKMRESIPE 73

Query: 183 VKDIRTV 189
           V ++  V
Sbjct: 74  VSEVVQV 80


>gi|255637868|gb|ACU19253.1| unknown [Glycine max]
          Length = 219

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + +RP +  DGG++        +V L ++GAC  CPS+  T+K G+   L   +PE
Sbjct: 75  ESVLDEIRPYLIADGGNVALHQIDGNVVRLKLQGACGSCPSSVTTMKMGIERRLMEKIPE 134

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 135 IVAVEPI 141



 Score = 38.6 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 51/182 (28%), Gaps = 26/182 (14%)

Query: 8   TPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67
           TPNPA         V +       N +          I     +A      + + +    
Sbjct: 60  TPNPA---------VELPLTAE--NVESVLDEIRPYLIADGGNVALHQIDGNVVRLKLQG 108

Query: 68  YDW--EHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVL 125
                      +   I    +   P        +   D+    +  E        I++VL
Sbjct: 109 ACGSCPSSVTTMKMGIERRLMEKIP---EIVAVEPIADEETGLELNED------NIEKVL 159

Query: 126 DNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           +      V    G +      + IV + + G      ++  T++  V   L   +P +  
Sbjct: 160 EEMRPYLVGAADGTLELVAIDEPIVKVRITGP----AASVLTVRVAVTQKLREKIPAIAA 215

Query: 186 IR 187
           ++
Sbjct: 216 VQ 217


>gi|116748860|ref|YP_845547.1| NifU domain-containing protein [Syntrophobacter fumaroxidans MPOB]
 gi|116697924|gb|ABK17112.1| nitrogen-fixing NifU domain protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 72

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + ++++E L   +RP + RDGG +     +  +V + + GAC GCP +  TLK G+  ++
Sbjct: 1   MRKKVEEALAK-IRPMLERDGGSVELVDVQGTVVKVRLTGACHGCPMSQMTLKAGIERVV 59

Query: 177 NHFVPEVKDIRTV 189
              VPEV ++++V
Sbjct: 60  KENVPEVTEVQSV 72


>gi|218185367|gb|EEC67794.1| hypothetical protein OsI_35353 [Oryza sativa Indica Group]
          Length = 228

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 83  EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 142

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 143 IVAVEPI 149



 Score = 38.6 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP ++  GG  + F    + IV + + 
Sbjct: 138 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLSGTGGGELEFVAIEEPIVKVRLT 197

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 198 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 225


>gi|115484477|ref|NP_001065900.1| Os11g0181500 [Oryza sativa Japonica Group]
 gi|108864066|gb|ABG22389.1| nitrogen fixation protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113644604|dbj|BAF27745.1| Os11g0181500 [Oryza sativa Japonica Group]
 gi|215695304|dbj|BAG90495.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765607|dbj|BAG87304.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222615626|gb|EEE51758.1| hypothetical protein OsJ_33192 [Oryza sativa Japonica Group]
          Length = 228

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 83  EIVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 142

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 143 IVAVEPI 149



 Score = 38.6 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP ++  GG  + F    + IV + + 
Sbjct: 138 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLSGTGGGELEFVAIEEPIVKVRLT 197

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 198 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 225


>gi|49082646|gb|AAT50723.1| PA1847 [synthetic construct]
          Length = 195

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 45/133 (33%), Gaps = 5/133 (3%)

Query: 58  YDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
            D     KD   W          + +  +        G L     +          DS +
Sbjct: 55  EDTAIALKDFTAWIDAVSE--PFLEDAVVDYATDRMGGQLTIKAPNAKVPMVN--EDSPI 110

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            +RI   L   + P +A  GG +       D I  L   G C GC     TLK GV   L
Sbjct: 111 TERINYYLQTEINPGLASHGGQVSLVDVVEDNIAVLRFGGGCQGCGMVDMTLKDGVEKTL 170

Query: 177 NHFVPEVKDIRTV 189
              +PE+K +R V
Sbjct: 171 IERIPELKGVRDV 183


>gi|229032593|ref|ZP_04188558.1| hypothetical protein bcere0028_46300 [Bacillus cereus AH1271]
 gi|229135778|ref|ZP_04264548.1| hypothetical protein bcere0014_46610 [Bacillus cereus BDRD-ST196]
 gi|228647644|gb|EEL03709.1| hypothetical protein bcere0014_46610 [Bacillus cereus BDRD-ST196]
 gi|228728778|gb|EEL79789.1| hypothetical protein bcere0028_46300 [Bacillus cereus AH1271]
          Length = 78

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  + +++ EVLD  +RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+
Sbjct: 2   ENPHMEEQVLEVLDK-LRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP V ++  V
Sbjct: 61  ERALLEEVPGVIEVEQV 77


>gi|118578775|ref|YP_900025.1| NifU domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118501485|gb|ABK97967.1| nitrogen-fixing NifU domain protein [Pelobacter propionicus DSM
           2379]
          Length = 74

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +  +VRPA+  DGGD+       DGIV + ++GAC  CP ++ TLK G+   +   +P 
Sbjct: 7   RVLGQVRPALQADGGDVELVEVTADGIVKVRLKGACGSCPMSTMTLKMGIERAMKEQIPA 66

Query: 183 VKDIRTV 189
           VK++  V
Sbjct: 67  VKEVVQV 73


>gi|328954876|ref|YP_004372209.1| nitrogen-fixing NifU domain protein [Coriobacterium glomerans PW2]
 gi|328455200|gb|AEB06394.1| nitrogen-fixing NifU domain protein [Coriobacterium glomerans PW2]
          Length = 92

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + + + +RP +  DGGD+ F G  D  +V L ++GAC+GCP +S TL  G+  +L   V 
Sbjct: 9   KRVLDEIRPNLQADGGDLTFVGVDDDGVVQLELQGACAGCPMSSMTLSMGIERVLKEHVA 68

Query: 182 EVKDIRTV 189
            V  +  V
Sbjct: 69  GVTRVEAV 76


>gi|228993673|ref|ZP_04153580.1| hypothetical protein bpmyx0001_43990 [Bacillus pseudomycoides DSM
           12442]
 gi|228999709|ref|ZP_04159285.1| hypothetical protein bmyco0003_42630 [Bacillus mycoides Rock3-17]
 gi|229007266|ref|ZP_04164867.1| hypothetical protein bmyco0002_41480 [Bacillus mycoides Rock1-4]
 gi|229087461|ref|ZP_04219595.1| hypothetical protein bcere0022_40270 [Bacillus cereus Rock3-44]
 gi|228695883|gb|EEL48734.1| hypothetical protein bcere0022_40270 [Bacillus cereus Rock3-44]
 gi|228754020|gb|EEM03457.1| hypothetical protein bmyco0002_41480 [Bacillus mycoides Rock1-4]
 gi|228760071|gb|EEM09041.1| hypothetical protein bmyco0003_42630 [Bacillus mycoides Rock3-17]
 gi|228766102|gb|EEM14749.1| hypothetical protein bpmyx0001_43990 [Bacillus pseudomycoides DSM
           12442]
          Length = 78

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
            +  + +++ EVLD  +RP + RDGGD+      +GIV L + GAC  CPS++ TLK G+
Sbjct: 2   ENPNMQEQVLEVLDK-LRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGI 60

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VP V ++  V
Sbjct: 61  ERALLEEVPGVIEVEQV 77


>gi|317154501|ref|YP_004122549.1| nitrogen-fixing NifU domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944752|gb|ADU63803.1| nitrogen-fixing NifU domain protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 74

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++ +VLD  VRPA+  DGGD+      D  IV + + GAC GCP +  TLK G+  I
Sbjct: 1   MREKVMKVLDK-VRPALQGDGGDVELVDITDKGIVQVRLTGACKGCPMSQMTLKNGIERI 59

Query: 176 LNHFVPEVKDIRTV 189
           +   +PE+K +  V
Sbjct: 60  ILKEIPEIKGVEAV 73


>gi|167037171|ref|YP_001664749.1| NifU domain-containing protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040690|ref|YP_001663675.1| NifU domain-containing protein [Thermoanaerobacter sp. X514]
 gi|256751269|ref|ZP_05492149.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914731|ref|ZP_07132047.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X561]
 gi|307724035|ref|YP_003903786.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           sp. X513]
 gi|320115589|ref|YP_004185748.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854930|gb|ABY93339.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X514]
 gi|166856005|gb|ABY94413.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256749824|gb|EEU62848.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889666|gb|EFK84812.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X561]
 gi|307581096|gb|ADN54495.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X513]
 gi|319928680|gb|ADV79365.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 73

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGGD+      +  IV + + GAC GCP A+ TLK G+   +   +P
Sbjct: 6   EEVLELLRPSLQADGGDVELIDVTEDGIVKVRLTGACGGCPFATLTLKEGIERAIKEEIP 65

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 66  EVKEVIAV 73


>gi|189500939|ref|YP_001960409.1| nitrogen-fixing NifU domain-containing protein [Chlorobium
           phaeobacteroides BS1]
 gi|189496380|gb|ACE04928.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides
           BS1]
          Length = 86

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPS 163
             + D++     +  R+ + L   VRP +  DGGD    G    + V + + GAC  CP 
Sbjct: 2   NTTKDYLPDTDPLYDRVIKAL-EEVRPYLQADGGDCQLVGITKDMLVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   VPE+  +  V
Sbjct: 61  STLTLRAGVEQAIKKAVPEIARVEAV 86


>gi|15597044|ref|NP_250538.1| hypothetical protein PA1847 [Pseudomonas aeruginosa PAO1]
 gi|107101280|ref|ZP_01365198.1| hypothetical protein PaerPA_01002314 [Pseudomonas aeruginosa PACS2]
 gi|116049799|ref|YP_791394.1| hypothetical protein PA14_40630 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152984911|ref|YP_001348805.1| hypothetical protein PSPA7_3445 [Pseudomonas aeruginosa PA7]
 gi|218892197|ref|YP_002441064.1| hypothetical protein PLES_34781 [Pseudomonas aeruginosa LESB58]
 gi|254234942|ref|ZP_04928265.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254240240|ref|ZP_04933562.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296389760|ref|ZP_06879235.1| hypothetical protein PaerPAb_16491 [Pseudomonas aeruginosa PAb1]
 gi|313110548|ref|ZP_07796433.1| hypothetical protein PA39016_002410135 [Pseudomonas aeruginosa
           39016]
 gi|51702153|sp|Q9I2P8|NFUA_PSEAE RecName: Full=Fe/S biogenesis protein nfuA
 gi|122258910|sp|Q02KZ2|NFUA_PSEAB RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767309|sp|A6V6X0|NFUA_PSEA7 RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767310|sp|B7VB28|NFUA_PSEA8 RecName: Full=Fe/S biogenesis protein nfuA
 gi|9947835|gb|AAG05236.1|AE004611_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115585020|gb|ABJ11035.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166873|gb|EAZ52384.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126193618|gb|EAZ57681.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|150960069|gb|ABR82094.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
 gi|218772423|emb|CAW28205.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310882935|gb|EFQ41529.1| hypothetical protein PA39016_002410135 [Pseudomonas aeruginosa
           39016]
          Length = 194

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 45/133 (33%), Gaps = 5/133 (3%)

Query: 58  YDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAV 117
            D     KD   W          + +  +        G L     +          DS +
Sbjct: 55  EDTAIALKDFTAWIDAVSE--PFLEDAVVDYATDRMGGQLTIKAPNAKVPMVN--EDSPI 110

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
            +RI   L   + P +A  GG +       D I  L   G C GC     TLK GV   L
Sbjct: 111 TERINYYLQTEINPGLASHGGQVSLVDVVEDNIAVLRFGGGCQGCGMVDMTLKDGVEKTL 170

Query: 177 NHFVPEVKDIRTV 189
              +PE+K +R V
Sbjct: 171 IERIPELKGVRDV 183


>gi|189426530|ref|YP_001953707.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ]
 gi|189422789|gb|ACD97187.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ]
          Length = 74

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + + ++VRP + RDGGD+       DGIV + ++GAC  CP ++ TLK G+   +   +P
Sbjct: 6   QAVLDQVRPMLQRDGGDVELIEVTADGIVKVKLQGACGSCPMSTMTLKMGIEKAIKEQIP 65

Query: 182 EVKDIRTV 189
           E+ +++ V
Sbjct: 66  EIVEVQQV 73


>gi|167465184|ref|ZP_02330273.1| nitrogen-fixing NifU domain protein [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322384547|ref|ZP_08058227.1| iron-sulfur scaffold-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150602|gb|EFX44079.1| iron-sulfur scaffold-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 82

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           DS +   + EVLD  +RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+ 
Sbjct: 7   DSTMYDEVLEVLDK-LRPFLQRDGGDVELVDVEDGIVKLRLMGACGSCPSSTITLKAGIE 65

Query: 174 NILNHFVPEVKDIRTV 189
             L   V  ++++  V
Sbjct: 66  RALVEEVEGIQEVVQV 81


>gi|73663148|ref|YP_301929.1| hypothetical protein SSP1839 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72495663|dbj|BAE18984.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 80

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 38/65 (58%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +  ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+   L+  VP V 
Sbjct: 15  VIEKLRPFLLRDGGDCSLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVI 74

Query: 185 DIRTV 189
           ++  V
Sbjct: 75  EVEQV 79


>gi|295107477|emb|CBL05020.1| Thioredoxin-like proteins and domains [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 78

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           V +     +   +RP++  DGGD+ F    +  +V + ++GAC GCP +  TL  GV  I
Sbjct: 2   VDKNDVAAVLELIRPSLQADGGDVRFVDVDEDGVVSVELQGACKGCPMSEMTLANGVERI 61

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V  +  V
Sbjct: 62  LKERVPGVTKVVAV 75


>gi|311694682|gb|ADP97555.1| yhgI protein [marine bacterium HP15]
          Length = 195

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 48/116 (41%), Gaps = 3/116 (2%)

Query: 75  PPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVA 134
              +  + E ++        G L     +        + D+ +  R+  +L + + P +A
Sbjct: 70  HNSVPFLEEAYVDYSKDQMGGQLTIKAPNAKVPKI--DDDAPLPDRVNYILASEINPNLA 127

Query: 135 RDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             GG++      D  V +    G C GC + S TLK GV + L   VPE+  +R V
Sbjct: 128 AHGGEVSLVEIVDESVAVLRFGGGCQGCSAVSLTLKQGVESTLKERVPEITAVRDV 183


>gi|224129660|ref|XP_002328771.1| predicted protein [Populus trichocarpa]
 gi|222839069|gb|EEE77420.1| predicted protein [Populus trichocarpa]
          Length = 234

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + VRP +  DGG++        +V L ++GACS C ++  T+K G+   L   +PE
Sbjct: 90  ESVLDEVRPYLISDGGNVALHEIDGNVVRLKLQGACSSCSASVTTMKMGIERRLMEKIPE 149

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 150 IVAVEAI 156



 Score = 35.9 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 29/73 (39%), Gaps = 5/73 (6%)

Query: 116 AVVQRIKEVLDNRVRPA-VARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +   E +   +RP  V   GG +      + IV + + G  +G      T++  V  
Sbjct: 164 ELKEENIEKVLEEIRPYLVGAAGGSLELVAIEEPIVKIRITGPAAG----VMTVRVAVTQ 219

Query: 175 ILNHFVPEVKDIR 187
            L   +P +  ++
Sbjct: 220 KLREKIPAIAAVQ 232


>gi|242067665|ref|XP_002449109.1| hypothetical protein SORBIDRAFT_05g005270 [Sorghum bicolor]
 gi|241934952|gb|EES08097.1| hypothetical protein SORBIDRAFT_05g005270 [Sorghum bicolor]
          Length = 225

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++        +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 80  EMVLDEVRPYLMADGGNVALHEIDGNMVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 139

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 140 IVAVEPI 146



 Score = 39.4 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + Q   E + + +RP +A  GG  + F    + IV + + 
Sbjct: 135 EKIPEIVAVEPIADEETGLELNQENIEKVLDEIRPYLAGTGGGELEFVTIEEPIVKVRLT 194

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 195 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 222


>gi|301064688|ref|ZP_07205077.1| NifU-like protein [delta proteobacterium NaphS2]
 gi|300441230|gb|EFK05606.1| NifU-like protein [delta proteobacterium NaphS2]
          Length = 75

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++++ L  +VRP++  DGGD+         +V + + GAC GCP +  TLK G+  +
Sbjct: 3   LREKVQDAL-EKVRPSLQADGGDVQLVDVDANGLVKVKLTGACGGCPMSQMTLKMGIEKV 61

Query: 176 LNHFVPEVKDIRT 188
           L   VPEV  + +
Sbjct: 62  LKQNVPEVTSVES 74


>gi|289578725|ref|YP_003477352.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter italicus
           Ab9]
 gi|289528438|gb|ADD02790.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter italicus
           Ab9]
          Length = 73

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGGD+      +  IV + + GAC GCP A+ TLK G+   +   +P
Sbjct: 6   EEVLELLRPSLQADGGDVELIDVTEDGIVKIRLTGACGGCPFATLTLKEGIERAIKEEIP 65

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 66  EVKEVIAV 73


>gi|297544959|ref|YP_003677261.1| nitrogen-fixing NifU domain-containing protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842734|gb|ADH61250.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 73

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGGD+         IV + + GAC GCP A+ TLK G+   +   +P
Sbjct: 6   EEVLELLRPSLQADGGDVELIDVTKDGIVKIRLTGACGGCPFATLTLKEGIERAIKEEIP 65

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 66  EVKEVIAV 73


>gi|313220324|emb|CBY31180.1| unnamed protein product [Oikopleura dioica]
          Length = 95

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILN 177
            IKE+LD R+RP V  DGGDI F  +      + LS+ GAC+ CPS+  TLK+GV N++ 
Sbjct: 1   MIKELLDTRIRPTVMEDGGDIAFVSFDPDTGVLQLSLIGACATCPSSVVTLKHGVENMMK 60

Query: 178 HFVPEVKDIRTV 189
            ++PE+ ++  +
Sbjct: 61  FYIPEITEVEQI 72


>gi|297583473|ref|YP_003699253.1| nitrogen-fixing NifU domain-containing protein [Bacillus
           selenitireducens MLS10]
 gi|297141930|gb|ADH98687.1| nitrogen-fixing NifU domain protein [Bacillus selenitireducens
           MLS10]
          Length = 78

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           +  ++   + + +++RP + RDGGD+      DG+V + + GAC  CPS++ TLK G+  
Sbjct: 3   TETMESQVQEVLDKLRPFLLRDGGDVELVDVEDGVVKVRLMGACGSCPSSTITLKAGIER 62

Query: 175 ILNHFVPEVKDIRTV 189
            L   VP V ++  V
Sbjct: 63  ALLEEVPGVTELEQV 77


>gi|197119169|ref|YP_002139596.1| thioredoxin/NifU-like domain-containing protein [Geobacter
           bemidjiensis Bem]
 gi|197088529|gb|ACH39800.1| thioredoxin/NifU-like domain protein [Geobacter bemidjiensis Bem]
          Length = 73

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + +  ++RPA+  DGGD+      D  IV + + GAC  CP ++ TLK G+   +   VP
Sbjct: 6   KAILEQIRPALQADGGDVELVEVTDDGIVKVRLVGACGHCPMSTMTLKMGIERTIKEKVP 65

Query: 182 EVKDIRTV 189
            +K++  V
Sbjct: 66  GIKEVVAV 73


>gi|317130102|ref|YP_004096384.1| nitrogen-fixing NifU domain protein [Bacillus cellulosilyticus DSM
           2522]
 gi|315475050|gb|ADU31653.1| nitrogen-fixing NifU domain protein [Bacillus cellulosilyticus DSM
           2522]
          Length = 78

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           + +++RP + RDGGD+      DGIV + + GAC  CPS++ TLK G+   L   VP VK
Sbjct: 13  VLDKLRPFLLRDGGDVELVDVEDGIVKVRLMGACGSCPSSTITLKAGIERALLEEVPGVK 72

Query: 185 DIRTV 189
           ++  V
Sbjct: 73  ELEQV 77


>gi|145351003|ref|XP_001419878.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580111|gb|ABO98171.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 213

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 38/74 (51%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + VRP +  DGGD+         V L ++GAC  CPS++ T++ G+   
Sbjct: 61  ELTADNIESVLDEVRPYLIADGGDVELVEIDGLSVKLKLKGACGSCPSSTVTMRMGIEKR 120

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  V
Sbjct: 121 LLEKIPDIMEVIQV 134



 Score = 37.5 bits (85), Expect = 0.84,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 29/73 (39%), Gaps = 5/73 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +   E   + +RP +A  GG  +      + IV + + G      +   T++  V  
Sbjct: 142 DLNEENVEATLDEIRPYLAGTGGGELELIDIEEPIVKVRLTGP----AAKVMTVRVAVTQ 197

Query: 175 ILNHFVPEVKDIR 187
            L   +P +  ++
Sbjct: 198 KLREKIPSIAAVQ 210


>gi|326530153|dbj|BAK08356.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 227

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++V       +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 82  ELVLDEVRPYLMADGGNVVLHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 141

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 142 IVAVEPI 148



 Score = 39.0 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + +   E + + +RP ++  GG  + F    + IV + + 
Sbjct: 137 EKIPEIVAVEPIADEETGLELNEENIEKVLDEIRPYLSGTGGGELEFVSIEEPIVKVRLT 196

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 197 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 224


>gi|308070638|ref|YP_003872243.1| thioredoxin-like protein [Paenibacillus polymyxa E681]
 gi|305859917|gb|ADM71705.1| Thioredoxin-like protein [Paenibacillus polymyxa E681]
          Length = 81

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           + +++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L   V  V+
Sbjct: 16  VLDKLRPFLQRDGGDVELVDVEDGIVKLKLVGACGSCPSSTITLKAGIERALLEEVDGVQ 75

Query: 185 DIRTV 189
           ++  V
Sbjct: 76  EVVQV 80


>gi|193212089|ref|YP_001998042.1| nitrogen-fixing NifU domain-containing protein [Chlorobaculum
           parvum NCIB 8327]
 gi|193085566|gb|ACF10842.1| nitrogen-fixing NifU domain protein [Chlorobaculum parvum NCIB
           8327]
          Length = 83

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASET 167
           D++ +   +  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP ++ T
Sbjct: 3   DYLPNSDPLYDRVISAL-ETVRPYLQVDGGDCQLIGITKDMVVDVKLLGACGSCPMSTLT 61

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           L+ GV   +   +PE+  +  V
Sbjct: 62  LRAGVEQAIKKAIPEIARVEQV 83


>gi|159474062|ref|XP_001695148.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158276082|gb|EDP01856.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 154

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + VRP +  DGG++ F      +V L ++GAC  CPS++ T+  G+   
Sbjct: 3   ELTPENVEKVLDEVRPYLMADGGNVEFMEIDGLVVKLKLQGACGSCPSSTTTMTMGIKRR 62

Query: 176 LNHFVPEVKDIRTV 189
           L   +PE+ D+  V
Sbjct: 63  LMERIPEILDVEQV 76



 Score = 34.4 bits (77), Expect = 7.5,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 28/75 (37%), Gaps = 5/75 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            +     E + N +RP +   GG  +        IV + + G      +   T++  V  
Sbjct: 84  ELNSDNVETVLNEIRPYLVGTGGGGLELVAIDGVIVKVKISGP----AANVMTVRVAVTQ 139

Query: 175 ILNHFVPEVKDIRTV 189
            L   +P +  ++ V
Sbjct: 140 KLREKIPGIAAVQLV 154


>gi|194334614|ref|YP_002016474.1| nitrogen-fixing NifU domain-containing protein [Prosthecochloris
           aestuarii DSM 271]
 gi|194312432|gb|ACF46827.1| nitrogen-fixing NifU domain protein [Prosthecochloris aestuarii DSM
           271]
          Length = 86

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             S  ++     +  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 2   STSKQYLPDTDPLYDRVINAL-EDVRPYLQADGGDCQLVGITKDMVVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   +PEV  + +V
Sbjct: 61  STLTLRAGVEQAVKKAIPEVARVESV 86


>gi|326526691|dbj|BAK00734.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 225

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + VRP +  DGG++V       +V L ++GAC  CP++  T+K G+   L   +PE
Sbjct: 80  ELVLDEVRPYLMADGGNVVLHEIDGNVVRLKLQGACGSCPASVTTMKMGIERRLMEKIPE 139

Query: 183 VKDIRTV 189
           +  +  +
Sbjct: 140 IVAVEPI 146



 Score = 38.6 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
               ++  +      E+   + +   E + + +RP ++  GG  + F    + IV + + 
Sbjct: 135 EKIPEIVAVEPIADEETGLELNEENIEKVLDEIRPYLSGTGGGELEFVSIEEPIVKVRLT 194

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           G  +G      T++  +   L   +P++  ++
Sbjct: 195 GPAAG----VMTVRVALTQKLREKIPKIAAVQ 222


>gi|298708751|emb|CBJ30713.1| NifU-like protein 2, chloroplast precursor (AtCNfu2) (AtCnfU-V)
           [Ectocarpus siliculosus]
          Length = 276

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 42/96 (43%)

Query: 93  HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL 152
            +        D     +  E+   +     E + + +RP +  DGG++        +V L
Sbjct: 98  ESPFATPGMADMGDEEEDPEALLTLTLENVETVLDEMRPYLMSDGGNVRVVEIDGPVVRL 157

Query: 153 SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
            + GAC  CPS++ T+K G+   L   +PE+ ++  
Sbjct: 158 ELEGACGSCPSSTMTMKMGLERRLVQRIPEISEVVQ 193


>gi|258516727|ref|YP_003192949.1| nitrogen-fixing NifU domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780432|gb|ACV64326.1| nitrogen-fixing NifU domain protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 73

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + ++++EVL   VRP + RDGGD+         +V + ++GACSG P A+ TLK G+  +
Sbjct: 1   MREKVEEVLGK-VRPYLQRDGGDVELVDITPDGVVQVKLKGACSGUPGATITLKQGIERV 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VPEVK +  V
Sbjct: 60  LKQEVPEVKGVVQV 73


>gi|253700042|ref|YP_003021231.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21]
 gi|251774892|gb|ACT17473.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21]
          Length = 73

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + +  ++RPA+  DGGD+      D  IV + + GAC  CP ++ TLK G+   +   +P
Sbjct: 6   KAILEQIRPALQADGGDVELVEVTDDGIVKVRLVGACGHCPMSTMTLKMGIERTIKDKIP 65

Query: 182 EVKDIRTV 189
            +K++  V
Sbjct: 66  GIKEVVAV 73


>gi|326487760|dbj|BAK05552.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 219

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           DS++     E++ ++VRP +  DGG++        +V L ++GAC  CP +  T++ G+ 
Sbjct: 65  DSSLTAENVELVLDQVRPYLMADGGNVALHEIDGNVVRLKLQGACGACPGSVMTMRMGIQ 124

Query: 174 NILNHFVPEVKDIRTV 189
             L   +PE+  +  +
Sbjct: 125 RRLMDEIPEIAAVEAI 140



 Score = 34.0 bits (76), Expect = 9.7,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 36/89 (40%), Gaps = 5/89 (5%)

Query: 100 MKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGAC 158
            ++  + +    E+   + +   E + + +RP +   GG  + F       V + +RG  
Sbjct: 132 PEIAAVEAITDNEAGLKLKKENVEKVLDEIRPYLTGAGGGNLRFVAINRFFVKVQLRGPA 191

Query: 159 SGCPSASETLKYGVANILNHFVPEVKDIR 187
           +G       ++  VA  L   +P +  ++
Sbjct: 192 AG----VAAIRVAVAQKLREKIPSISAVQ 216


>gi|83815451|ref|YP_444955.1| hypothetical protein SRU_0820 [Salinibacter ruber DSM 13855]
 gi|294506813|ref|YP_003570871.1| hypothetical protein SRM_00998 [Salinibacter ruber M8]
 gi|83756845|gb|ABC44958.1| conserved domain protein [Salinibacter ruber DSM 13855]
 gi|294343141|emb|CBH23919.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 101

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 104 DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCP 162
           D   G     D  +   I+E LD  +RP +  DGG +       D +V L + GAC  CP
Sbjct: 10  DTEDGSSPHIDPELRDNIEEALDT-IRPYLMADGGSVRLLNVTADYVVELELLGACGSCP 68

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
            ++ TL+ G+   L   VP+VK +  V
Sbjct: 69  MSTMTLRAGIEQALKRSVPKVKRVEAV 95


>gi|90416073|ref|ZP_01224006.1| yhgI protein [marine gamma proteobacterium HTCC2207]
 gi|90332447|gb|EAS47644.1| yhgI protein [marine gamma proteobacterium HTCC2207]
          Length = 193

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 47/143 (32%), Gaps = 10/143 (6%)

Query: 57  GYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD----------MG 106
               I   +     E            +F        +    D   D             
Sbjct: 40  AETCIAYSRPGEHNEEDMVVEYDAFSAYFEQRSIAFLDEAKVDFAEDKFGGQLTIRAPNS 99

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASE 166
               +  DS +  RI  +L N + P +A  GG +      +G   L   G C GC + S 
Sbjct: 100 RLPNVNDDSPIEDRINYLLYNEINPGLASHGGVVSLSEMDEGFAVLEFGGGCQGCSAVSM 159

Query: 167 TLKYGVANILNHFVPEVKDIRTV 189
           TLK GV   L   +PE+K +R V
Sbjct: 160 TLKEGVEKTLMEKIPELKGVRDV 182


>gi|297627112|ref|YP_003688875.1| NifU-like protein [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296922877|emb|CBL57457.1| NifU-like protein [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 190

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 75/186 (40%), Gaps = 22/186 (11%)

Query: 6   EDTPNPATLKFIPGQVVLV-EGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVG 64
           E T +PATL+++    +L   G +          +P    + +   ++ V  G D + V 
Sbjct: 23  EATDDPATLRWVVSHHILPFAGTL--------ASAPGLDDLLADR-VSRVVVGPDTLLVT 73

Query: 65  -KDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKE 123
                DW  L P V   +M      D  +                  +  D A+     E
Sbjct: 74  LAPGSDWAELGPVVRRALMRALGHTDAWVGAA-----------DARVLSGDDALGVCADE 122

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           +++  +       GG I   G +DG+V + M GAC GCP+A  T+   + + L   VP +
Sbjct: 123 LIEGPIGDIARAHGGHIALAGVQDGVVTVKMSGACRGCPAAVITMHQRLEHQLRRRVPGL 182

Query: 184 KDIRTV 189
            D+R++
Sbjct: 183 VDVRSI 188


>gi|293375093|ref|ZP_06621383.1| NifU-like protein [Turicibacter sanguinis PC909]
 gi|325841245|ref|ZP_08167346.1| NifU-like protein [Turicibacter sp. HGF1]
 gi|292646287|gb|EFF64307.1| NifU-like protein [Turicibacter sanguinis PC909]
 gi|325489926|gb|EGC92273.1| NifU-like protein [Turicibacter sp. HGF1]
          Length = 78

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           +   ++I E+L  ++RP + RDGGD+ +  + DGIV++ M GAC GC S   TLK G+  
Sbjct: 2   NETEKQIVEIL-EKLRPYLQRDGGDVEYIKFEDGIVYVRMLGACVGCASMDSTLKDGIEQ 60

Query: 175 ILNHFVPEVKDIRTV 189
           IL   VP V  +  V
Sbjct: 61  ILLEEVPGVIGVENV 75


>gi|269216053|ref|ZP_06159907.1| NifU family protein [Slackia exigua ATCC 700122]
 gi|269130312|gb|EEZ61390.1| NifU family protein [Slackia exigua ATCC 700122]
          Length = 76

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVAN 174
            + ++    + + VRP++  DGGD+      D  IV + ++GAC+GC  +S T+  GV  
Sbjct: 2   EIDKKRVSRVLDMVRPSLQADGGDLELVDITDDGIVRVRLQGACNGCALSSLTIANGVER 61

Query: 175 ILNHFVPEVKDIRTV 189
           IL   VPEV  + ++
Sbjct: 62  ILKEHVPEVAKVISI 76


>gi|222616724|gb|EEE52856.1| hypothetical protein OsJ_35404 [Oryza sativa Japonica Group]
          Length = 219

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + ++VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +P+
Sbjct: 74  ESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPD 133

Query: 183 VKDIRTV 189
           V  +  V
Sbjct: 134 VAAVEPV 140



 Score = 35.5 bits (80), Expect = 3.6,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 39/93 (41%), Gaps = 7/93 (7%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
                +  +      E+   + +   E + N +RP +A  GG  + F   +  IV + + 
Sbjct: 129 EKIPDVAAVEPVTDKETGLELNEENVEKVLNEIRPYLAGTGGGGLQFLMIKGPIVKVRLT 188

Query: 156 GACSGCPSASE-TLKYGVANILNHFVPEVKDIR 187
           G     P+A   T++  V+  L   +P ++ ++
Sbjct: 189 G-----PAAVVRTVRIAVSKKLREKIPSIQIVQ 216


>gi|218186519|gb|EEC68946.1| hypothetical protein OsI_37662 [Oryza sativa Indica Group]
          Length = 221

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + ++VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +P+
Sbjct: 76  ESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPD 135

Query: 183 VKDIRTV 189
           V  +  V
Sbjct: 136 VAAVEPV 142


>gi|163310812|pdb|2JNV|A Chain A, Solution Structure Of C-Terminal Domain Of Nifu-Like
           Protein From Oryza Sativa
          Length = 91

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + ++VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +P+
Sbjct: 11  ESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPD 70

Query: 183 VKDIRTV 189
           V  +  V
Sbjct: 71  VAAVEPV 77


>gi|115487614|ref|NP_001066294.1| Os12g0176200 [Oryza sativa Japonica Group]
 gi|75147032|sp|Q84LK7|NIFU1_ORYSJ RecName: Full=NifU-like protein 1, chloroplastic; AltName:
           Full=OsNifu1; Flags: Precursor
 gi|30698492|dbj|BAC76603.1| NifU1 [Oryza sativa Japonica Group]
 gi|77553807|gb|ABA96603.1| nitrogen fixation protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113648801|dbj|BAF29313.1| Os12g0176200 [Oryza sativa Japonica Group]
          Length = 226

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + ++VRP +  DGGD+        +V L ++GAC  CPS+  T+K G+   L   +P+
Sbjct: 81  ESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPD 140

Query: 183 VKDIRTV 189
           V  +  V
Sbjct: 141 VAAVEPV 147



 Score = 35.5 bits (80), Expect = 3.6,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 39/93 (41%), Gaps = 7/93 (7%)

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMR 155
                +  +      E+   + +   E + N +RP +A  GG  + F   +  IV + + 
Sbjct: 136 EKIPDVAAVEPVTDKETGLELNEENVEKVLNEIRPYLAGTGGGGLQFLMIKGPIVKVRLT 195

Query: 156 GACSGCPSASE-TLKYGVANILNHFVPEVKDIR 187
           G     P+A   T++  V+  L   +P ++ ++
Sbjct: 196 G-----PAAVVRTVRIAVSKKLREKIPSIQIVQ 223


>gi|78186286|ref|YP_374329.1| NifU protein, putative [Chlorobium luteolum DSM 273]
 gi|78166188|gb|ABB23286.1| NifU protein, putative [Chlorobium luteolum DSM 273]
          Length = 89

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             S D++ +  A+  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 5   STSKDYLPNSDALYDRVIAAL-ETVRPYLQVDGGDCQLVGITKDMVVDVKLLGACGSCPM 63

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   +PE+  + +V
Sbjct: 64  STLTLRAGVEQAIKKAIPEIVRVESV 89


>gi|145219268|ref|YP_001129977.1| NifU domain-containing protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205432|gb|ABP36475.1| nitrogen-fixing NifU domain protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 86

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             S D++ +  A+  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 2   STSKDYLPNSDALYDRVIAAL-ETVRPYLQVDGGDCQLVGISKDMVVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   +PE+  + +V
Sbjct: 61  STLTLRAGVEQAIKKAIPEIVRVESV 86


>gi|149374734|ref|ZP_01892507.1| Thioredoxin-like protein [Marinobacter algicola DG893]
 gi|149360623|gb|EDM49074.1| Thioredoxin-like protein [Marinobacter algicola DG893]
          Length = 195

 Score = 81.4 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 75  PPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVA 134
              +  + E F+        G L     +       ++ ++ +  RI+ +L + + P +A
Sbjct: 70  HNSVPFLEEAFVDYSKDQMGGQLTIKAPN--AKVPNVDENAPLPDRIQYILASEINPNLA 127

Query: 135 RDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             GG++       + I  L   G C GC + S TLK GV + L   VPE+  +R V
Sbjct: 128 AHGGEVSLVEVAEESIAVLRFGGGCQGCSAVSLTLKQGVESTLKERVPEITAVRDV 183


>gi|268317872|ref|YP_003291591.1| nitrogen-fixing NifU domain-containing protein [Rhodothermus
           marinus DSM 4252]
 gi|262335406|gb|ACY49203.1| nitrogen-fixing NifU domain protein [Rhodothermus marinus DSM 4252]
          Length = 96

 Score = 81.4 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 99  DMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGA 157
                   +G     D  + +RI+E L + +RP +  DGG +       D +V L + GA
Sbjct: 2   ADTKTTHTTGPLAPDDPELHRRIEEAL-DMIRPYLMTDGGSVRLLNVTEDYVVELELLGA 60

Query: 158 CSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           C  CP +  TL+ G+  +L   VPE+  +  V
Sbjct: 61  CGTCPMSLMTLRAGIEQVLKRAVPEITRVEAV 92


>gi|39995588|ref|NP_951539.1| NifU-like domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982351|gb|AAR33812.1| NifU-like domain protein [Geobacter sulfurreducens PCA]
 gi|298504607|gb|ADI83330.1| thioredoxin/NifU-like domain protein [Geobacter sulfurreducens
           KN400]
          Length = 74

 Score = 81.4 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + + VRPA+  DGGD+      +  +V + + GAC  CP ++ TLK G+   L   VP V
Sbjct: 8   VLDLVRPALQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGV 67

Query: 184 KDIRTV 189
           K++ +V
Sbjct: 68  KEVVSV 73


>gi|300087175|ref|YP_003757697.1| nitrogen-fixing NifU domain-containing protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299526908|gb|ADJ25376.1| nitrogen-fixing NifU domain protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 74

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           +  +VRP +  DGGD+      +  IV + + G+C+GCP +  TLK G+  IL   VPEV
Sbjct: 8   VLEQVRPNLQADGGDVELVSVSEDGIVTVKLTGSCAGCPMSQMTLKNGIERILKREVPEV 67

Query: 184 KDIRT 188
           K++ +
Sbjct: 68  KEVVS 72


>gi|257790861|ref|YP_003181467.1| nitrogen-fixing NifU domain-containing protein [Eggerthella lenta
           DSM 2243]
 gi|317488428|ref|ZP_07946981.1| NifU-like domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|325831888|ref|ZP_08164985.1| NifU-like protein [Eggerthella sp. HGA1]
 gi|257474758|gb|ACV55078.1| nitrogen-fixing NifU domain protein [Eggerthella lenta DSM 2243]
 gi|316912472|gb|EFV34028.1| NifU-like domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|325486209|gb|EGC88661.1| NifU-like protein [Eggerthella sp. HGA1]
          Length = 77

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
            +   +RP++  DGGD+      +  +V + ++GAC GCP +  TL  GV  IL   VP 
Sbjct: 9   AVLELIRPSLQADGGDVRLVDVNEDGVVSVELQGACKGCPMSQMTLANGVERILKERVPG 68

Query: 183 VKDIRT 188
           V  +  
Sbjct: 69  VTKVVP 74


>gi|322420167|ref|YP_004199390.1| nitrogen-fixing NifU domain-containing protein [Geobacter sp. M18]
 gi|320126554|gb|ADW14114.1| nitrogen-fixing NifU domain protein [Geobacter sp. M18]
          Length = 73

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           + +   +RPA+  DGGD+      D  +V + + GAC  CP ++ TLK G+   +   +P
Sbjct: 6   KAILENIRPALQADGGDVELVEVTDDGVVKVRLVGACGHCPMSTMTLKMGIERTIKEKIP 65

Query: 182 EVKDIRTV 189
            VK++ +V
Sbjct: 66  GVKEVVSV 73


>gi|82548259|gb|ABB82950.1| uncharacterized protein with NifU-like and HesB-like domains
           [uncultured organism HF70_19B12]
          Length = 187

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 37/74 (50%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             + QR+ EV+D  V PAVA  GG +   G       ++  G C GC  A  TLK GV  
Sbjct: 102 DDLSQRVAEVIDKNVNPAVASHGGHVDLVGVDANKAIIAFGGGCQGCGMADVTLKQGVEV 161

Query: 175 ILNHFVPEVKDIRT 188
           ++   VPE+ ++  
Sbjct: 162 MIMDNVPEIIEVID 175


>gi|308808272|ref|XP_003081446.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
 gi|116059909|emb|CAL55968.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri]
          Length = 203

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 38/74 (51%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + VRP +  DGGD+         V L ++GAC  CPS++ T++ G+   
Sbjct: 51  ELTADNIEKVLDEVRPYLIADGGDVELVEIDGLSVKLKLKGACGSCPSSTVTMRMGIEKR 110

Query: 176 LNHFVPEVKDIRTV 189
           L   +P++ ++  +
Sbjct: 111 LLEKIPDIMEVIQI 124



 Score = 37.9 bits (86), Expect = 0.72,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 30/75 (40%), Gaps = 5/75 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +   E   N +RP +A  GG +       + IV + + G      +   T++  V  
Sbjct: 132 PLTEENVEQTLNEIRPYLAGTGGGVLELLDIEEPIVKVRLTGP----AAKVMTVRVAVTQ 187

Query: 175 ILNHFVPEVKDIRTV 189
            L   +P +  ++ V
Sbjct: 188 KLREKIPSIAAVQLV 202


>gi|20808161|ref|NP_623332.1| thioredoxin domain-containing protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516751|gb|AAM24936.1| Thioredoxin-like proteins and domains [Thermoanaerobacter
           tengcongensis MB4]
          Length = 73

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E + N ++P++  DGGD+      +  +V + + GAC GCP A+ TLK G+   +   +P
Sbjct: 6   EEILNLIKPSLQADGGDVELVDVTEDGVVKVKLTGACGGCPFATLTLKEGIERAIKEEIP 65

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 66  EVKEVIAV 73


>gi|189345962|ref|YP_001942491.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245]
 gi|189340109|gb|ACD89512.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245]
          Length = 86

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             S D++ +  A+  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 2   STSKDYLPNSDALYDRVIAAL-ETVRPYLQVDGGDCQLVGITKDMVVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   +PE+  + +V
Sbjct: 61  STITLRAGVEQAIKKAIPEIARVESV 86


>gi|307266231|ref|ZP_07547773.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326390563|ref|ZP_08212119.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           JW 200]
 gi|306918761|gb|EFN48993.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325993388|gb|EGD51824.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 73

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGG++      +  IV + + GAC GCP A+ TLK G+   +   +P
Sbjct: 6   EEVLELLRPSLQADGGNVELIDVTEDGIVKVRLTGACGGCPFATLTLKEGIERAIKEEIP 65

Query: 182 EVKDIRTV 189
           EV+++  V
Sbjct: 66  EVREVIAV 73


>gi|268325898|emb|CBH39486.1| conserved hypothetical protein, containing NifU-like domain
           [uncultured archaeon]
          Length = 116

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 39/73 (53%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           +  ++KEV++  ++P  A DGG I      D    L + GAC+GCP +  TL   V   L
Sbjct: 1   MKDKVKEVIEKELKPLFAVDGGGIELVSVDDSEAKLKLSGACAGCPMSQYTLANIVEVTL 60

Query: 177 NHFVPEVKDIRTV 189
              VPE+K++  V
Sbjct: 61  KEKVPELKEVILV 73


>gi|291287157|ref|YP_003503973.1| nitrogen-fixing NifU domain protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884317|gb|ADD68017.1| nitrogen-fixing NifU domain protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 75

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 119 QRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILN 177
           ++  E + ++VRP +  DGGDI      +  IV + + GAC  CP ++ TLK+GV   L 
Sbjct: 4   KQRVEEVLDQVRPTLQADGGDIELLDVSEDGIVKVQLTGACGSCPFSTMTLKHGVEARLK 63

Query: 178 HFVPEVKDIRTV 189
             +PEVK++ ++
Sbjct: 64  DMIPEVKEVLSI 75


>gi|78189610|ref|YP_379948.1| NifU protein, putative [Chlorobium chlorochromatii CaD3]
 gi|78171809|gb|ABB28905.1| NifU protein, putative [Chlorobium chlorochromatii CaD3]
          Length = 84

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSAS 165
           S D++ S  ++  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP ++
Sbjct: 2   SKDYLPSSDSLYDRVIAAL-ETVRPYLQADGGDCQLVGISKDMVVDVKLLGACGSCPMST 60

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TL+ GV   +   +PE+  + +V
Sbjct: 61  LTLRAGVEQAIKKAIPEIVRVESV 84


>gi|194337374|ref|YP_002019168.1| nitrogen-fixing NifU domain protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194309851|gb|ACF44551.1| nitrogen-fixing NifU domain protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 86

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             + D++ +  A+  R+   L   VRP +  DGGD    G  +D  V + + GAC  CP 
Sbjct: 2   SSTKDYLPNSDALYDRVIAAL-ETVRPYLQVDGGDCQIVGITKDMTVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   VPE+  + +V
Sbjct: 61  STLTLRAGVEQAIKKAVPEIVRVESV 86


>gi|242082972|ref|XP_002441911.1| hypothetical protein SORBIDRAFT_08g004740 [Sorghum bicolor]
 gi|241942604|gb|EES15749.1| hypothetical protein SORBIDRAFT_08g004740 [Sorghum bicolor]
          Length = 227

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 35/67 (52%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + + VRP +  DGGD+        +V L ++GAC  CPS+  T+K  +   L   +PE
Sbjct: 82  ESVLDEVRPYLIADGGDVALHEINGNVVRLKLQGACGSCPSSVTTMKMRIQRRLMENIPE 141

Query: 183 VKDIRTV 189
           +  +  V
Sbjct: 142 ISAVERV 148


>gi|219120702|ref|XP_002181084.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217407800|gb|EEC47736.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 225

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 96  GLGDMKLDDMGSGDFIESDSAVVQRI---------KEVLDNRVRPAVARDGGDIVFKGYR 146
              D    D GS    E D+   + +          E + + +RP + +DGG+++     
Sbjct: 41  SPFDSSERDEGSVATTELDAPPTKLVGPLDLTWDNVEAVLDEMRPYLIQDGGNVIISDID 100

Query: 147 DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
             +V L ++GAC  CPS+++T+K G+   L   +PE++++  
Sbjct: 101 GPVVKLELQGACGTCPSSTQTMKMGLERGLREKIPEIQEVIQ 142


>gi|71029204|ref|XP_764245.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68351199|gb|EAN31962.1| hypothetical protein TP04_0610 [Theileria parva]
          Length = 180

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 81  IMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI 140
           I  + I   P+             +    + + D   V+ IK ++D R+RP + +DGGD+
Sbjct: 55  INGNRIMRSPMNFINRKFSTVTKAVIPESYSDEDIETVESIKILIDKRIRPVIQQDGGDV 114

Query: 141 VFKGYRDGI--VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            F  Y      V++ + GAC GC  +  TLK+ +  +L H++ E+  +  V
Sbjct: 115 SFVSYDPSTGYVYVRLSGACVGCIQSDVTLKHMIQGMLCHYLEEITAVYNV 165


>gi|222054851|ref|YP_002537213.1| nitrogen-fixing NifU domain protein [Geobacter sp. FRC-32]
 gi|221564140|gb|ACM20112.1| nitrogen-fixing NifU domain protein [Geobacter sp. FRC-32]
          Length = 73

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 125 LDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + + +RP +  DGGD+       DG+V + + GAC  CP ++ TLK G+   L   VP V
Sbjct: 8   VLDTIRPNLQADGGDVELVEVGEDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGV 67

Query: 184 KDIRTV 189
           K++ +V
Sbjct: 68  KEVISV 73


>gi|206890081|ref|YP_002249266.1| thioredoxin family protein [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742019|gb|ACI21076.1| thioredoxin family protein [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 74

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           + +   E +  ++R  +  DGG+I     +D IV++ ++GAC  CP A+ TLK  V   L
Sbjct: 2   IEKAKVEQVLGKIRVGLMADGGNIDLVDIKDNIVYVKLKGACGTCPMATLTLKNWVEKTL 61

Query: 177 NHFVPEVKDIRTV 189
              +PEVK++  V
Sbjct: 62  KSEIPEVKEVVAV 74


>gi|117924033|ref|YP_864650.1| NifU domain-containing protein [Magnetococcus sp. MC-1]
 gi|117607789|gb|ABK43244.1| nitrogen-fixing NifU domain protein [Magnetococcus sp. MC-1]
          Length = 76

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           + ++I  VL   +RP + RDGGD+ F     D +V + +RGAC  CP A  TLK G+  +
Sbjct: 1   MKEKILAVLAE-IRPMLQRDGGDVEFVDLTEDNVVQVRLRGACGSCPGAMMTLKGGIERL 59

Query: 176 LNHFVPEVKDIRTV 189
           +   +PEV  +  V
Sbjct: 60  MKERIPEVHSVENV 73


>gi|119357807|ref|YP_912451.1| NifU domain-containing protein [Chlorobium phaeobacteroides DSM
           266]
 gi|119355156|gb|ABL66027.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides
           DSM 266]
          Length = 86

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             +  ++ +  A+  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 2   STNKTYLPNSDALYDRVIAAL-ETVRPYLQVDGGDCQLVGISKDMVVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +   +PE+  + +V
Sbjct: 61  STLTLRAGVEQAIKKAIPEIARVESV 86


>gi|291279936|ref|YP_003496771.1| nitrogen-fixing NifU domain protein [Deferribacter desulfuricans
           SSM1]
 gi|290754638|dbj|BAI81015.1| nitrogen-fixing NifU domain protein [Deferribacter desulfuricans
           SSM1]
          Length = 75

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +R++EVL+  VRP +  DGGD+      +  +V + + GAC  CP ++ TLK+G+   
Sbjct: 3   LKERVQEVLNQ-VRPGLQADGGDVELLDVTEDGVVKVQLTGACGSCPFSTMTLKHGIEMR 61

Query: 176 LNHFVPEVKDIRT 188
           L   +PEVK++  
Sbjct: 62  LKEMIPEVKEVVA 74


>gi|186680893|ref|YP_001864089.1| Rieske (2Fe-2S) domain-containing protein [Nostoc punctiforme PCC
           73102]
 gi|186463345|gb|ACC79146.1| Rieske (2Fe-2S) domain protein [Nostoc punctiforme PCC 73102]
          Length = 281

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 50/134 (37%), Gaps = 1/134 (0%)

Query: 57  GYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116
               + VG  +      +  +  +I        P + +    ++    +   + ++    
Sbjct: 24  SQRCVAVGLKRAIEALHKAALTNLIKNLKQESMPALRHAVADELVYAVLLYHELVKPPKP 83

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +  E     VRP +    GD+     +    V + + G CS CP+++ TL  GV   
Sbjct: 84  PLAQRIETALEEVRPGLKSHDGDVELVAIKSPDTVEVRLIGTCSSCPASTLTLSQGVEQA 143

Query: 176 LNHFVPEVKDIRTV 189
           + +  PE+  +  V
Sbjct: 144 IKNHCPEITKVVAV 157


>gi|323453984|gb|EGB09855.1| hypothetical protein AURANDRAFT_6483 [Aureococcus anophagefferens]
          Length = 114

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E++ + +RP +  DGG++   G    +V L + GAC  CPS++ T+K G+   L   +PE
Sbjct: 11  ELILDELRPYLMSDGGNVRIAGIEGPVVKLELEGACGTCPSSTMTMKMGLERRLKEAIPE 70

Query: 183 VKDIRT 188
           + D+  
Sbjct: 71  ISDVVQ 76


>gi|226944949|ref|YP_002800022.1| NfuA protein [Azotobacter vinelandii DJ]
 gi|259511740|sp|C1DLW0|NFUA_AZOVD RecName: Full=Fe/S biogenesis protein nfuA
 gi|226719876|gb|ACO79047.1| NfuA protein [Azotobacter vinelandii DJ]
          Length = 194

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 46/120 (38%), Gaps = 7/120 (5%)

Query: 70  WEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRV 129
                P +   I+++              + K+        I+ DS + +RI   L   +
Sbjct: 69  DAVSEPFLEDAIVDYANDRMGGQLTIKAPNAKV------PMIDEDSPLGERINYYLQTEI 122

Query: 130 RPAVARDGGDIVFKG-YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
            P +A  GG +       +GI  L   G C GC     TLK GV   L   +P++K +R 
Sbjct: 123 NPGLASHGGQVSLVDIVEEGIAVLRFGGGCQGCGMVDMTLKDGVEKTLLERIPDLKGVRD 182


>gi|158520102|ref|YP_001527972.1| NifU domain-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158508928|gb|ABW65895.1| nitrogen-fixing NifU domain protein [Desulfococcus oleovorans Hxd3]
          Length = 72

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 39/72 (54%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++   +   +++RP +  DGGD+      +G V + ++GAC+GCP +  TLK  +   L 
Sbjct: 1   MKEQVKAALDKIRPQLQADGGDVELVDVENGNVSVRLKGACAGCPMSQITLKQRIEAYLK 60

Query: 178 HFVPEVKDIRTV 189
             VP V ++  V
Sbjct: 61  KTVPGVINVEKV 72


>gi|78358118|ref|YP_389567.1| Fe-S cluster assembly protein NifU [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220523|gb|ABB39872.1| Fe-S cluster assembly protein NifU [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 280

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 58/172 (33%), Gaps = 2/172 (1%)

Query: 19  GQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVL 78
           GQ  L     ++   +  +       +    G+                 +         
Sbjct: 109 GQEALEAAIKNYRGEEVEQHHHEGQLVCKCFGVTDEQIIRSIRENKLTSVEEVTHFTKAG 168

Query: 79  GMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGG 138
           G   +       ++          +         S+   +Q + + L+  +RP++ +DGG
Sbjct: 169 GGCGDCLNDIQKLLDEELGKTAACEVPEPQPRTLSNVQRMQLVVKTLEEDIRPSLQKDGG 228

Query: 139 DIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
           DI         V +++RG C+ CPS+  TL   V   L   V P++  ++ V
Sbjct: 229 DIELVDIDGKEVKVALRGMCTHCPSSQLTLTNFVQRTLREHVEPDIT-VKEV 279


>gi|95929342|ref|ZP_01312085.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684]
 gi|95134458|gb|EAT16114.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684]
          Length = 74

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + ++I+  LD  VRP +  DGG++      D  +V + + GAC  CP ++ TLK G+  I
Sbjct: 1   MKEQIEAALDE-VRPTLLADGGNVELVDVSDDGVVSVKLVGACGSCPMSTVTLKMGIERI 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP VK++  V
Sbjct: 60  LLEKVPGVKEVVQV 73


>gi|312213452|emb|CBX93534.1| hypothetical protein [Leptosphaeria maculans]
          Length = 186

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 49/98 (50%), Gaps = 9/98 (9%)

Query: 1   MFIQTEDTPNPATLKFIPGQVVLVEGA----IHFSNAKEAEISPLAS----RIFSIPGIA 52
           MFIQTE TPN   LKF P   VL E      + +   +     P  S     + +I G+ 
Sbjct: 71  MFIQTEPTPNDDALKFNPNARVLSESISSPYLEYLTPRSTLAPPHPSPLAAALMNIDGVT 130

Query: 53  SVYFGYDFITVGKDQ-YDWEHLRPPVLGMIMEHFISGD 89
           SV+FG D+ITV KD    W H++P V  +I E   SG 
Sbjct: 131 SVFFGTDYITVTKDSGTPWAHIKPEVFALITEFMTSGQ 168


>gi|218961333|ref|YP_001741108.1| NifU-like domain protein [Candidatus Cloacamonas acidaminovorans]
 gi|167729990|emb|CAO80902.1| NifU-like domain protein [Candidatus Cloacamonas acidaminovorans]
          Length = 75

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVF-LSMRGACSGCPSASETLKYGVANI 175
           + +   E +  +VRP++  DGGD+     R+  V  + ++G C+GCP A+ TLK G+  +
Sbjct: 2   IAKEKIESILAKVRPSIQADGGDVELINIREDNVIEVRLKGTCNGCPMATLTLKAGIERL 61

Query: 176 LNHFVPEVKDIRTV 189
           +   +PEVK++  V
Sbjct: 62  IKEEIPEVKEVIAV 75


>gi|323704659|ref|ZP_08116237.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536121|gb|EGB25894.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 73

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGGD+      D  +V + + GAC GCP A  TLK G+   +   +P
Sbjct: 6   EEVLKLLRPSLQADGGDVELVDVTDDGVVQVRLTGACGGCPFAVMTLKEGIERAIKEEIP 65

Query: 182 EVKDIRT 188
           EVK++  
Sbjct: 66  EVKEVVA 72


>gi|78224272|ref|YP_386019.1| nitrogen-fixing NifU-like [Geobacter metallireducens GS-15]
 gi|78195527|gb|ABB33294.1| Nitrogen-fixing NifU-like protein [Geobacter metallireducens GS-15]
          Length = 74

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + + VRPA+  DGGD+      +  +V + + GAC  CP ++ TLK G+   L   VP V
Sbjct: 8   VLDTVRPALQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGV 67

Query: 184 KDIRTV 189
           K++ +V
Sbjct: 68  KEVISV 73


>gi|88798134|ref|ZP_01113721.1| Thioredoxin-like protein [Reinekea sp. MED297]
 gi|88779331|gb|EAR10519.1| Thioredoxin-like protein [Reinekea sp. MED297]
          Length = 196

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 54/168 (32%), Gaps = 14/168 (8%)

Query: 33  AKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPII 92
           AK+           + PG     +    +   +   +        L  I  +        
Sbjct: 20  AKQNTKGMAVRMFVTQPGTK---YAETCLAYSRPGEEKPDDELVELSHIRVYLERNSLPY 76

Query: 93  HNGGLGDMKLD----------DMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVF 142
            +    D   D                 +  DS +  ++  +L   + P +A  GGD+  
Sbjct: 77  LDEAEVDYAKDRMGGQLTIKAPNAKMPKVTKDSPLPDQVNYILYTEINPGLAAHGGDVSL 136

Query: 143 KGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +   D  V +    G C GC +   TLK GV   L   VP++  +R V
Sbjct: 137 EELTDDNVAVLRFGGGCQGCSAVDMTLKDGVEKTLMERVPQLAGVRDV 184


>gi|225849734|ref|YP_002729968.1| hypothetical protein PERMA_0171 [Persephonella marina EX-H1]
 gi|225645990|gb|ACO04176.1| conserved domain protein [Persephonella marina EX-H1]
          Length = 91

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +  ++RP +  DGGD+       DG V++ + G+C GC  +  TLK G+   L   +P
Sbjct: 17  EEVLEQIRPMLRFDGGDVELVDIGEDGTVYVRLMGSCHGCAMSLVTLKGGIEMKLKEAIP 76

Query: 182 EVKDIRTV 189
           EVK++  V
Sbjct: 77  EVKEVVAV 84


>gi|302340763|ref|YP_003805969.1| nitrogen-fixing NifU domain protein [Spirochaeta smaragdinae DSM
           11293]
 gi|301637948|gb|ADK83375.1| nitrogen-fixing NifU domain protein [Spirochaeta smaragdinae DSM
           11293]
          Length = 77

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVAN 174
            +  ++K+ +   +RP++  DGGDI       +G V + + GAC+GCP A  TLK GV  
Sbjct: 4   ELEGKVKKAI-QDIRPSLQADGGDIELVTVGENGKVSVRLTGACNGCPMAQITLKQGVER 62

Query: 175 ILNHFVPEVKDIRTV 189
            L   +PE+K +  V
Sbjct: 63  YLKETIPEIKSVDAV 77


>gi|218246615|ref|YP_002371986.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8801]
 gi|218167093|gb|ACK65830.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8801]
          Length = 294

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 62/166 (37%), Gaps = 14/166 (8%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLR---------PPVLGMIMEHF 85
           +       + I    G+         + +  D    E +             L  I +  
Sbjct: 132 DHHEDDEGALICKCFGVTDARI--RRVIIENDLTTAEQVTNYVKAGGGCSSCLSDIDDIL 189

Query: 86  ISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
                          ++           ++   +  I+++LD  ++PA+A+DGGD+    
Sbjct: 190 ADITQEKATAVTAATEVVQSKLTPQKPLNNLQKITLIQQILDEEIKPALAKDGGDVELFD 249

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
               +V + ++GAC  C S+++TLK G+   L   V PE+  + +V
Sbjct: 250 VEGDLVKVILQGACGSCASSTQTLKMGIEARLRERVSPELT-VISV 294


>gi|256827631|ref|YP_003151590.1| thioredoxin-like protein [Cryptobacterium curtum DSM 15641]
 gi|256583774|gb|ACU94908.1| thioredoxin-like protein [Cryptobacterium curtum DSM 15641]
          Length = 75

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           V +     +   VRP++  DGGD+       DG V + ++GAC GCP +  TL +G+  I
Sbjct: 2   VNKEDVAAVLELVRPSLQADGGDVRLVDVMEDGTVTVELQGACQGCPMSQMTLAHGIERI 61

Query: 176 LNHFVPEVKDIRT 188
           L   VP V+ +  
Sbjct: 62  LKDRVPGVQQVVP 74


>gi|134300123|ref|YP_001113619.1| NifU domain-containing protein [Desulfotomaculum reducens MI-1]
 gi|134052823|gb|ABO50794.1| nitrogen-fixing NifU domain protein [Desulfotomaculum reducens
           MI-1]
          Length = 74

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++KE L  +VRP + RDGGD+ F    +  +V + +RGAC  CP A  TLK G+  +
Sbjct: 1   MKEQVKEAL-EQVRPFLQRDGGDVEFVDCDEKGVVKVKLRGACGSCPGALYTLKNGIERV 59

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V ++  V
Sbjct: 60  LKQQVPGVTEVVRV 73


>gi|218289813|ref|ZP_03494013.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|258510957|ref|YP_003184391.1| nitrogen-fixing NifU domain-containing protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218240104|gb|EED07289.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|257477683|gb|ACV58002.1| nitrogen-fixing NifU domain protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 81

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 3/81 (3%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETL 168
           +   ++   RI+E +   +R A+ +DGGD+ F  Y D    V++S++GAC GCP++  TL
Sbjct: 2   MSDVTSTEARIREAI-ESIREAIQQDGGDVEFVSYDDLSKTVYVSLQGACVGCPASVMTL 60

Query: 169 KYGVANILNHFVPEVKDIRTV 189
           K G+   +    P+V+ +  V
Sbjct: 61  KMGIERAVKKVAPDVEYVEAV 81


>gi|148263012|ref|YP_001229718.1| NifU domain-containing protein [Geobacter uraniireducens Rf4]
 gi|146396512|gb|ABQ25145.1| nitrogen-fixing NifU domain protein [Geobacter uraniireducens Rf4]
          Length = 73

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
           + + +RP +  DGGD+      +  +V + + GAC  CP ++ TLK G+   L   VP V
Sbjct: 8   VLDLIRPNLQADGGDVELVEVTEDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGV 67

Query: 184 KDIRTV 189
           K++ +V
Sbjct: 68  KEVISV 73


>gi|218886099|ref|YP_002435420.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757053|gb|ACL07952.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 77

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVA 173
            A+ +R++  LD  VRP +  DGGD+         +V + + GAC GCP + +TLK GV 
Sbjct: 3   DAIHERVQAALDK-VRPYLQGDGGDVELVEITADGVVRVRLTGACKGCPMSQQTLKGGVE 61

Query: 174 NILNHFVPEVKDIRTV 189
            ++   V EVK +  V
Sbjct: 62  RMVLKEVAEVKRVEAV 77


>gi|332982274|ref|YP_004463715.1| nitrogen-fixing NifU domain-containing protein [Mahella
           australiensis 50-1 BON]
 gi|332699952|gb|AEE96893.1| nitrogen-fixing NifU domain protein [Mahella australiensis 50-1
           BON]
          Length = 73

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   E    ++RPA+  DGGD+       DG+V + + GAC  CP A  TLK G+   L
Sbjct: 1   MKEKVEAALEKIRPALKADGGDVELVDVASDGVVKVKLTGACGACPFALMTLKQGIEETL 60

Query: 177 NHFVPEVKDIRTV 189
              VPEVK++  V
Sbjct: 61  KESVPEVKEVVAV 73


>gi|220931159|ref|YP_002508067.1| nitrogen-fixing NifU domain protein [Halothermothrix orenii H 168]
 gi|219992469|gb|ACL69072.1| nitrogen-fixing NifU domain protein [Halothermothrix orenii H 168]
          Length = 74

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           + +++RP++  DGGD+      D   IV + + GAC GCP ++ T+K G+  +L   VP 
Sbjct: 8   IIDKIRPSLQADGGDVKLVDVDDEKGIVKVKLLGACQGCPMSTMTIKNGIERVLKEKVPG 67

Query: 183 VKDIRTV 189
           VK+++ V
Sbjct: 68  VKEVKPV 74


>gi|295697085|ref|YP_003590323.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
 gi|295412687|gb|ADG07179.1| nitrogen-fixing NifU domain protein [Bacillus tusciae DSM 2912]
          Length = 277

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 34/64 (53%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
            +   VRP +   GGD+        +V++ + GACSGC  ++ TL+ GV   +   VPEV
Sbjct: 92  AVLEEVRPYMRSHGGDVELVKVEADVVYVRLHGACSGCSLSALTLRDGVEEAVKARVPEV 151

Query: 184 KDIR 187
           + + 
Sbjct: 152 RRVE 155


>gi|257059658|ref|YP_003137546.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8802]
 gi|256589824|gb|ACV00711.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 8802]
          Length = 294

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 62/166 (37%), Gaps = 14/166 (8%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLR---------PPVLGMIMEHF 85
           +       + I    G+         + +  D    E +             L  I +  
Sbjct: 132 DHHEDDEGALICKCFGVTDARI--RRVIIENDLTTAEQVTNYVKAGGGCSSCLSDIDDIL 189

Query: 86  ISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
                          ++           ++   +  I+++LD  ++PA+A+DGGD+    
Sbjct: 190 ADITQEKATAVTAATEVVQSKLTPQKPLNNLQKITLIQQILDEEIKPALAKDGGDVELFD 249

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
               +V + ++GAC  C S+++TLK G+   L   V PE+  + +V
Sbjct: 250 VEGDLVKVILQGACGSCASSTQTLKMGIEARLRERVSPELT-VISV 294


>gi|261409236|ref|YP_003245477.1| nitrogen-fixing NifU domain-containing protein [Paenibacillus sp.
           Y412MC10]
 gi|315649387|ref|ZP_07902475.1| nitrogen-fixing NifU domain protein [Paenibacillus vortex V453]
 gi|329926903|ref|ZP_08281306.1| NifU-like protein [Paenibacillus sp. HGF5]
 gi|261285699|gb|ACX67670.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. Y412MC10]
 gi|315275163|gb|EFU38533.1| nitrogen-fixing NifU domain protein [Paenibacillus vortex V453]
 gi|328938890|gb|EGG35263.1| NifU-like protein [Paenibacillus sp. HGF5]
          Length = 81

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           + +++RP + RDGGD+      DGIV L + GAC  CPS++ TLK G+   L   V  ++
Sbjct: 16  VLDKLRPFLQRDGGDVELVDVEDGIVKLKLMGACGSCPSSTITLKAGIERALVEEVEGIQ 75

Query: 185 DIRTV 189
           ++  V
Sbjct: 76  EVVQV 80


>gi|298528227|ref|ZP_07015631.1| nitrogen-fixing NifU domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511879|gb|EFI35781.1| nitrogen-fixing NifU domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 73

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   + +  ++RP++  DGGD+       D +V + ++GAC GCP +  TLK G+  ++
Sbjct: 1   MKEQVQEVLEKIRPSLQADGGDVELVEVTEDNVVKVQLQGACKGCPMSQMTLKNGIERLI 60

Query: 177 NHFVPEVKDIRTV 189
              +P++K + +V
Sbjct: 61  MQELPQIKSVESV 73


>gi|218438784|ref|YP_002377113.1| Rieske (2Fe-2S) domain protein [Cyanothece sp. PCC 7424]
 gi|218171512|gb|ACK70245.1| Rieske (2Fe-2S) domain protein [Cyanothece sp. PCC 7424]
          Length = 309

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSAS 165
                     + +RI++ LD  VRP +    GD+          V + + G CS CP+++
Sbjct: 88  HELIKPPQPPLEKRIQQALDE-VRPGLKSHNGDVELVAIELPDTVKVRLVGTCSNCPAST 146

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            T+K GV   + ++ PE+  + ++
Sbjct: 147 LTMKQGVEQTIKNYCPEITQVISI 170


>gi|46579079|ref|YP_009887.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603338|ref|YP_967738.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris DP4]
 gi|46448492|gb|AAS95146.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563567|gb|ABM29311.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris DP4]
 gi|311232925|gb|ADP85779.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris RCH1]
          Length = 281

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 53/153 (34%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
           E +     +    GI                 +         G   +       I+    
Sbjct: 127 EHAHEGKLVCKCFGITDEQIIRAIRENNLKTVEDITHFTKAGGGCGDCLEEIRHILDVEL 186

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRG 156
             + +           ++   +Q + +VLD  +RP + +DGGDI         V +++RG
Sbjct: 187 GKEPECLTPLEPPKKLTNVQRMQLVMKVLDGEIRPRLQQDGGDIELVDMNGTEVMVALRG 246

Query: 157 ACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            C+ CPS+  TLK  V   L   V +   +R V
Sbjct: 247 MCTSCPSSQLTLKEFVERTLRDHVDQEIVVREV 279


>gi|2183204|gb|AAC33371.1| NifU [Cyanothece sp. PCC 8801]
          Length = 294

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 62/166 (37%), Gaps = 14/166 (8%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLR---------PPVLGMIMEHF 85
           +       + I    G+         + +  D    E +             L  I +  
Sbjct: 132 DHHEDDEGALICKCFGVTDARI--RRVIIENDLTTAEQVTNYVKAGGGCSSCLSDIDDIL 189

Query: 86  ISGDPIIHNGGLGDMKLDDMGSGDFIE-SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
                          +L           ++   +  I+++LD  ++PA+A+DGGD+    
Sbjct: 190 ADITQEKATAVTAATELVQSKLTPQKPLNNLQKITLIQQILDEEIKPALAKDGGDVELFD 249

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
               +V + ++GAC  C S+++TLK G+   L   V PE+  + +V
Sbjct: 250 VEGDLVKVILQGACGSCASSTQTLKMGIEARLRERVSPELT-VISV 294


>gi|67922888|ref|ZP_00516385.1| Aminotransferase, class V:Nitrogen-fixing NifU, C-terminal
           [Crocosphaera watsonii WH 8501]
 gi|67855238|gb|EAM50500.1| Aminotransferase, class V:Nitrogen-fixing NifU, C-terminal
           [Crocosphaera watsonii WH 8501]
          Length = 469

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 3/129 (2%)

Query: 62  TVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRI 121
           +V +    +   R      I         II +      +++D  +    +        I
Sbjct: 343 SVLQGSIRFSLSRYTTQEEINRVIEIVPDIISHLRSITPRIEDETTSSPTKE-QEKANLI 401

Query: 122 KEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV- 180
           +++L+  V+P +A+DGGDI        +V + ++GAC  CPS++ TLK  +   L   V 
Sbjct: 402 QQILEEEVKPFLAQDGGDIDLYDIEGDLVKVVLKGACDACPSSTATLKLAIEARLKDRVD 461

Query: 181 PEVKDIRTV 189
           PE+  +  V
Sbjct: 462 PELT-VIAV 469


>gi|195952454|ref|YP_002120744.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932066|gb|ACG56766.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 87

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVAN 174
             V+ ++E LD  +RPA+  DGGDI      +   V + + GACSGC  ++ TLK GV  
Sbjct: 4   PTVEEVEEALDE-IRPALRFDGGDIELVSIEEDGTVLVRLMGACSGCGMSTLTLKAGVER 62

Query: 175 ILNHFVPEVKDIRTV 189
            L    P++K+++ V
Sbjct: 63  ALKQKFPDIKEVKDV 77


>gi|156088839|ref|XP_001611826.1| NifU-like domain containing protein [Babesia bovis]
 gi|154799080|gb|EDO08258.1| NifU-like domain containing protein [Babesia bovis]
          Length = 123

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSA 164
              + E+D  VV  IK ++D R+ P V +DGGD+ F  Y      V++ + GAC GC  +
Sbjct: 23  PSSYSEADLEVVDSIKLLIDKRIAPVVRQDGGDVSFISYDPETGFVYVRLSGACVGCAQS 82

Query: 165 SETLKYGVANILNHFVPEVKDI 186
             TLK+ +   L H++ +V  +
Sbjct: 83  DITLKHMIQGTLCHYLDDVTGV 104


>gi|119503957|ref|ZP_01626038.1| hypothetical protein MGP2080_09413 [marine gamma proteobacterium
           HTCC2080]
 gi|119459960|gb|EAW41054.1| hypothetical protein MGP2080_09413 [marine gamma proteobacterium
           HTCC2080]
          Length = 191

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIV-FLSMRGACSGCPSASETLKYGV 172
           DS +  RI  VL N V P++A  GG++      D  +  L   G C GC + S TLK GV
Sbjct: 104 DSPIEDRINYVLYNEVNPSLAAHGGEVSLVEITDDALAILRFGGGCQGCSAVSMTLKDGV 163

Query: 173 ANILNHFVPEVKDIRTV 189
              L   VPE+  +R V
Sbjct: 164 EKTLLEQVPELSGVRDV 180


>gi|298527898|ref|ZP_07015302.1| Fe-S cluster assembly protein NifU [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511550|gb|EFI35452.1| Fe-S cluster assembly protein NifU [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 281

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 54/157 (34%)

Query: 33  AKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPII 92
            + A        +    G+                 +         G   +     + ++
Sbjct: 123 EEAATRDLEGEVVCECFGVTDEEIKRAIRDNNLTSVEDVTHYTKAGGGCEDCHAEIEKLL 182

Query: 93  HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL 152
                  +   +  S +   ++   +Q +  V+D  +RP++ +DGGDI         V +
Sbjct: 183 DQVRSQTLTPVEPVSEERPMTNIKRMQLVTRVVDEEIRPSLHKDGGDIELVDIEGPKVMV 242

Query: 153 SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           S RGAC+GCPS+  T K  V   L   V     +  V
Sbjct: 243 SFRGACAGCPSSHLTAKEVVEKKLKERVDSQIQVEEV 279


>gi|298490557|ref|YP_003720734.1| Fe-S cluster assembly protein NifU ['Nostoc azollae' 0708]
 gi|298232475|gb|ADI63611.1| Fe-S cluster assembly protein NifU ['Nostoc azollae' 0708]
          Length = 306

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 59/164 (35%), Gaps = 9/164 (5%)

Query: 28  IHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFIS 87
              ++ K  ++    + + +      V  G    +              ++  + + F  
Sbjct: 148 FSITDTKIRKVIAQNNLLSAEQVTNYVKAGGGCGSCLA-------KIDDIIKEVKQEFAK 200

Query: 88  GDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR--IKEVLDNRVRPAVARDGGDIVFKGY 145
            +   +             S    E  + V +   I++VLD  VRP +  DGGD+     
Sbjct: 201 ENLHTNGAKAKTEVSVLNNSLWQQEPLTNVRKVALIQKVLDEEVRPVLIADGGDVELYDV 260

Query: 146 RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
               V + ++GAC  C S++ TLK  + + L   + +   +  V
Sbjct: 261 EGDKVKVVLQGACGSCSSSTATLKIAIESRLRDRISKEIIVEAV 304


>gi|90021654|ref|YP_527481.1| hypothetical protein Sde_2009 [Saccharophagus degradans 2-40]
 gi|89951254|gb|ABD81269.1| HesB/YadR/YfhF [Saccharophagus degradans 2-40]
          Length = 203

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYG 171
            DS +  RI  VL N V P +A  GG++  +   D +  +    G C GC +   TLK G
Sbjct: 115 EDSTIEDRINYVLYNEVNPGLAAHGGNVSLEAITDDMHIVLKFGGGCQGCSAVDMTLKQG 174

Query: 172 VANILNHFVPEVKDIRT 188
           V   L   VPE+K +R 
Sbjct: 175 VEKTLMERVPEIKGVRD 191


>gi|110596893|ref|ZP_01385183.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031]
 gi|110341580|gb|EAT60040.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031]
          Length = 86

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPS 163
             S D++ +  A+  R+   L   VRP +  DGGD    G  +D +V + + GAC  CP 
Sbjct: 2   STSKDYLPNSDAIYDRVIAAL-ETVRPYLQVDGGDCQLVGISKDMVVDVKLLGACGSCPM 60

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
           ++ TL+ GV   +    PE+  + +V
Sbjct: 61  STLTLRAGVEQAIKKANPEIVRVESV 86


>gi|313673639|ref|YP_004051750.1| nitrogen-fixing nifu domain protein [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940395|gb|ADR19587.1| nitrogen-fixing NifU domain protein [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 75

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +  +VRPA+  DGGD+   G  D  +V + + GAC  CP ++ TLK+G+   L   +P
Sbjct: 8   EEVLKKVRPALQADGGDVELLGVTDDGVVKVQLTGACGSCPFSTMTLKHGIEMRLKDEIP 67

Query: 182 EVKDIRT 188
           E+K++ +
Sbjct: 68  EIKEVVS 74


>gi|315187331|gb|EFU21087.1| nitrogen-fixing NifU domain protein [Spirochaeta thermophila DSM
           6578]
          Length = 74

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E + N +RPA+  DGGDI      +  +V + + GAC GCP +  TLK GV   L   +P
Sbjct: 7   EKVINEIRPALKADGGDIQLLEVTEQGVVKVRLTGACHGCPMSQITLKQGVEAYLKRKLP 66

Query: 182 EVKDIRTV 189
           E+  +  V
Sbjct: 67  EISSVEAV 74


>gi|21674600|ref|NP_662665.1| NifU protein, putative [Chlorobium tepidum TLS]
 gi|21647799|gb|AAM73007.1| nifU protein, putative [Chlorobium tepidum TLS]
          Length = 83

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASET 167
           D++     +  ++   L   VRP +  DGGD    G  +D +V + + GAC  CP ++ T
Sbjct: 3   DYLPKTDPLYDKVISAL-ETVRPYLQVDGGDCQLVGITKDMVVDVKLLGACGSCPMSTLT 61

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           L+ GV   +    PE+  + +V
Sbjct: 62  LRAGVEQAIKKANPEIVRVESV 83


>gi|164688813|ref|ZP_02212841.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM
           16795]
 gi|164602289|gb|EDQ95754.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM
           16795]
          Length = 73

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           ++     + ++VRP + RDGGD+      D  +V + ++GACSGCP A+ TLK  + N+L
Sbjct: 1   MKEQVAAVLDKVRPVLQRDGGDVELVEVSDDGVVLVRLKGACSGCPGATMTLKAVIENLL 60

Query: 177 NHFVPEVKDIRTV 189
              VP V  +  V
Sbjct: 61  VKEVPGVTRVVGV 73


>gi|237734458|ref|ZP_04564939.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229382278|gb|EEO32369.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 75

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 43/67 (64%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK GV  IL   VP 
Sbjct: 3   EKVINKLRPYLNRDGGDIELIDFKDGIVYVKMLGACAGCSMLDETLKDGVEQILMEEVPG 62

Query: 183 VKDIRTV 189
           V  ++ +
Sbjct: 63  VLGVQNI 69


>gi|296449646|ref|ZP_06891419.1| NifU family protein [Clostridium difficile NAP08]
 gi|296878033|ref|ZP_06902051.1| NifU family protein [Clostridium difficile NAP07]
 gi|296261502|gb|EFH08324.1| NifU family protein [Clostridium difficile NAP08]
 gi|296430988|gb|EFH16817.1| NifU family protein [Clostridium difficile NAP07]
          Length = 95

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++++VL+ +++P + RDGGD+      +  +V + ++GACSGCP A+ T+K  + N+
Sbjct: 22  MREKVEKVLEEKIKPVLQRDGGDVELIDVNENGVVLVRLQGACSGCPGATMTIKAIIENV 81

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V  +  V
Sbjct: 82  LVSEVPGVTQVLGV 95


>gi|302389972|ref|YP_003825793.1| nitrogen-fixing NifU domain protein [Thermosediminibacter oceani
           DSM 16646]
 gi|302200600|gb|ADL08170.1| nitrogen-fixing NifU domain protein [Thermosediminibacter oceani
           DSM 16646]
          Length = 74

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVAN 174
           + ++++EVL+  +RP++  DGGD+      +   IV + + G+C GCP ++ TLK G+  
Sbjct: 1   MKEKVQEVLNK-IRPSLQADGGDVELVDVDEEKGIVKVRLTGSCFGCPFSTLTLKNGIEQ 59

Query: 175 ILNHFVPEVKDIRTV 189
           +L   VP VK++++V
Sbjct: 60  VLKEEVPGVKEVQSV 74


>gi|163781905|ref|ZP_02176905.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883125|gb|EDP76629.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 87

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E + + +RPA+  DGGD+     ++   V + + GACSGC  +  TLK G+   L    P
Sbjct: 10  EKVLDEIRPALRFDGGDVELVDIQEDGTVLVRLVGACSGCGMSVLTLKAGIERALKQKFP 69

Query: 182 EVKDIRTV 189
           E+K+++ V
Sbjct: 70  EIKEVKDV 77


>gi|313675047|ref|YP_004053043.1| nitrogen-fixing nifu domain protein [Marivirga tractuosa DSM 4126]
 gi|312941745|gb|ADR20935.1| nitrogen-fixing NifU domain protein [Marivirga tractuosa DSM 4126]
          Length = 91

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            V+ RI++ LD+ +RP +  DGG++      +G++ L + GAC  CP ++ TLK GV   
Sbjct: 2   DVLDRIEKALDS-IRPYLEADGGNVRILDLNEGVLRLELLGACGNCPMSTMTLKAGVEEA 60

Query: 176 LNHFVPEVKDIRTV 189
           +   VPEV  +  V
Sbjct: 61  VKKSVPEVTSVEAV 74


>gi|256372488|ref|YP_003110312.1| nitrogen-fixing NifU domain protein [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256009072|gb|ACU54639.1| nitrogen-fixing NifU domain protein [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 204

 Score = 77.5 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 46/103 (44%)

Query: 87  SGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
               ++        +  D+         S + +R+  +L  +V PA+A  GG     G  
Sbjct: 86  DDGDLVIENPNAPTRQSDLPEFGPEALTSDLARRVDSILQEQVNPAIAAHGGYAELVGVV 145

Query: 147 DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           D + ++ M G C GC  AS TL  G+A  +   VPE++D+  V
Sbjct: 146 DEVAYVLMGGGCQGCGLASATLTQGIAVAIRDAVPEIRDVVDV 188


>gi|309810977|ref|ZP_07704775.1| NifU-like protein [Dermacoccus sp. Ellin185]
 gi|308434941|gb|EFP58775.1| NifU-like protein [Dermacoccus sp. Ellin185]
          Length = 219

 Score = 77.5 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 73/188 (38%), Gaps = 8/188 (4%)

Query: 6   EDTPNPATLK--FIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFITV 63
           E TP+P  ++  F   +  +  GA+  +   EA        + S PG   V         
Sbjct: 9   EATPDPDVVRWRFSGARCDVPLGAL--AAWPEALTRAGVGDVVSEPGALVVMLSAPHTW- 65

Query: 64  GKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIE---SDSAVVQR 120
             D          VL      F++ +P            D    G+  E    D+ + ++
Sbjct: 66  ASDGAAVRDALSDVLADASSRFVAREPGGVEPSDASSNADGDAVGELDEGAADDTEIAEQ 125

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
            + V+ +         GGDI   G   G+V +S+ GAC GCP+A+ TL   + + L   V
Sbjct: 126 ARVVVADVAEQVAHSHGGDITLLGVERGVVTVSLTGACDGCPAAAMTLHRRIEDELRARV 185

Query: 181 PEVKDIRT 188
             V+++R 
Sbjct: 186 GGVREVRA 193


>gi|302335395|ref|YP_003800602.1| nitrogen-fixing NifU domain protein [Olsenella uli DSM 7084]
 gi|301319235|gb|ADK67722.1| nitrogen-fixing NifU domain protein [Olsenella uli DSM 7084]
          Length = 85

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASET 167
              E+ + + + + E   + +R ++  DGGD+   G+ D  +V L M+GAC+GCP +S  
Sbjct: 1   MAEETKTPINRELLEATLDVIRQSLQADGGDVALVGFNDEGVVTLEMQGACAGCPLSSLD 60

Query: 168 LKYGVANILNHFVPEVKDIRT 188
           +  G+  IL   VP V  +  
Sbjct: 61  MSEGIERILKEHVPGVTKVEP 81


>gi|836637|emb|CAA83509.1| nifU [Nostoc sp. PCC 6720]
 gi|1091584|prf||2021269A dinitrogenase reductase
          Length = 87

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VLD  VRP +  DGGD+        IV + ++GAC  C S++ TLK  + + L   +
Sbjct: 18  IQKVLDEEVRPVLIADGGDVELYDVDGDIVKVVLQGACGSCSSSTATLKIAIESRLRDRI 77

Query: 181 -PEVKDIRTV 189
            P +  +  V
Sbjct: 78  NPSLVVVEAV 87


>gi|257064210|ref|YP_003143882.1| thioredoxin-like protein [Slackia heliotrinireducens DSM 20476]
 gi|256791863|gb|ACV22533.1| thioredoxin-like protein [Slackia heliotrinireducens DSM 20476]
          Length = 76

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E +   +RP++  DGGD+       DG+V + + GAC+GCP +  TL  GV  +L   VP
Sbjct: 9   ERVLELIRPSLQADGGDLELVDVGDDGVVTVHLTGACNGCPLSQLTLANGVRRVLKERVP 68

Query: 182 EVKDIRTV 189
            V D+R V
Sbjct: 69  SVTDVRAV 76


>gi|83645334|ref|YP_433769.1| thioredoxin-like protein [Hahella chejuensis KCTC 2396]
 gi|83633377|gb|ABC29344.1| Thioredoxin-like protein [Hahella chejuensis KCTC 2396]
          Length = 192

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 44/109 (40%), Gaps = 2/109 (1%)

Query: 80  MIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD 139
            + E  +  +     G L     +       ++  S +  RI  +L   + P +A  GG+
Sbjct: 73  YLEEALVDFNTERMGGQLTIKAPN--AKMPKVDESSPLPDRINYILYTEINPGLASHGGE 130

Query: 140 IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +      D +  L   G C GC +   TLK GV   L   +PE+K +R 
Sbjct: 131 VSLVEVVDDVAVLKFGGGCQGCSAVDFTLKQGVEKTLLSKIPELKGVRD 179


>gi|32267366|ref|NP_861398.1| hypothetical protein HH1867 [Helicobacter hepaticus ATCC 51449]
 gi|32263419|gb|AAP78464.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 91

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
              ++   E++  +VRP +  DGGDI   G +D  V++ + GAC GCPS++ TLKY + N
Sbjct: 6   DEELKMPVEIVIQKVRPTLTLDGGDITLLGIKDAKVYVRLEGACKGCPSSANTLKYAIEN 65

Query: 175 ILNHFV-PEVKDI 186
            L   + P++  +
Sbjct: 66  RLKEEIHPDIAIV 78


>gi|126641029|ref|YP_001084013.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter baumannii ATCC 17978]
          Length = 156

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  VL   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 64  DASIEERITYVLQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTL 123

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 124 KQGVETTLKEHIPELQRVVD 143


>gi|218778425|ref|YP_002429743.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759809|gb|ACL02275.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 74

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   +   + +RP + RDGGD+       DG+V + + GAC GCP + +TLK G+   +
Sbjct: 1   MKEQVKAAIDEIRPTLQRDGGDVELVEVGDDGVVKVRLVGACKGCPMSQQTLKNGIEKYM 60

Query: 177 NHFVPEVKDIRTV 189
              +P VK +  V
Sbjct: 61  KKNIPGVKSVEGV 73


>gi|304317418|ref|YP_003852563.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778920|gb|ADL69479.1| nitrogen-fixing NifU domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 73

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   E + N +RP++  DGGD+      D  +V + + GAC GCP A  TLK G+   +
Sbjct: 1   MKERVEEVLNLLRPSLQADGGDVELIDVTDDGVVQVKLTGACGGCPFAVMTLKEGIERAI 60

Query: 177 NHFVPEVKDIRT 188
              +PEVK++  
Sbjct: 61  KEELPEVKEVVA 72


>gi|224437749|ref|ZP_03658696.1| hypothetical protein HcinC1_07235 [Helicobacter cinaedi CCUG 18818]
 gi|313144195|ref|ZP_07806388.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129226|gb|EFR46843.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 86

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
              +Q   E++ ++VRP +  DGGDI   G RD  V++ + GAC GCPS++ TLKY + N
Sbjct: 6   DEELQTPVELVIDKVRPTLTLDGGDITLLGIRDAKVYVRLEGACKGCPSSANTLKYAIEN 65

Query: 175 ILNHFV-PEVKDI 186
            L   + P++  +
Sbjct: 66  RLKEEIHPDIAIV 78


>gi|148244538|ref|YP_001219232.1| hypothetical protein COSY_0386 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|254767332|sp|A5CX22|NFUA_VESOH RecName: Full=Fe/S biogenesis protein nfuA
 gi|146326365|dbj|BAF61508.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 192

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI-VFLSMRGACSGCPS 163
              G+  + D+ + ++IK V+   + P +A  GG +   G    I V L+  G C GC S
Sbjct: 96  NAKGEEPKEDAPLEEKIKYVIAADITPGLASHGGFVELVGITKQIDVILNFGGGCQGCSS 155

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
              TL+ GV   L    PE+K +R V
Sbjct: 156 VKSTLEQGVEAQLKARFPEIKSVRDV 181


>gi|224543029|ref|ZP_03683568.1| hypothetical protein CATMIT_02223 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524054|gb|EEF93159.1| hypothetical protein CATMIT_02223 [Catenibacterium mitsuokai DSM
           15897]
          Length = 84

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E     ++ IKEV+   +RP + RDGGD+ F  ++DGIV++ M GAC+GC     T+K G
Sbjct: 8   EIMEEKIEAIKEVIHK-LRPYLQRDGGDLEFVDFKDGIVYVHMLGACAGCMMLDSTIKDG 66

Query: 172 VANILNHFVPEVKDIRTV 189
           V  IL   VP V +++ +
Sbjct: 67  VEQILIEEVPGVIEVQAI 84


>gi|34558002|ref|NP_907817.1| hypothetical protein WS1690 [Wolinella succinogenes DSM 1740]
 gi|34483720|emb|CAE10717.1| conserved hypothetical protein-Thioredoxin-like proteins and
           domains [Wolinella succinogenes]
          Length = 91

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 2/75 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ + E +  +VRP +A DGGD+   G     V++ + GAC GC S++ TLK G+
Sbjct: 5   SDDDLLKPV-ERVLEKVRPTLALDGGDVSLIGVAAPKVYVRLEGACKGCASSALTLKNGI 63

Query: 173 ANILNHFV-PEVKDI 186
              +   + PE++ +
Sbjct: 64  ERQMRLEIHPEIEIV 78


>gi|312144147|ref|YP_003995593.1| nitrogen-fixing NifU domain protein [Halanaerobium sp.
           'sapolanicus']
 gi|311904798|gb|ADQ15239.1| nitrogen-fixing NifU domain protein [Halanaerobium sp.
           'sapolanicus']
          Length = 73

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   +   +++RP++  DGGD+      +  IV + + GACSGCP ++ T+K G+   L
Sbjct: 1   MKEEVQKYLDKIRPSLQADGGDVELVEVTEEGIVKVKLLGACSGCPMSTLTIKNGIERTL 60

Query: 177 NHFVPEVKDIRTV 189
              V  VK+++ V
Sbjct: 61  KQNVDGVKEVQPV 73


>gi|255536379|ref|YP_003096750.1| Nitrogen-fixing NifU, C-terminal [Flavobacteriaceae bacterium
           3519-10]
 gi|255342575|gb|ACU08688.1| Nitrogen-fixing NifU, C-terminal [Flavobacteriaceae bacterium
           3519-10]
          Length = 77

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 40/67 (59%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
                ++RP + +DGGDI     R+ IV++ ++G C+GCP +  T+K GV N +    PE
Sbjct: 10  MYALEKIRPFLNKDGGDIELVDVRESIVYVKLQGNCNGCPMSFSTMKLGVENTIKQHAPE 69

Query: 183 VKDIRTV 189
           ++++  V
Sbjct: 70  IQEVINV 76


>gi|307151545|ref|YP_003886929.1| Rieske (2Fe-2S) iron-sulfur domain-containing protein [Cyanothece
           sp. PCC 7822]
 gi|306981773|gb|ADN13654.1| Rieske (2Fe-2S) iron-sulfur domain protein [Cyanothece sp. PCC
           7822]
          Length = 292

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSAS 165
                     + +R+ + L   VRP +    GD+          V + + G CS CP+++
Sbjct: 88  HELIKPPQPPLEKRLNQAL-EEVRPGLKSHNGDVELVAIELPDTVKVRLVGTCSNCPAST 146

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            T+K GV   + ++ PE+  + +V
Sbjct: 147 LTMKQGVEQTIKNYCPEITHVISV 170


>gi|169796823|ref|YP_001714616.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter baumannii AYE]
 gi|184157261|ref|YP_001845600.1| thioredoxin-like protein [Acinetobacter baumannii ACICU]
 gi|213156785|ref|YP_002318446.1| IscR-regulated protein YhgI [Acinetobacter baumannii AB0057]
 gi|215484301|ref|YP_002326528.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB307-0294]
 gi|239502990|ref|ZP_04662300.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB900]
 gi|260555913|ref|ZP_05828133.1| iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii ATCC 19606]
 gi|301346712|ref|ZP_07227453.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB056]
 gi|301511819|ref|ZP_07237056.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB058]
 gi|301594411|ref|ZP_07239419.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB059]
 gi|332853697|ref|ZP_08434927.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6013150]
 gi|332870876|ref|ZP_08439521.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6013113]
 gi|332872882|ref|ZP_08440846.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6014059]
 gi|254767282|sp|B7GXX8|NFUA_ACIB3 RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767283|sp|B7I8Q3|NFUA_ACIB5 RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767284|sp|B2HVD2|NFUA_ACIBC RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767286|sp|B0V9L0|NFUA_ACIBY RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767504|sp|A3M3B7|NFUA_ACIBT RecName: Full=Fe/S biogenesis protein nfuA
 gi|169149750|emb|CAM87641.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter baumannii AYE]
 gi|183208855|gb|ACC56253.1| Thioredoxin-like protein [Acinetobacter baumannii ACICU]
 gi|193076708|gb|ABO11411.2| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter baumannii ATCC 17978]
 gi|213055945|gb|ACJ40847.1| IscR-regulated protein YhgI [Acinetobacter baumannii AB0057]
 gi|213988281|gb|ACJ58580.1| Iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii AB307-0294]
 gi|260410824|gb|EEX04122.1| iron-sulphur cluster biosynthesis family protein [Acinetobacter
           baumannii ATCC 19606]
 gi|322507146|gb|ADX02600.1| thioredoxin-like protein [Acinetobacter baumannii 1656-2]
 gi|323517125|gb|ADX91506.1| thioredoxin-like protein [Acinetobacter baumannii TCDC-AB0715]
 gi|332728521|gb|EGJ59895.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6013150]
 gi|332731977|gb|EGJ63255.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6013113]
 gi|332738893|gb|EGJ69756.1| IscR-regulated protein YhgI [Acinetobacter baumannii 6014059]
          Length = 212

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  VL   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYVLQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLKEHIPELQRVVD 199


>gi|262279919|ref|ZP_06057704.1| IscR-regulated protein YhgI [Acinetobacter calcoaceticus RUH2202]
 gi|262260270|gb|EEY79003.1| IscR-regulated protein YhgI [Acinetobacter calcoaceticus RUH2202]
          Length = 212

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYILQAEINPGLAGHGGNCSLVEVQDNPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLREHIPELQRVVD 199


>gi|23099811|ref|NP_693277.1| nitrogen fixation protein [Oceanobacillus iheyensis HTE831]
 gi|22778042|dbj|BAC14312.1| nitrogen fixation protein (NifU protein) [Oceanobacillus iheyensis
           HTE831]
          Length = 74

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANIL 176
           +Q   + + N++RP + RDGGD+      +  +V L + GAC  CPS++ TLK G+   L
Sbjct: 1   MQEQVQEVLNKLRPFLLRDGGDVELIDVDEEGVVLLRLMGACGNCPSSTITLKAGIERAL 60

Query: 177 NHFVPEVKDIRTV 189
              VP V++I  V
Sbjct: 61  MAEVPGVREIEQV 73


>gi|260551205|ref|ZP_05825408.1| iron-sulphur cluster biosynthesis family protein [Acinetobacter sp.
           RUH2624]
 gi|260405810|gb|EEW99299.1| iron-sulphur cluster biosynthesis family protein [Acinetobacter sp.
           RUH2624]
          Length = 212

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  VL   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYVLQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLREHIPELQRVVD 199


>gi|242277615|ref|YP_002989744.1| Fe-S cluster assembly protein NifU [Desulfovibrio salexigens DSM
           2638]
 gi|242120509|gb|ACS78205.1| Fe-S cluster assembly protein NifU [Desulfovibrio salexigens DSM
           2638]
          Length = 279

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
              G I E               + +     +           Q + +V+D  +RPA+ +
Sbjct: 172 ECHGRIEEIITEVLTGEAAKPAPEPEKPAKLTNI------KRFQLVTKVIDEEIRPALNK 225

Query: 136 DGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRT 188
           DGGDI         V +S+RGAC GCPS+  TLK  V   L   V PE+  +R 
Sbjct: 226 DGGDIELIDIDGHEVIVSLRGACVGCPSSGRTLKDFVERRLKETVEPEI-SVRE 278


>gi|67921275|ref|ZP_00514794.1| Nitrogen-fixing NifU, C-terminal:Rieske [2Fe-2S] region
           [Crocosphaera watsonii WH 8501]
 gi|67857392|gb|EAM52632.1| Nitrogen-fixing NifU, C-terminal:Rieske [2Fe-2S] region
           [Crocosphaera watsonii WH 8501]
          Length = 286

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 54/140 (38%), Gaps = 19/140 (13%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS------------ 115
             W+  +  V+  + E   S         +  +K + + +      D             
Sbjct: 27  IQWDKNQQVVVERLKEAIESLHKEALTRLIKTVKKEALPALREAVEDELVYGILRYHDLI 86

Query: 116 -----AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLK 169
                 + +RI++ L   VRP +    GD+     +    V + + G CS CP+++ T+K
Sbjct: 87  KPPTPPLEKRIEQAL-ESVRPGLKSHHGDVELVAIKLPDTVEVQLVGTCSNCPASTLTMK 145

Query: 170 YGVANILNHFVPEVKDIRTV 189
            GV   +  + PE+  + +V
Sbjct: 146 QGVEQAIKTYCPEITKVISV 165


>gi|289548959|ref|YP_003473947.1| nitrogen-fixing NifU domain protein [Thermocrinis albus DSM 14484]
 gi|289182576|gb|ADC89820.1| nitrogen-fixing NifU domain protein [Thermocrinis albus DSM 14484]
          Length = 85

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E + + +RPA+  DGGD+       DG V + M GAC+GC  +  TLK G+   L    P
Sbjct: 8   EAVLDEIRPALRFDGGDVELVDVLEDGTVLVRMIGACAGCGMSVLTLKAGIERALKSRFP 67

Query: 182 EVKDIRTV 189
           ++K+++ V
Sbjct: 68  DIKEVKDV 75


>gi|325475673|gb|EGC78849.1| NifU domain-containing protein [Treponema denticola F0402]
          Length = 75

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           +RP +  DGGDI      + G V++ ++GAC  CP A  TLK GV   L    PEV ++ 
Sbjct: 14  IRPYLQADGGDIELDSVDEAGKVYVKLKGACGSCPMAIYTLKMGVEEQLKDMFPEVTEVV 73

Query: 188 TV 189
            V
Sbjct: 74  AV 75


>gi|126656503|ref|ZP_01727764.1| Fe-S cluster assembly protein NifU [Cyanothece sp. CCY0110]
 gi|126622189|gb|EAZ92896.1| Fe-S cluster assembly protein NifU [Cyanothece sp. CCY0110]
          Length = 293

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 61/165 (36%), Gaps = 13/165 (7%)

Query: 35  EAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRP---------PVLGMIMEHF 85
           +       + I    G+         I +  D    E +             L  I +  
Sbjct: 132 DNHEEDEGALICRCFGVTDSRI--RRIILENDLTTAEQVTNYVKAGGGCGSCLADIDDLI 189

Query: 86  ISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY 145
                          ++    S     ++   +  I++VL+  VRPA+A+DGGD+     
Sbjct: 190 AEIVQEKATAVAVATEVVKAKSESLPLTNLQKITLIQQVLEEEVRPALAQDGGDVDLFDV 249

Query: 146 RDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
              +V + ++GAC  CPS++ TLK  +   L   V P++  +  V
Sbjct: 250 DGDLVKVILKGACDSCPSSTATLKMAIEARLRDRVSPDLT-VIAV 293


>gi|283851976|ref|ZP_06369252.1| Fe-S cluster assembly protein NifU [Desulfovibrio sp. FW1012B]
 gi|283572700|gb|EFC20684.1| Fe-S cluster assembly protein NifU [Desulfovibrio sp. FW1012B]
          Length = 283

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             ++ + +V++  +RP + +DGGDI         V +S+RGAC GCP ++ TL   V N 
Sbjct: 208 ERMKLVTKVMEEEIRPNLKKDGGDIELVDIDGHTVVVSLRGACKGCPKSNLTLTEFVQNR 267

Query: 176 LNHFV-PEVKDIRT 188
           L   V PE+     
Sbjct: 268 LRELVEPEIVVKEA 281


>gi|192359576|ref|YP_001983001.1| yhgI protein [Cellvibrio japonicus Ueda107]
 gi|190685741|gb|ACE83419.1| yhgI protein [Cellvibrio japonicus Ueda107]
          Length = 197

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYG 171
            DS +  RI  VL N V P++A  GG++       D I  L   G C GC S + TLK G
Sbjct: 109 DDSPLEDRINYVLYNDVNPSLAAHGGNVSLVEVTEDMIAILKFGGGCQGCGSVALTLKQG 168

Query: 172 VANILNHFVPEVKDIRTV 189
           +   L   +PE+K IR V
Sbjct: 169 IEVQLMDKLPELKGIRDV 186


>gi|126698430|ref|YP_001087327.1| hypothetical protein CD0850 [Clostridium difficile 630]
 gi|254974469|ref|ZP_05270941.1| hypothetical protein CdifQC_04113 [Clostridium difficile QCD-66c26]
 gi|255091862|ref|ZP_05321340.1| hypothetical protein CdifC_04255 [Clostridium difficile CIP 107932]
 gi|255099963|ref|ZP_05328940.1| hypothetical protein CdifQCD-6_04105 [Clostridium difficile
           QCD-63q42]
 gi|255305852|ref|ZP_05350024.1| hypothetical protein CdifA_04615 [Clostridium difficile ATCC 43255]
 gi|255313596|ref|ZP_05355179.1| hypothetical protein CdifQCD-7_04573 [Clostridium difficile
           QCD-76w55]
 gi|255516280|ref|ZP_05383956.1| hypothetical protein CdifQCD-_04157 [Clostridium difficile
           QCD-97b34]
 gi|255649377|ref|ZP_05396279.1| hypothetical protein CdifQCD_04212 [Clostridium difficile
           QCD-37x79]
 gi|255654901|ref|ZP_05400310.1| hypothetical protein CdifQCD-2_04194 [Clostridium difficile
           QCD-23m63]
 gi|260682549|ref|YP_003213834.1| hypothetical protein CD196_0799 [Clostridium difficile CD196]
 gi|260686148|ref|YP_003217281.1| hypothetical protein CDR20291_0780 [Clostridium difficile R20291]
 gi|306519465|ref|ZP_07405812.1| hypothetical protein CdifQ_04665 [Clostridium difficile QCD-32g58]
 gi|115249867|emb|CAJ67684.1| putative NifU-like protein [Clostridium difficile]
 gi|260208712|emb|CBA61527.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260212164|emb|CBE02822.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 74

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++++VL+ +++P + RDGGD+      +  +V + ++GACSGCP A+ T+K  + N+
Sbjct: 1   MREKVEKVLEEKIKPVLQRDGGDVELIDVNENGVVLVRLQGACSGCPGATMTIKAIIENV 60

Query: 176 LNHFVPEVKDIRTV 189
           L   VP V  +  V
Sbjct: 61  LVSEVPGVTQVLGV 74


>gi|42525980|ref|NP_971078.1| NifU domain-containing protein [Treponema denticola ATCC 35405]
 gi|41816030|gb|AAS10959.1| NifU domain protein [Treponema denticola ATCC 35405]
          Length = 75

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP +  DGGDI      + G V++ ++GAC  CP A  TLK GV   L    PEV ++ 
Sbjct: 14  VRPYLQADGGDIELDSVDEAGKVYVKLKGACGSCPMAIYTLKMGVEEQLKDMFPEVTEVV 73

Query: 188 TV 189
            V
Sbjct: 74  AV 75


>gi|75910444|ref|YP_324740.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
 gi|1236928|gb|AAA93019.1| NifU2 [Anabaena variabilis ATCC 29413]
 gi|75704169|gb|ABA23845.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
          Length = 309

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 37/69 (53%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VLD  VRP +  DGGDI     +   V + ++GAC  CPS++ TLK  V   L   V
Sbjct: 231 IQKVLDEEVRPLLIADGGDIELYDVQGDNVQVVLQGACGSCPSSTATLKVAVEAKLQERV 290

Query: 181 PEVKDIRTV 189
            +   +  V
Sbjct: 291 SQSLRVEAV 299


>gi|226952464|ref|ZP_03822928.1| DNA uptake protein [Acinetobacter sp. ATCC 27244]
 gi|294649752|ref|ZP_06727157.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226836786|gb|EEH69169.1| DNA uptake protein [Acinetobacter sp. ATCC 27244]
 gi|292824361|gb|EFF83159.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 212

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L + + P +A  GG+      ++         L   G C GC +   TL
Sbjct: 120 DASIEERITYILQSEINPGLAGHGGNCSLVEVQEDAEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLRQHIPELQRVVD 199


>gi|168037489|ref|XP_001771236.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677477|gb|EDQ63947.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 165

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+    V+ + +VLD  VRP +  DGG++     +DG+V L ++GAC  CPS++ T+K G
Sbjct: 18  ETYEFTVENVDKVLDE-VRPYLIADGGNVEVVAVKDGVVSLRLQGACGTCPSSTSTMKMG 76

Query: 172 VANILNHFVPEV-KDIRTV 189
           +  +L     +V K++  V
Sbjct: 77  IERVLMEKFGDVLKEVVQV 95


>gi|331006512|ref|ZP_08329811.1| hypothetical protein IMCC1989_384 [gamma proteobacterium IMCC1989]
 gi|330419680|gb|EGG94047.1| hypothetical protein IMCC1989_384 [gamma proteobacterium IMCC1989]
          Length = 193

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPS 163
                 +  DS V  RI  VL N V P +A  GG +  +   +     L   G C GC +
Sbjct: 97  NSKMPQVNDDSPVEDRINYVLYNEVNPGLASHGGQVDLEDVTEDGFAILKFGGGCQGCSA 156

Query: 164 ASETLKYGVANILNHFVPEVKDIRTV 189
            S TLK GV   L   VPE+K ++ V
Sbjct: 157 VSLTLKEGVEKTLLEKVPELKGVKDV 182


>gi|319760689|ref|YP_004124627.1| Fe/S biogenesis protein nfuA [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039403|gb|ADV33953.1| Fe/S biogenesis protein nfuA [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 202

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 54/136 (39%), Gaps = 1/136 (0%)

Query: 54  VYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIES 113
           +   ++   +  ++     ++   + +I +   +   I        +          I +
Sbjct: 55  LKIQFNQFAIYLEKIIAPFIQNTQIDIITDDLRTQITIQSPNLTNSIDNPSDNINKKITN 114

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGV 172
           +S++  RIK V+  ++ P +A  GG +         +  L   G C+GC  A  T+K G+
Sbjct: 115 NSSLTDRIKYVITQQINPQLAMHGGSVSLIKVNTDGMAILQFHGGCNGCSMALYTIKEGI 174

Query: 173 ANILNHFVPEVKDIRT 188
              L  F PE+K +  
Sbjct: 175 EKTLKKFFPELKGVID 190


>gi|126656692|ref|ZP_01727906.1| hypothetical protein CY0110_23676 [Cyanothece sp. CCY0110]
 gi|126621912|gb|EAZ92620.1| hypothetical protein CY0110_23676 [Cyanothece sp. CCY0110]
          Length = 286

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +RI++ L   VRP +    GD+     +    V + + G CS CP+++ T+K GV  
Sbjct: 92  PLEKRIQQAL-ETVRPGLKSHHGDVELVAIKLPDTVEVQLVGTCSNCPASTLTMKQGVEQ 150

Query: 175 ILNHFVPEVKDIRTV 189
            +  + PE+K++ +V
Sbjct: 151 AIKTYCPEIKNVISV 165


>gi|319938275|ref|ZP_08012672.1| Fe/S-biogenesis protein NfuA [Coprobacillus sp. 29_1]
 gi|319806568|gb|EFW03226.1| Fe/S-biogenesis protein NfuA [Coprobacillus sp. 29_1]
          Length = 74

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +  +  + + I +     +RP + RDGGDI F  + +GIV++ M GAC+GC     TLK 
Sbjct: 1   MNQEEEIKKVIHK-----LRPYLQRDGGDIEFIKFEEGIVYVQMHGACAGCTMLDATLKD 55

Query: 171 GVANILNHFVPEVKDIRTV 189
           GV  IL   VP V +++ +
Sbjct: 56  GVEQILIEEVPGVLEVQAI 74


>gi|187250677|ref|YP_001875159.1| thioredoxin-like protein [Elusimicrobium minutum Pei191]
 gi|186970837|gb|ACC97822.1| Thioredoxin-like protein [Elusimicrobium minutum Pei191]
          Length = 74

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI--VFLSMRGACSGCPSASETLKYGVAN 174
           +  +I+EV+   ++P +  DGGD+ F  + +    V++S++G C GCP+A  TLK  +  
Sbjct: 1   MHSKIEEVIAK-IKPVLQADGGDLEFVSFDENTGTVYVSLKGRCGGCPAAQMTLKAVIER 59

Query: 175 ILNHFVPEVKDIRTV 189
            +   +PEVK +  V
Sbjct: 60  KIMQEIPEVKAVERV 74


>gi|167756739|ref|ZP_02428866.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402]
 gi|167702914|gb|EDS17493.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402]
          Length = 83

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           +E+ S + +   E + N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK 
Sbjct: 1   MENTSTIEE--VEKVINKLRPYLNRDGGDIELIDFKDGIVYVKMLGACAGCSMLDETLKD 58

Query: 171 GVANILNHFVPEVKDIRTV 189
           GV  IL   VP V  ++ +
Sbjct: 59  GVEQILMEEVPGVLGVQNI 77


>gi|75910119|ref|YP_324415.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
 gi|7387938|sp|Q43885|NIFU_ANAAZ RecName: Full=Nitrogen fixation protein nifU
 gi|762779|gb|AAA87250.1| NifU gene product [Anabaena azollae]
 gi|75703844|gb|ABA23520.1| Fe-S cluster assembly protein NifU [Anabaena variabilis ATCC 29413]
          Length = 300

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 43/119 (36%), Gaps = 5/119 (4%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR-----IKEVLDNRVR 130
             L  I +             L +       +         +        I++VLD  VR
Sbjct: 182 SCLAKIDDIIKDVKENKAATNLNNKGGSKPTNIPNSGQKRPLTNVQKIALIQKVLDEEVR 241

Query: 131 PAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           P +  DGGD+        IV + ++GAC  C S++ TLK  + + L   +     +  V
Sbjct: 242 PVLIADGGDVELYDVDGDIVKVVLQGACGSCSSSTATLKIAIESRLRDRINPSLVVEAV 300


>gi|17228950|ref|NP_485498.1| nitrogen fixation protein [Nostoc sp. PCC 7120]
 gi|128316|sp|P20628|NIFU_ANASP RecName: Full=Nitrogen fixation protein nifU
 gi|97707|pir||D34443 nitrogen fixation protein nifU - Anabaena sp
 gi|142038|gb|AAA22007.1| nifU [Nostoc sp. PCC 7120]
 gi|17130802|dbj|BAB73412.1| nitrogen fixation protein [Nostoc sp. PCC 7120]
          Length = 300

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 43/119 (36%), Gaps = 5/119 (4%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR-----IKEVLDNRVR 130
             L  I +             L +       +         +        I++VLD  VR
Sbjct: 182 SCLAKIDDIIKDVKENKAATNLNNKGGSKPTNIPNSGQKRPLTNVQKIALIQKVLDEEVR 241

Query: 131 PAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           P +  DGGD+        IV + ++GAC  C S++ TLK  + + L   +     +  V
Sbjct: 242 PVLIADGGDVELYDVDGDIVKVVLQGACGSCSSSTATLKIAIESRLRDRINPSLVVEAV 300


>gi|156743727|ref|YP_001433856.1| NifU domain-containing protein [Roseiflexus castenholzii DSM 13941]
 gi|156235055|gb|ABU59838.1| nitrogen-fixing NifU domain protein [Roseiflexus castenholzii DSM
           13941]
          Length = 291

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 36/66 (54%)

Query: 124 VLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEV 183
            + +  RP +   GGD+     R+ +V++ + G+C+GC  ++ TL+  +   L   VPE+
Sbjct: 101 RVLDAARPYIRSHGGDVELVEVRENVVYVRLHGSCNGCSLSAVTLRNEIEAALRANVPEI 160

Query: 184 KDIRTV 189
             ++ V
Sbjct: 161 VGVQVV 166


>gi|283768905|ref|ZP_06341815.1| NifU-like domain protein [Bulleidia extructa W1219]
 gi|283104458|gb|EFC05832.1| NifU-like domain protein [Bulleidia extructa W1219]
          Length = 100

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 101 KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSG 160
             D +           +++RI+  LD  +RP +  DGGD    G+ DG V +SM GAC G
Sbjct: 1   MPDVIDKIALDSERKELLKRIQHTLDK-IRPYIQADGGDCELVGFDDGTVIISMTGACQG 59

Query: 161 CPSASETLKYGVANILNHFVPEVKDIR 187
           C     TL  G+  IL   VPEVKD++
Sbjct: 60  CGIIDITLNDGIKAILMDEVPEVKDVK 86


>gi|325972864|ref|YP_004249055.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta sp.
           Buddy]
 gi|324028102|gb|ADY14861.1| nitrogen-fixing NifU domain-containing protein [Spirochaeta sp.
           Buddy]
          Length = 75

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-P 181
           +     +RP++  DGGDI F       V + ++GAC+GCP +  TLK GV   L +FV P
Sbjct: 6   KRAIEDIRPSLQNDGGDIEFVSLVGSDVTVRLKGACAGCPMSQMTLKSGVERYLRNFVDP 65

Query: 182 EVKDI 186
           ++  +
Sbjct: 66  KLTVV 70


>gi|262372009|ref|ZP_06065288.1| iron-sulfur cluster biosynthesis family protein [Acinetobacter
           junii SH205]
 gi|262312034|gb|EEY93119.1| iron-sulfur cluster biosynthesis family protein [Acinetobacter
           junii SH205]
          Length = 212

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  VL + + P +   GG+      ++         L   G C GC +   TL
Sbjct: 120 DASIEERITYVLQSEINPGLEGHGGNCSLVEVQNDPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   VPE++ +  
Sbjct: 180 KQGVETTLKQHVPELQRVVD 199


>gi|417363|sp|P33179|NIFU_ANASL RecName: Full=Nitrogen fixation protein nifU
 gi|2126543|pir||I39609 nifU protein - Anabaena sp. (fragment)
 gi|142056|gb|AAA22013.1| NifU [Anabaena sp. L-31]
          Length = 112

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 37/69 (53%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VLD  VRP +  DGGD+        IV + ++GAC  CPS++ TLK  + + L   +
Sbjct: 44  IQKVLDEEVRPVLIADGGDVELYDVDGDIVKVVLQGACGSCPSSTATLKIAIESRLRDRI 103

Query: 181 PEVKDIRTV 189
                +  V
Sbjct: 104 NPSLVVEAV 112


>gi|139438470|ref|ZP_01771986.1| Hypothetical protein COLAER_00976 [Collinsella aerofaciens ATCC
           25986]
 gi|133776009|gb|EBA39829.1| Hypothetical protein COLAER_00976 [Collinsella aerofaciens ATCC
           25986]
          Length = 67

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 140 IVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           + + G  D  +V L ++GAC+GCP +S TL  G+  IL   VP V  +  V
Sbjct: 1   MEYVGVDDEGVVKLELQGACAGCPMSSLTLSMGIERILKEHVPGVTRVEQV 51


>gi|242278148|ref|YP_002990277.1| nitrogen-fixing NifU domain protein [Desulfovibrio salexigens DSM
           2638]
 gi|242121042|gb|ACS78738.1| nitrogen-fixing NifU domain protein [Desulfovibrio salexigens DSM
           2638]
          Length = 74

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E   ++VRP +  DGG++      D  I  + ++GAC GCP +  TL+  +   L   +P
Sbjct: 6   EAALDKVRPLLQADGGNVELVEVTDKGIAKVRLQGACKGCPMSQITLRNAIERTLLKEIP 65

Query: 182 EVKDIRT 188
           E+K +  
Sbjct: 66  ELKGVEP 72


>gi|169350337|ref|ZP_02867275.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552]
 gi|169293120|gb|EDS75253.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552]
          Length = 83

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 44/67 (65%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + N++RP + RDGGDI    ++DGIV++ M GAC+GC    ETLK GV  IL   VP 
Sbjct: 11  EKVINKLRPYLNRDGGDIELVDFKDGIVYVKMLGACAGCAMLDETLKDGVEQILMEEVPG 70

Query: 183 VKDIRTV 189
           V +++ V
Sbjct: 71  VLEVKNV 77


>gi|288818297|ref|YP_003432645.1| NifU-like protein [Hydrogenobacter thermophilus TK-6]
 gi|288787697|dbj|BAI69444.1| NifU-like protein [Hydrogenobacter thermophilus TK-6]
 gi|308751894|gb|ADO45377.1| nitrogen-fixing NifU domain protein [Hydrogenobacter thermophilus
           TK-6]
          Length = 87

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E + + +RPA+  DGGD+       DG V + M GACSGC  +  TLK G+   L +  P
Sbjct: 10  EAVLDEIRPALRFDGGDVELVDVLEDGTVLVRMMGACSGCGMSVLTLKAGIERALKNKFP 69

Query: 182 EVKDIRTV 189
           E+K+++ +
Sbjct: 70  EIKEVKDI 77


>gi|303290897|ref|XP_003064735.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226453761|gb|EEH51069.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 153

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     E + + VRP +  DGGD+        +V L + GAC  CPS++ T++ G+   
Sbjct: 2   ELTAENVEKVLDEVRPYLIADGGDVELVEIDGLVVRLKLNGACGSCPSSTVTMRMGIERR 61

Query: 176 LNHFVPEV 183
           L   +PE+
Sbjct: 62  LLEVIPEI 69



 Score = 37.9 bits (86), Expect = 0.74,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 29/73 (39%), Gaps = 5/73 (6%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGD-IVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
            + +   E   + +RP +   GG  +      + IV + + G      ++  T++  V  
Sbjct: 83  ELNEANVEATLDEIRPYLKGTGGGELELVDIEEPIVKIKLSGP----AASVMTVRVAVTQ 138

Query: 175 ILNHFVPEVKDIR 187
            L   +P +  ++
Sbjct: 139 KLREKMPSIAAVQ 151


>gi|299771122|ref|YP_003733148.1| Iron-sulfur cluster biosynthesis family protein [Acinetobacter sp.
           DR1]
 gi|298701210|gb|ADI91775.1| Iron-sulfur cluster biosynthesis family protein [Acinetobacter sp.
           DR1]
          Length = 212

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYILQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLKEQIPELQRVVD 199


>gi|258404239|ref|YP_003196981.1| Fe-S cluster assembly protein NifU [Desulfohalobium retbaense DSM
           5692]
 gi|257796466|gb|ACV67403.1| Fe-S cluster assembly protein NifU [Desulfohalobium retbaense DSM
           5692]
          Length = 283

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 56/143 (39%), Gaps = 3/143 (2%)

Query: 45  IFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD 104
           + +  G+                 +         G   E       ++ N  L +     
Sbjct: 135 VCTCFGVTDQQILRAIEENDLKTVEDITAYTKAGGGCGECQSKLTELLENKRLSEPAQVP 194

Query: 105 MGSGDFIESDSAV--VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCP 162
            G     +  + +  +Q + +V++  +RP++ +DGGDI         V +++RG CSGCP
Sbjct: 195 TGPAASTKKLTNIQRMQLVNDVIEKEIRPSLQKDGGDIELIDIEGREVQVALRGMCSGCP 254

Query: 163 SASETLKYGVANILNHFV-PEVK 184
           S+  TLK  V   L   V PE+ 
Sbjct: 255 SSQLTLKNVVERRLQERVEPEIT 277


>gi|328949227|ref|YP_004366564.1| nitrogen-fixing NifU domain-containing protein [Treponema
           succinifaciens DSM 2489]
 gi|328449551|gb|AEB15267.1| nitrogen-fixing NifU domain-containing protein [Treponema
           succinifaciens DSM 2489]
          Length = 78

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGV 172
           D A++ ++KE L    RP +  DGGD+ F    D   V L + GAC  CP A+ TLK G+
Sbjct: 3   DEALIAKVKETL-EAFRPQLNADGGDMEFINIDDENKVHLKLTGACGSCPMATMTLKMGI 61

Query: 173 ANILNHFVPEVKDIRT 188
              L    PE+ ++  
Sbjct: 62  ERYLKETCPEISEVVQ 77


>gi|307545194|ref|YP_003897673.1| thioredoxin [Halomonas elongata DSM 2581]
 gi|307217218|emb|CBV42488.1| K07400 thioredoxin-like protein [Halomonas elongata DSM 2581]
          Length = 250

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDN 127
           Y  ++  P +   +++               + K+  + +      DS +  R+  VL +
Sbjct: 122 YLDKNSVPFLEEAVVDFNADRMGGQLTIKAPNAKMPKVNA------DSPLEDRVNYVLYS 175

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            + P +A  GG+I      +  V + +  G C GC +   TLK GV   L   +PE+  I
Sbjct: 176 EINPGLAAHGGEIKLVQLTEEQVAVLAFGGGCQGCAAVDLTLKEGVERTLMERIPELSGI 235

Query: 187 RTV 189
           R V
Sbjct: 236 RDV 238


>gi|118602435|ref|YP_903650.1| NifU domain-containing protein [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|254767316|sp|A1AW72|NFUA_RUTMC RecName: Full=Fe/S biogenesis protein nfuA
 gi|118567374|gb|ABL02179.1| nitrogen-fixing NifU domain protein [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 192

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 3/110 (2%)

Query: 83  EHFISGDPIIHNGGLGDM--KLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDI 140
           E+    +  + + G G           G   + D+ + ++IK V+   + P +A  GG +
Sbjct: 72  EYLKDSEVALKDAGTGKKLTITAPNTKGKEPKEDAPLEEKIKYVIAANINPGLASHGGFV 131

Query: 141 VFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
                 +   V L+  G C GC S   TL+ GV   L    PE+K +R V
Sbjct: 132 ELVEITKHMDVILNFGGGCQGCSSVKSTLEQGVEAQLKMSFPEIKSVRDV 181


>gi|254282987|ref|ZP_04957955.1| IscR-regulated protein YhgI [gamma proteobacterium NOR51-B]
 gi|219679190|gb|EED35539.1| IscR-regulated protein YhgI [gamma proteobacterium NOR51-B]
          Length = 191

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 3/110 (2%)

Query: 80  MIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGD 139
            + +  +        G L     +       ++ DS +  RI  +L N V P++A  GG+
Sbjct: 72  FLEDALVDYAEDRMGGQLTIKAPN--AKMPRVDPDSPIEDRINYILYNEVNPSLAAHGGE 129

Query: 140 IVFKGYRDGI-VFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +      D     L   G C GC +   TLK GV   L   +PE+  +R 
Sbjct: 130 VSLVEVTDEKYAILRFGGGCQGCSAVDVTLKDGVEKTLVEQLPELTGVRD 179


>gi|310643918|ref|YP_003948676.1| nifu-like protein [Paenibacillus polymyxa SC2]
 gi|309248868|gb|ADO58435.1| NifU-like protein [Paenibacillus polymyxa SC2]
          Length = 79

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKY 170
           ++ +  +   + EVL   +RP + RDGGD       +GI  L   GAC+GCPSA+ TLK 
Sbjct: 1   MDENGVLFDEVSEVLLK-LRPFLLRDGGDAELVEVENGIAKLRFLGACNGCPSATITLKV 59

Query: 171 GVANILNHFVPEVKDIRTV 189
            +   +   + ++K++  V
Sbjct: 60  AIERAILEEIDDIKEVVQV 78


>gi|302770961|ref|XP_002968899.1| hypothetical protein SELMODRAFT_16556 [Selaginella moellendorffii]
 gi|300163404|gb|EFJ30015.1| hypothetical protein SELMODRAFT_16556 [Selaginella moellendorffii]
          Length = 170

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 2/104 (1%)

Query: 87  SGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
           S   ++      +            E+     + + +VLD  VRP +  DGG++      
Sbjct: 1   SSREVVSPFESSNTSSTAGSGLYSTETYDFTAENVDKVLDE-VRPYLVADGGNVAVVSVA 59

Query: 147 DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE-VKDIRTV 189
           DG V L ++GAC  CPS++ T+K G+  +L     + VK++  +
Sbjct: 60  DGTVSLELQGACGTCPSSTSTMKMGIERVLREKFGDAVKEVVDI 103


>gi|148907013|gb|ABR16650.1| unknown [Picea sitchensis]
          Length = 465

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           +++ N VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +L     +
Sbjct: 325 DLVLNDVRPYLVADGGNVEVASVEDGVISLRLQGACGTCPSSTTTMKMGIERVLKEKFGD 384

Query: 183 V-KDIRTV 189
           V K+IR V
Sbjct: 385 VLKEIRQV 392


>gi|293608910|ref|ZP_06691213.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829483|gb|EFF87845.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121322|gb|ADY80845.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 212

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L   + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYILQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLRENIPELQRVVD 199


>gi|312880024|ref|ZP_07739824.1| nitrogen-fixing NifU domain protein [Aminomonas paucivorans DSM
           12260]
 gi|310783315|gb|EFQ23713.1| nitrogen-fixing NifU domain protein [Aminomonas paucivorans DSM
           12260]
          Length = 76

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174
           + QR+ +V+  ++RP +   GGDI FKG+ +  G V +++ GAC GCP A ETL+  V  
Sbjct: 1   MEQRVLQVIQEQIRPNLQAHGGDIEFKGFDEVEGAVTVALTGACGGCPFAQETLRVQVEQ 60

Query: 175 ILNHFVPEVKDIR 187
           +L   +PEVK +R
Sbjct: 61  VLRAAIPEVKSVR 73


>gi|255994758|ref|ZP_05427893.1| NifU family protein [Eubacterium saphenum ATCC 49989]
 gi|255993471|gb|EEU03560.1| NifU family protein [Eubacterium saphenum ATCC 49989]
          Length = 74

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   +    +VRPA+  DGGD+ F  +  D +V + ++G C GCP +  T+K  +   L
Sbjct: 1   MKEEIKAALEKVRPALQMDGGDVEFVDFTDDKVVKVKLQGHCCGCPMSQMTVKGFIEKAL 60

Query: 177 NHFVPEVKDIRTV 189
               P++K + TV
Sbjct: 61  RESFPDIKGVETV 73


>gi|157804286|gb|ABV79889.1| NifU [Anabaena siamensis TISTR 8012]
          Length = 195

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 40/119 (33%), Gaps = 5/119 (4%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR-----IKEVLDNRVR 130
             L  I +             L             +     +        I++VLD  VR
Sbjct: 77  SCLAKIDDIISEVKQESAKQNLNINGAKAKTEISSVGQQKPLTNVQKIALIQKVLDEEVR 136

Query: 131 PAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             +  DGGD+         V + ++GAC  C S++ TLK  +   L   + +   +  V
Sbjct: 137 LVLIADGGDVELYDIEGDKVKVKLQGACGSCSSSTATLKIAIEARLRDRISKDIIVEAV 195


>gi|70940575|ref|XP_740685.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56518569|emb|CAH83895.1| hypothetical protein PC401665.00.0 [Plasmodium chabaudi chabaudi]
          Length = 191

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 72/155 (46%), Gaps = 5/155 (3%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGG 96
                +++ F   G+ S+YF         D  ++ +     +     H  +      N  
Sbjct: 33  NYVNFSNKPFLRKGVNSMYFSTSN---NLDYINYINEINNFIETFQNHSDNSISNEGNIL 89

Query: 97  LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSM 154
               K+ +    +  E    ++  IK +++ RVRP V  DGGDI F  +     IV++ +
Sbjct: 90  PILQKIKNEPKYNENEEIMEIISSIKLLIEKRVRPIVVNDGGDIKFVCFDMDSGIVYVQL 149

Query: 155 RGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +GAC GC  +  TL+Y + N+L +++ E+K+I+ +
Sbjct: 150 QGACVGCSQSEVTLQYMIKNMLTYYISEIKEIKNI 184


>gi|57233705|ref|YP_182326.1| NifU-like protein [Dehalococcoides ethenogenes 195]
 gi|57224153|gb|AAW39210.1| NifU-like protein [Dehalococcoides ethenogenes 195]
          Length = 72

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + +++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL   +PE
Sbjct: 6   EAVLDKIRPALEADGGNVELVEVVDGVVKVKLVGACAGCPMSTMTLKNGIEKILKREIPE 65

Query: 183 VKDIRT 188
           VK++  
Sbjct: 66  VKEVVA 71


>gi|325954760|ref|YP_004238420.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
 gi|323437378|gb|ADX67842.1| nitrogen-fixing NifU domain-containing protein [Weeksella virosa
           DSM 16922]
          Length = 93

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           ++ ++  + + LD  +RP +  DGGDI     +D +V + ++GAC+ C     TLK GV 
Sbjct: 2   NTELIDNVHKALDE-IRPFLNSDGGDIELVEVKDNVVKVRLKGACTSCSVNQMTLKAGVE 60

Query: 174 NILNHFVPEVKDIRTV 189
             +  FVPE+  +  V
Sbjct: 61  TTVKKFVPEIIKVIDV 76


>gi|313206297|ref|YP_004045474.1| nitrogen-fixing nifu domain protein [Riemerella anatipestifer DSM
           15868]
 gi|312445613|gb|ADQ81968.1| nitrogen-fixing NifU domain protein [Riemerella anatipestifer DSM
           15868]
 gi|315023020|gb|EFT36033.1| Nitrogen-fixing NifU, C-terminal [Riemerella anatipestifer RA-YM]
 gi|325336260|gb|ADZ12534.1| Thioredoxin-like protein [Riemerella anatipestifer RA-GD]
          Length = 78

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
             +RP + +DGGDI      D +V++ + G CSGCP +  T+K GV N +   VPE+  +
Sbjct: 15  ESIRPFLNKDGGDIELIKIEDTVVYVKLLGNCSGCPVSFSTMKLGVENTVKEKVPEITRV 74

Query: 187 RTV 189
             V
Sbjct: 75  ENV 77


>gi|186680943|ref|YP_001864139.1| Fe-S cluster assembly protein NifU [Nostoc punctiforme PCC 73102]
 gi|186463395|gb|ACC79196.1| Fe-S cluster assembly protein NifU [Nostoc punctiforme PCC 73102]
          Length = 299

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 46/118 (38%), Gaps = 4/118 (3%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR----IKEVLDNRVRP 131
             L  I +   S      +  L +  +         +  S    +    I++VLD  VRP
Sbjct: 182 SCLANIDDIIRSVQQEYASPALNNYGVQVATEIVTSKERSLTNVQKIALIQKVLDEEVRP 241

Query: 132 AVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            +  DGGD+         V + ++GAC  C S++ TLK  +   L   V +   +  V
Sbjct: 242 VLIADGGDVELYDVEGDRVKVVLQGACGSCSSSTATLKIAIEARLQDRVSKSLVVEAV 299


>gi|332296888|ref|YP_004438810.1| nitrogen-fixing NifU domain-containing protein [Treponema
           brennaborense DSM 12168]
 gi|332179991|gb|AEE15679.1| nitrogen-fixing NifU domain-containing protein [Treponema
           brennaborense DSM 12168]
          Length = 76

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 127 NRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
           +++RP +  DGGD+ F     G  VF+ + GAC  CP A+ TLK GV   L   +PEV +
Sbjct: 12  DKIRPQLQADGGDLEFVSMEAGGKVFVKLTGACGNCPMATMTLKQGVERFLKDTIPEVTE 71

Query: 186 IRT 188
           +  
Sbjct: 72  VLQ 74


>gi|329945551|ref|ZP_08293288.1| NifU-like protein [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528731|gb|EGF55683.1| NifU-like protein [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 170

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 71/184 (38%), Gaps = 18/184 (9%)

Query: 7   DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYF-GYDFITVGK 65
            TP+P  L++     V+ +G + F+  + A+       +     + SV   G   +T+  
Sbjct: 2   TTPDPDVLRW-----VVPDGLLPFT-GEVAQAPATLQALIDDGTLRSVRVDGGAVLTLLG 55

Query: 66  DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVL 125
             + W      V   ++E   +                          D A+    +++ 
Sbjct: 56  SGHSWRAEGARVRSALVEALGAPKAWKGGETAQVSGP-----------DDALEAAARQIA 104

Query: 126 DNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKD 185
              +   V   GG +V +  RDG+V ++M GAC  CP+A  T+     ++L    P + +
Sbjct: 105 GGSLGSFVNSHGGALVVRSVRDGVVEVAMEGACDECPAAEITMHARFEHLLRRRCPWLVE 164

Query: 186 IRTV 189
           +R +
Sbjct: 165 VRRI 168


>gi|239906346|ref|YP_002953087.1| nitrogen fixation protein NifU [Desulfovibrio magneticus RS-1]
 gi|239796212|dbj|BAH75201.1| nitrogen fixation protein NifU [Desulfovibrio magneticus RS-1]
          Length = 281

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             ++ + +V++  +RP + +DGGDI         VF+S+RGAC GCPS++ TL   V   
Sbjct: 207 ERMKLVTKVMEEEIRPNLKKDGGDIELVDIDGQTVFVSLRGACKGCPSSNVTLTEFVQKR 266

Query: 176 LNHFV-PEVKDIRT 188
           L   V P +     
Sbjct: 267 LQELVEPGITVKEA 280


>gi|302784600|ref|XP_002974072.1| hypothetical protein SELMODRAFT_58377 [Selaginella moellendorffii]
 gi|300158404|gb|EFJ25027.1| hypothetical protein SELMODRAFT_58377 [Selaginella moellendorffii]
          Length = 162

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E+     + + +VLD  VRP +  DGG++      DG V L ++GAC  CPS++ T+K G
Sbjct: 15  ETYDFTAENVDKVLDE-VRPYLVADGGNVAVVSVADGTVSLELQGACGTCPSSTSTMKMG 73

Query: 172 VANILNHFVPE-VKDIRTV 189
           +  +L     + VK++  +
Sbjct: 74  IERVLREKFGDAVKEVVDI 92


>gi|282901488|ref|ZP_06309413.1| Fe-S cluster assembly protein NifU [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193767|gb|EFA68739.1| Fe-S cluster assembly protein NifU [Cylindrospermopsis raciborskii
           CS-505]
          Length = 308

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 36/69 (52%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VLD  VRP +  DGGD+         V + ++GAC  C S++ TLK  + + L   V
Sbjct: 240 IQKVLDEEVRPVLIADGGDVELYDIEGNKVKVILKGACGSCSSSTATLKIAIESRLRERV 299

Query: 181 PEVKDIRTV 189
            +   +  V
Sbjct: 300 NKEIIVEAV 308


>gi|225437626|ref|XP_002278510.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297744011|emb|CBI36981.3| unnamed protein product [Vitis vinifera]
          Length = 213

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 96  GLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMR 155
              +        G +      +  +  +++   VRP +  DGG++      DG++ L ++
Sbjct: 46  KASNPSAPSGSPGLYSAHKFELTAKNVDLVLEDVRPYLISDGGNVDVVSVEDGVISLKLQ 105

Query: 156 GACSGCPSASETLKYGVANILNHFVPE-VKDIRTV 189
           GAC  CPS++ T+  G+  +L     + VKDIR V
Sbjct: 106 GACGSCPSSTTTMTMGIERVLKEKFGDAVKDIRQV 140


>gi|68349029|gb|AAY96420.1| YhgI [Halomonas elongata]
          Length = 196

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 68  YDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDN 127
           Y  ++  P +   +++               + K+  + +      DS +  R+  VL +
Sbjct: 68  YLDKNSVPFLEEAVVDFNADRMGGQLTIKAPNAKMPKVNA------DSPLEDRVNYVLYS 121

Query: 128 RVRPAVARDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
            + P +A  GG+I      +  V + +  G C GC +   TLK GV   L   +PE+  I
Sbjct: 122 EINPGLAAHGGEIKLVQLTEEQVAVLAFGGGCQGCAAVDLTLKEGVERTLMERIPELSGI 181

Query: 187 RTV 189
           R V
Sbjct: 182 RDV 184


>gi|255319128|ref|ZP_05360346.1| IscR-regulated protein YhgI [Acinetobacter radioresistens SK82]
 gi|262379260|ref|ZP_06072416.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255303774|gb|EET82973.1| IscR-regulated protein YhgI [Acinetobacter radioresistens SK82]
 gi|262298717|gb|EEY86630.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 212

 Score = 74.5 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-----RDGIVFLSMRGACSGCPSASETL 168
           D+++ +RI  VL + + P +A  GG+                 L   G C GC +   TL
Sbjct: 120 DASIEERITYVLQSEINPGLAGHGGNCALVEVVEDEEHGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE+  +  
Sbjct: 180 KQGVETTLKQHIPELSRVVD 199


>gi|304311311|ref|YP_003810909.1| hypothetical protein HDN1F_16740 [gamma proteobacterium HdN1]
 gi|301797044|emb|CBL45257.1| Conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 199

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 105 MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY--RDGIVFLSMRGACSGCP 162
                 I  +S+V +RI  ++ + + P +A  GG +  +     D +  L   G+C GC 
Sbjct: 102 KSKVPQIGENSSVEERINHIIFSEINPQLASHGGSVELQQLIDDDTVAILKFGGSCQGCG 161

Query: 163 SASETLKYGVANILNHFVPEVKDIRTV 189
               TLK GV   L   VPE+K +  V
Sbjct: 162 MIDVTLKQGVEKTLLDRVPELKRVTDV 188


>gi|154148473|ref|YP_001407292.1| NifU family protein [Campylobacter hominis ATCC BAA-381]
 gi|153804482|gb|ABS51489.1| NifU family protein [Campylobacter hominis ATCC BAA-381]
          Length = 88

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 50/75 (66%), Gaps = 2/75 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           SD  +++ +++ L + +RP + +DGGD+   G ++ +V++ ++GAC GC ++++TLKYGV
Sbjct: 5   SDDELIEPVQKSL-DLIRPMLQKDGGDLELLGIKNAVVYVRLKGACHGCSASAQTLKYGV 63

Query: 173 ANILNHFV-PEVKDI 186
              L   + PE+  +
Sbjct: 64  ERQLKIDIHPEISVV 78


>gi|172036772|ref|YP_001803273.1| NifU-like protein [Cyanothece sp. ATCC 51142]
 gi|171698226|gb|ACB51207.1| NifU-like protein [Cyanothece sp. ATCC 51142]
          Length = 286

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 50/118 (42%), Gaps = 1/118 (0%)

Query: 73  LRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPA 132
            +  +  +I        P +      ++    +   D I+  +  +++  E     VRP 
Sbjct: 48  HKEALSRLIKTVKKEALPSLREAVKDELVYGLLRYHDLIKPPNPPLEKRLEQALATVRPG 107

Query: 133 VARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           +    GD+     +    V + + G CS CP+++ T+K G+   +  + PE+ ++ +V
Sbjct: 108 LKSHHGDVELVAIKLPNTVEVKLVGTCSNCPASTLTMKQGIEQAIKTYCPEITNVISV 165


>gi|50084252|ref|YP_045762.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter sp. ADP1]
 gi|51701945|sp|Q6FDB8|NFUA_ACIAD RecName: Full=Fe/S biogenesis protein nfuA
 gi|49530228|emb|CAG67940.1| putative membrane-bound protein in GNT I transport system (GntY)
           [Acinetobacter sp. ADP1]
          Length = 212

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L + + P +A  GG+      +D         L   G C GC +   TL
Sbjct: 120 DASIEERITYILQSEINPGLAGHGGNCALVEVQDDPENGLTAVLKFGGGCQGCSAIDVTL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 180 KQGVETTLRQQIPELQRVVD 199


>gi|332703499|ref|ZP_08423587.1| nitrogen-fixing NifU domain-containing protein [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332553648|gb|EGJ50692.1| nitrogen-fixing NifU domain-containing protein [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 80

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGV 172
           D+ + +R+   L + +RP +  DGGD+      D  +V + +RGAC  C  +  TLK G+
Sbjct: 5   DTTMRERVLAAL-DMIRPVLRADGGDVELVEVTDTGVVKVRLRGACQCCTMSRMTLKNGI 63

Query: 173 ANILNHFVPEVKDIRTV 189
              +   +P +  + +V
Sbjct: 64  ERTILKEIPGLTSVESV 80


>gi|125995235|dbj|BAF47150.1| NifU [Gloeothece sp. KO68DGA]
          Length = 293

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
             L  I +                 ++    S     ++   +  I++VL+  V+PA+A+
Sbjct: 180 SCLADIDDLIAEVMHERETAVAVATEVVKAKSEPKPLTNIQKITLIQQVLEEEVKPALAQ 239

Query: 136 DGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV-PEVKDIRTV 189
           DGGD         +V + ++GAC  C S+++TLK  +   L   + PE+  +  V
Sbjct: 240 DGGDCDLFDVDGDLVKVVLKGACGSCASSTQTLKIAIEARLRDRISPELT-VIAV 293


>gi|86134908|ref|ZP_01053490.1| NifU-like protein [Polaribacter sp. MED152]
 gi|85821771|gb|EAQ42918.1| NifU-like protein [Polaribacter sp. MED152]
          Length = 78

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +   +++ LD  +RP +  DGG+I      D IV + ++GAC+GC     TLK GV   
Sbjct: 5   EIHNNVEKALDE-IRPFLMSDGGNIKLLSIEDAIVKVQLQGACTGCSVNQMTLKNGVEAT 63

Query: 176 LNHFVPEVKDIRTV 189
           +  + P+++ +  V
Sbjct: 64  IKKYAPQIEQVINV 77


>gi|218439087|ref|YP_002377416.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 7424]
 gi|218171815|gb|ACK70548.1| Fe-S cluster assembly protein NifU [Cyanothece sp. PCC 7424]
          Length = 293

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 46/114 (40%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVAR 135
             L  I +                 ++    SG    ++   +Q I++VL+  VRP +  
Sbjct: 180 SCLPAIDDILAEVAQEKAKAVEVATEVVTASSGFGQLTNLKKIQLIEQVLEKEVRPILKA 239

Query: 136 DGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           DGG++         + + ++GAC  C  ++ TLK+ + + L   +     +  V
Sbjct: 240 DGGNVELYDVEGHRIKVVLKGACGSCAGSTATLKHAIEDKLRELIDSTLVVEAV 293


>gi|309389827|gb|ADO77707.1| nitrogen-fixing NifU domain protein [Halanaerobium praevalens DSM
           2228]
          Length = 73

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYGVANIL 176
           ++   +   +++RP++  DGGD+      + GIV + + GACSGCP ++ T+K G+   L
Sbjct: 1   MKEEVQKYIDKIRPSLQADGGDVELIEVTEAGIVKVKLLGACSGCPMSTLTIKNGIEKTL 60

Query: 177 NHFVPEVKDIRTV 189
              V  VK++++V
Sbjct: 61  KQNVEGVKEVQSV 73


>gi|330720100|gb|EGG98512.1| hypothetical protein imdm_2277 [gamma proteobacterium IMCC2047]
          Length = 195

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 3/108 (2%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           +    +   +   +G        +    +   +S + +R+  VL   V P +A  GG++ 
Sbjct: 76  YLEEANIDYNKDRMGGQLTIKAPNSKLPKVNENSTLEERVNYVLWTEVNPMLASHGGEVS 135

Query: 142 FKGYRDGIVFL-SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
                D  V +    G C GC S   TLK GV   L   +PE+ +IR 
Sbjct: 136 LMEIADETVAVLKFGGGCQGCSSVDVTLKEGVEKTLREHIPELTEIRD 183


>gi|288574803|ref|ZP_06393160.1| nitrogen-fixing NifU domain protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570544|gb|EFC92101.1| nitrogen-fixing NifU domain protein [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 77

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG--IVFLSMRGACSGCPSASETLKYGVAN 174
           ++ RI EV+D  +RPA+   GGD+    + +   ++   ++GAC  CP A ETL+  V  
Sbjct: 3   LIDRINEVVDKSIRPALQSHGGDVEVVSFDEESGVISARLQGACGTCPFAQETLRMQVEA 62

Query: 175 ILNHFVPEVKDIR 187
           +L   +PEV  + 
Sbjct: 63  VLKREIPEVSSVV 75


>gi|222624810|gb|EEE58942.1| hypothetical protein OsJ_10617 [Oryza sativa Japonica Group]
          Length = 224

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 85  FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
             +     H            G G +      +     + + + VRP +  DGGD+    
Sbjct: 44  IQTSGARAHLAAAPASTPPAAGGGLYSAETYELTAENVDRVLDDVRPYLIADGGDVTVAS 103

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE-VKDIRTV 189
             DG++ L + GAC  CPS++ T+K G+  +L     + VKDIR V
Sbjct: 104 VEDGVISLKLEGACGSCPSSTTTMKMGIERVLKEKFGDAVKDIRQV 149


>gi|115452669|ref|NP_001049935.1| Os03g0314700 [Oryza sativa Japonica Group]
 gi|108707815|gb|ABF95610.1| NifU-like domain containing protein, expressed [Oryza sativa
           Japonica Group]
 gi|113548406|dbj|BAF11849.1| Os03g0314700 [Oryza sativa Japonica Group]
 gi|215697309|dbj|BAG91303.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 224

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 85  FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
             +     H            G G +      +     + + + VRP +  DGGD+    
Sbjct: 44  IQTSGARAHLAAAPASTPPAAGGGLYSAETYELTAENVDRVLDDVRPYLIADGGDVTVAS 103

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE-VKDIRTV 189
             DG++ L + GAC  CPS++ T+K G+  +L     + VKDIR V
Sbjct: 104 VEDGVISLKLEGACGSCPSSTTTMKMGIERVLKEKFGDAVKDIRQV 149


>gi|330507732|ref|YP_004384160.1| NifU-like domain-containing protein [Methanosaeta concilii GP-6]
 gi|328928540|gb|AEB68342.1| NifU-like domain protein [Methanosaeta concilii GP-6]
          Length = 75

 Score = 74.1 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 35/67 (52%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E    ++R  +  DGGD+      DGIV + ++G C+GCP +  TLK  +   L   V  
Sbjct: 9   EAALGKIREGLRVDGGDVELVDISDGIVTVRLQGHCAGCPFSQMTLKNFIEKELVKSVAG 68

Query: 183 VKDIRTV 189
           +K + +V
Sbjct: 69  IKGVVSV 75


>gi|281356627|ref|ZP_06243118.1| nitrogen-fixing NifU domain protein [Victivallis vadensis ATCC
           BAA-548]
 gi|281316754|gb|EFB00777.1| nitrogen-fixing NifU domain protein [Victivallis vadensis ATCC
           BAA-548]
          Length = 76

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             + ++I E L   +R  +  DGGD+         V L ++GAC GCP A+ T+K G+  
Sbjct: 2   DELTKKITERL-ESLRVHLQADGGDLEIVAIEGKTVKLKLQGACGGCPHAAMTIKGGLER 60

Query: 175 ILNHFV-PEVK 184
           IL   + PE+ 
Sbjct: 61  ILREEIDPEIV 71


>gi|119509287|ref|ZP_01628437.1| nitrogen fixation protein [Nodularia spumigena CCY9414]
 gi|119466129|gb|EAW47016.1| nitrogen fixation protein [Nodularia spumigena CCY9414]
          Length = 312

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 43/115 (37%), Gaps = 1/115 (0%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDS-AVVQRIKEVLDNRVRPAVA 134
             L  I +             L    +    S       +   +  I++VLD  VRP + 
Sbjct: 196 SCLANIDDIIRDVKEKAAVPALNTHSVAVANSQQSKPLTNVQRIALIQKVLDEEVRPVLI 255

Query: 135 RDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            DGGD+         V + ++GAC  C S++ TLK  +   L   V +   +  V
Sbjct: 256 ADGGDVELYDVEGDKVKVVLQGACGSCSSSTATLKIAIEARLQDRVSKNLVVEAV 310


>gi|83816071|ref|YP_445990.1| hypothetical protein SRU_1878 [Salinibacter ruber DSM 13855]
 gi|294507901|ref|YP_003571959.1| conserved hypothetical protein containing thioredoxin-like domain
           [Salinibacter ruber M8]
 gi|83757465|gb|ABC45578.1| conserved hypothetical protein [Salinibacter ruber DSM 13855]
 gi|294344229|emb|CBH25007.1| conserved hypothetical protein containing thioredoxin-like domain
           [Salinibacter ruber M8]
          Length = 142

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 4   QTEDTPNPATLKFIPGQ-VVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62
           Q E TPNP +LKF       L  G   +S+A EA   PLA R+F + G+  V+    F+T
Sbjct: 56  QAESTPNPNSLKFTTDDGPFLSGGVAAYSSADEAAEDPLARRLFGVSGVDDVFITPQFVT 115

Query: 63  VGK-DQYDWEHLRPPVLGMIMEHFIS 87
           V K    DW  ++P V  ++ EH  +
Sbjct: 116 VSKAPSVDWGSVKPDVETILAEHLEA 141


>gi|119509243|ref|ZP_01628393.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
 gi|119466085|gb|EAW46972.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414]
          Length = 277

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 46/121 (38%), Gaps = 8/121 (6%)

Query: 76  PVLGMIMEHFISGDPIIHNGGLGDMKLDDMG------SGDFIESDSAVVQRIKEVLDNRV 129
            +    + H I          L     DD+               + +++RI   L+  V
Sbjct: 38  DLHKAALTHLIKSLKQESMSALRQAVDDDIVYSVLLYHELIKPPQAPLIERINTALEE-V 96

Query: 130 RPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           RP +    GD+ F        V + + G+CS CP+++ TL   V   + +  PE+  +  
Sbjct: 97  RPGLKSHDGDVEFVAIKPPDTVEVKLIGSCSSCPTSTLTLTQSVEQAIKNHCPEITKVVA 156

Query: 189 V 189
           V
Sbjct: 157 V 157


>gi|289643389|ref|ZP_06475510.1| iron-sulfur cluster assembly accessory protein [Frankia symbiont of
           Datisca glomerata]
 gi|289506787|gb|EFD27765.1| iron-sulfur cluster assembly accessory protein [Frankia symbiont of
           Datisca glomerata]
          Length = 198

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 46/103 (44%), Gaps = 1/103 (0%)

Query: 85  FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
           F+  +P   +            +      +  + +++ E +  +VRP + RDGGD+    
Sbjct: 94  FVFSNPRAADPCSCGSSFSADAAERQEGDEDTLWRQVDEAI-QQVRPFLQRDGGDVTVVD 152

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
              G+V + + GAC GC +A +TL   +   L   VP V+ + 
Sbjct: 153 ITAGVVSVRLTGACGGCSAALDTLTGVIERQLKESVPAVERVV 195


>gi|254410535|ref|ZP_05024314.1| Fe-S cluster assembly protein NifU [Microcoleus chthonoplastes PCC
           7420]
 gi|196182741|gb|EDX77726.1| Fe-S cluster assembly protein NifU [Microcoleus chthonoplastes PCC
           7420]
          Length = 315

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 40/97 (41%)

Query: 93  HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL 152
                     ++        ++   +  I++VL+  +RP +A DGGD+         V +
Sbjct: 218 TTTPSTSPVKEETSPPPATLTNLQKITLIQQVLETEIRPTLAYDGGDVELYDVEGDRVKV 277

Query: 153 SMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            ++G+C GCPS   TLK  +   L   V     +  V
Sbjct: 278 ILKGSCDGCPSVMITLKMAIEKRLQERVSPNLMVEAV 314


>gi|189485737|ref|YP_001956678.1| hypothetical protein TGRD_734 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287696|dbj|BAG14217.1| conserved hypothetical protein [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 75

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +++++ L   VRP +  D GD+      +  IV + + G+C GCP A+ TL+YGV N 
Sbjct: 3   LREKVEKAL-ESVRPHLQADCGDVELIDVSEDGIVKVKLTGSCGGCPMAAMTLQYGVTNT 61

Query: 176 LNHFVPEVKDIRTV 189
           +   VPEVKD++++
Sbjct: 62  IKQAVPEVKDVQSI 75


>gi|320354022|ref|YP_004195361.1| nitrogen-fixing NifU domain-containing protein [Desulfobulbus
           propionicus DSM 2032]
 gi|320122524|gb|ADW18070.1| nitrogen-fixing NifU domain protein [Desulfobulbus propionicus DSM
           2032]
          Length = 77

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVAN 174
             +Q     +  ++RP + RDGGD+ F     D I+ + + GAC GCP +  TLK G+  
Sbjct: 2   EQLQETVIKVLAQIRPTLQRDGGDVEFVELGPDQILKVRLTGACQGCPMSRITLKEGIEK 61

Query: 175 ILNHFVPEVKDIRTV 189
            +   +P ++ +  V
Sbjct: 62  FVKGELPTIRAVEAV 76


>gi|295400424|ref|ZP_06810403.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294977699|gb|EFG53298.1| nitrogen-fixing NifU domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 283

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 41/133 (30%), Gaps = 1/133 (0%)

Query: 49  PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG 108
             I  +        +   +         +  ++     + +         +         
Sbjct: 21  DSIKGLPEDARMKAMELKKAIEAFHEHALRKLVRTFRETEEGKELLLKAVEDPSIYAMFL 80

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
                   +  R+   L   VRP +   GG +          ++ ++GACSGC  ++ TL
Sbjct: 81  LHGIIKQDLFTRVAAAL-EEVRPYMRSHGGGVELVEVEGKTAYVRLQGACSGCSLSAVTL 139

Query: 169 KYGVANILNHFVP 181
           K GV   +   VP
Sbjct: 140 KNGVEEAIKARVP 152


>gi|332702422|ref|ZP_08422510.1| Fe-S cluster assembly protein NifU [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552571|gb|EGJ49615.1| Fe-S cluster assembly protein NifU [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 285

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           +Q + +V+D  +RP++ +DGGDI         V +S+RGAC GCPSA  TLK  V   L 
Sbjct: 213 MQLVSKVIDEEIRPSLKKDGGDIELIDIDGLNVVVSLRGACVGCPSAQLTLKQLVERRLR 272

Query: 178 HFV-PEVK 184
             V P++ 
Sbjct: 273 ETVEPDIV 280


>gi|218192692|gb|EEC75119.1| hypothetical protein OsI_11301 [Oryza sativa Indica Group]
          Length = 288

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 85  FISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKG 144
             +     H            G G +      +     + + + VRP +  DGGD+    
Sbjct: 44  IQTSGARAHLAAAPASTPPAAGGGLYSAETYELTAENVDRVLDDVRPYLIADGGDVTVAS 103

Query: 145 YRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE-VKDIRTV 189
             DG++ L + GAC  CPS++ T+K G+  +L     + VKDIR V
Sbjct: 104 VEDGVISLKLEGACGSCPSSTTTMKMGIERVLKEKFGDAVKDIRQV 149


>gi|289209036|ref|YP_003461102.1| nitrogen-fixing NifU domain protein [Thioalkalivibrio sp. K90mix]
 gi|288944667|gb|ADC72366.1| nitrogen-fixing NifU domain protein [Thioalkalivibrio sp. K90mix]
          Length = 299

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 45/138 (32%), Gaps = 1/138 (0%)

Query: 49  PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG 108
            G          + V       +          ++     DP +           +  + 
Sbjct: 159 GGPTMAGPDKAQVMVDVSHLLSDDPDHVYSEDELDAIEELDPELALRLDRAQTFAEREAA 218

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
           D   +D  + +          R  + +DGGDI F       V + ++GAC GCP ++  L
Sbjct: 219 DV-PADGPIDEDAVRAAIEEARRILMQDGGDIEFVELDGRTVRVRLKGACVGCPRSTLDL 277

Query: 169 KYGVANILNHFVPEVKDI 186
           K  V  ++    P V  +
Sbjct: 278 KNVVERLVRSRAPGVASV 295


>gi|225010130|ref|ZP_03700602.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
 gi|225005609|gb|EEG43559.1| nitrogen-fixing NifU domain protein [Flavobacteria bacterium
           MS024-3C]
          Length = 79

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
             ++Q++++ LD  +RP +  DGGDI  +G     V + + GAC GC     TLK GV  
Sbjct: 4   DELLQQVEKALDE-IRPFLQSDGGDIALEGIEGNTVKVRLMGACVGCSVNQMTLKSGVEL 62

Query: 175 ILNHFVPEVKDIR 187
            +  + P+++ + 
Sbjct: 63  TIKKYAPQIEQVI 75


>gi|162448199|ref|YP_001621331.1| NifU-like domain-containing protein [Acholeplasma laidlawii PG-8A]
 gi|161986306|gb|ABX81955.1| NifU-like domain protein [Acholeplasma laidlawii PG-8A]
          Length = 77

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 38/65 (58%)

Query: 125 LDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVK 184
           +  RVRP + RDGGDI      DGIV++ M GAC GC +   TLK G+  ++   VP + 
Sbjct: 13  IIKRVRPYIQRDGGDIELVNIEDGIVYVKMGGACDGCAAIDITLKQGIETMMLENVPGII 72

Query: 185 DIRTV 189
            + TV
Sbjct: 73  AVVTV 77


>gi|312890429|ref|ZP_07749966.1| nitrogen-fixing NifU domain protein [Mucilaginibacter paludis DSM
           18603]
 gi|311297199|gb|EFQ74331.1| nitrogen-fixing NifU domain protein [Mucilaginibacter paludis DSM
           18603]
          Length = 92

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVANILNHFVP 181
           E   + +RP +  DGG++  +    D +V L + G+C  CP +  TLK G+   +   VP
Sbjct: 8   EAALDTIRPYLETDGGNVSVEEITADNVVKLKLLGSCGSCPMSIMTLKAGIEQAIKKAVP 67

Query: 182 EVKDIRTV 189
           EV  +  +
Sbjct: 68  EVTGVEAI 75


>gi|262368793|ref|ZP_06062122.1| IscR-regulated protein YhgI [Acinetobacter johnsonii SH046]
 gi|262316471|gb|EEY97509.1| IscR-regulated protein YhgI [Acinetobacter johnsonii SH046]
          Length = 215

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGY-----RDGIVFLSMRGACSGCPSASETL 168
           D+++ +RI  +L + + P +A  GG+                 L   G C GC +   TL
Sbjct: 123 DASIEERITYILQSEINPGLAGHGGNCALVEVVEDEEHGLTAVLKFGGGCQGCSAIDVTL 182

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   +PE++ +  
Sbjct: 183 KQGVETTLQQHIPELRRVID 202


>gi|312111050|ref|YP_003989366.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
 gi|311216151|gb|ADP74755.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y4.1MC1]
          Length = 283

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 41/133 (30%), Gaps = 1/133 (0%)

Query: 49  PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG 108
             I  +        +   +         +  ++     + +         +         
Sbjct: 21  DSIKGLPEDARMKAMELKKAIEAFHEHALRKLVRTFRETEEGKELLLKAVEDPSIYAMFL 80

Query: 109 DFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETL 168
                   +  R+   L   VRP +   GG +          ++ ++GACSGC  ++ TL
Sbjct: 81  LHGIIKQDLFTRVAVAL-EEVRPYMRSHGGGVELVEVEGKTAYVRLQGACSGCSLSAVTL 139

Query: 169 KYGVANILNHFVP 181
           K GV   +   VP
Sbjct: 140 KNGVEEAIKARVP 152


>gi|239828215|ref|YP_002950839.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70]
 gi|239808508|gb|ACS25573.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70]
          Length = 78

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   TDQEIKEQVQEVLDK-LRPFLLRDGGDCELIDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANIL 176
              L
Sbjct: 61  ERAL 64


>gi|257456257|ref|ZP_05621454.1| NifU-like domain protein [Treponema vincentii ATCC 35580]
 gi|257446343|gb|EEV21389.1| NifU-like domain protein [Treponema vincentii ATCC 35580]
          Length = 75

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP +  DGGD+ F    D  +V + ++GAC  CP A  TLK G+   L    P++K + 
Sbjct: 14  VRPHLQADGGDVEFVSLSDDGVVSVRLKGACGSCPVALMTLKSGIEAQLKESYPDIKKVV 73

Query: 188 TV 189
           ++
Sbjct: 74  SI 75


>gi|2688826|gb|AAB88877.1| putative NifU protein [Prunus armeniaca]
          Length = 76

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     +++   VRP +  DGGD+      DG+V L ++GAC  CPS++ T+K G+  +
Sbjct: 1   ELTVPNVDLVLEDVRPYLIADGGDVDVVSVEDGVVSLKLQGACGSCPSSTTTMKMGIERV 60

Query: 176 LNHFVPE-VKDIRTV 189
           L     + +KDI+ V
Sbjct: 61  LKEKFGDALKDIQQV 75


>gi|261420397|ref|YP_003254079.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC61]
 gi|297528899|ref|YP_003670174.1| nitrogen-fixing NifU domain protein [Geobacillus sp. C56-T3]
 gi|319768064|ref|YP_004133565.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC52]
 gi|261376854|gb|ACX79597.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC61]
 gi|297252151|gb|ADI25597.1| nitrogen-fixing NifU domain protein [Geobacillus sp. C56-T3]
 gi|317112930|gb|ADU95422.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC52]
          Length = 78

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 2   TDQEIKEQVQEVLDK-LRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 60

Query: 173 ANIL 176
              L
Sbjct: 61  ERAL 64


>gi|56421496|ref|YP_148814.1| nitrogen fixation NifU protein [Geobacillus kaustophilus HTA426]
 gi|138896548|ref|YP_001127001.1| nitrogen fixation protein NifU [Geobacillus thermodenitrificans
           NG80-2]
 gi|56381338|dbj|BAD77246.1| nitrogen fixation protein (NifU protein) [Geobacillus kaustophilus
           HTA426]
 gi|134268061|gb|ABO68256.1| Nitrogen fixation protein NifU [Geobacillus thermodenitrificans
           NG80-2]
          Length = 80

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGV 172
           +D  + ++++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+
Sbjct: 4   TDQEIKEQVQEVLDK-LRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGI 62

Query: 173 ANIL 176
              L
Sbjct: 63  ERAL 66


>gi|116753461|ref|YP_842579.1| NifU domain-containing protein [Methanosaeta thermophila PT]
 gi|116664912|gb|ABK13939.1| nitrogen-fixing NifU domain protein [Methanosaeta thermophila PT]
          Length = 75

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 37/72 (51%)

Query: 118 VQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177
           ++   E     +R  +  +GGD+      DG+V++ + G+C+GCP +  TL+  V   L 
Sbjct: 4   MKEEVESTLESIRNVLRIEGGDVELVDINDGVVYVKLTGSCAGCPFSQMTLRNFVERELK 63

Query: 178 HFVPEVKDIRTV 189
             V  VK + +V
Sbjct: 64  KNVSGVKAVESV 75


>gi|303246717|ref|ZP_07332995.1| Fe-S cluster assembly protein NifU [Desulfovibrio fructosovorans
           JJ]
 gi|302492057|gb|EFL51935.1| Fe-S cluster assembly protein NifU [Desulfovibrio fructosovorans
           JJ]
          Length = 279

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             V+R+ +V+D  +RP + +DGGDI         V +++RGAC GCP ++ TL   V   
Sbjct: 204 ERVKRVTQVMDEEIRPNLKKDGGDIELLDIEGKTVLVALRGACQGCPVSNVTLTEFVQKR 263

Query: 176 LNHFV-PEVKDIRT 188
           L   V P++     
Sbjct: 264 LRELVEPDITVKEA 277


>gi|110834051|ref|YP_692910.1| hypothetical protein ABO_1190 [Alcanivorax borkumensis SK2]
 gi|110647162|emb|CAL16638.1| yhgI conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 198

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYG 171
            D+ + ++I  VL   + P +A  GG +      D  V +    G C GC     TL+ G
Sbjct: 109 EDATIEEKINYVLYAEINPNLAAHGGSVQLLELTDDNVAVLEFGGGCQGCSVVDVTLRDG 168

Query: 172 VANILNHFVPEVKDIRT 188
           V   L   +PE+  +R 
Sbjct: 169 VEKTLQERIPELAGVRD 185


>gi|299139675|ref|ZP_07032848.1| nitrogen-fixing NifU domain protein [Acidobacterium sp. MP5ACTX8]
 gi|298598299|gb|EFI54464.1| nitrogen-fixing NifU domain protein [Acidobacterium sp. MP5ACTX8]
          Length = 197

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 32/62 (51%)

Query: 127 NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDI 186
             VRP +   GGD    G  +GIV L + G C  CPS+S TLK  V   L    P++K+I
Sbjct: 120 ESVRPYLQEHGGDCELAGLDNGIVRLRLHGNCGSCPSSSLTLKNAVEEALFQAAPDIKEI 179

Query: 187 RT 188
             
Sbjct: 180 IA 181


>gi|302825922|ref|XP_002994529.1| hypothetical protein SELMODRAFT_48861 [Selaginella moellendorffii]
 gi|300137483|gb|EFJ04406.1| hypothetical protein SELMODRAFT_48861 [Selaginella moellendorffii]
          Length = 126

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 142 FKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            +     +V L ++GAC  CPS+  T+K G+   L   +PE+  +  V
Sbjct: 1   MEEIDGLVVKLKLQGACGSCPSSLMTMKMGIEARLKEKIPEIIGVEQV 48


>gi|254429726|ref|ZP_05043433.1| HesB-like domain protein [Alcanivorax sp. DG881]
 gi|196195895|gb|EDX90854.1| HesB-like domain protein [Alcanivorax sp. DG881]
          Length = 198

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL-SMRGACSGCPSASETLKYG 171
            D+++ ++I  VL   + P +A  GG +      +  V +    G C GC     TL+ G
Sbjct: 109 EDASIEEKINYVLYAEINPNLAAHGGSVQLLELTEDNVAVLEFGGGCQGCSVVDVTLRDG 168

Query: 172 VANILNHFVPEVKDIRT 188
           V   L   +PE+  +R 
Sbjct: 169 VEKTLQERIPELAGVRD 185


>gi|46580957|ref|YP_011765.1| NifU family protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46450377|gb|AAS97025.1| NifU family protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 81

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLK 169
           +  D  +  ++++ L   VRP + +DGGD+         +V + + G C GCP + +TLK
Sbjct: 1   MSEDIPMRDKVEQALAI-VRPLLQQDGGDVELVDITPEGVVRVRLTGRCKGCPMSQKTLK 59

Query: 170 YGVANILNHFVPEVKDIRTV 189
             V  ++  FVP V+ +  V
Sbjct: 60  NSVEKMVLKFVPAVQRVEAV 79


>gi|254514377|ref|ZP_05126438.1| IscR-regulated protein YhgI [gamma proteobacterium NOR5-3]
 gi|219676620|gb|EED32985.1| IscR-regulated protein YhgI [gamma proteobacterium NOR5-3]
          Length = 196

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYG 171
            DS +  RI  +L N V P++A  GG++      +     L   G C GC +   TLK G
Sbjct: 108 DDSPIEDRINYLLYNEVNPSLAAHGGEVSLVEVTEDAYAVLRFGGGCQGCSAVDMTLKDG 167

Query: 172 VANILNHFVPEVKDIRT 188
           V   L   +P++K +R 
Sbjct: 168 VEKTLLDQLPQLKGVRD 184


>gi|88703284|ref|ZP_01101000.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
 gi|88701998|gb|EAQ99101.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
          Length = 191

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYG 171
            DS +  RI  VL N V P++A  GG++      D     L   G C GC +   TLK G
Sbjct: 103 DDSPIEDRINYVLYNEVNPSLAAHGGEVSLVEVTDDAFAVLRFGGGCQGCSAVDMTLKDG 162

Query: 172 VANILNHFVPEVKDIRT 188
           V   L   +P++K +R 
Sbjct: 163 VEKTLLDQLPQLKGVRD 179


>gi|256827894|ref|YP_003156622.1| nitrogen-fixing NifU domain-containing protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577070|gb|ACU88206.1| nitrogen-fixing NifU domain protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 73

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANI 175
           + +++++ LD  VRP +  DGG +        GIV + M GAC GCP A  TLK  +   
Sbjct: 1   MREQVEKALDT-VRPILQADGGYVELVNILPSGIVQVRMSGACKGCPMAQMTLKSSIERA 59

Query: 176 LNHFVPEVKDIRTV 189
           +   VP +K +  V
Sbjct: 60  VKKMVPGIKAVEAV 73


>gi|113476874|ref|YP_722935.1| nitrogen-fixing NifU-like protein [Trichodesmium erythraeum IMS101]
 gi|110167922|gb|ABG52462.1| nitrogen-fixing NifU-like [Trichodesmium erythraeum IMS101]
          Length = 173

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 59/159 (37%), Gaps = 19/159 (11%)

Query: 49  PGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSG 108
             ++      D     +    W+  +  V+  +     +         +  +K + M + 
Sbjct: 10  ESVSLEALVSDITHFEQTIAHWDENQKLVVEGLKNAIEALHKEALTRLIRSVKKESMPAL 69

Query: 109 DFIESDS-----------------AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIV 150
                D                   +  RI++ LD  VRP +    GD+   G +    V
Sbjct: 70  REAVQDEVVYGLLRYHELVKPPTPPLEIRIQQALDE-VRPGLQSHNGDVELVGIKLPDTV 128

Query: 151 FLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
            + + G CS CP+++ T+K GV   +    PE+K++ +V
Sbjct: 129 EVKLVGNCSNCPASTLTMKDGVEQAIKTHCPEIKNVVSV 167


>gi|119484429|ref|ZP_01619046.1| hypothetical protein L8106_01887 [Lyngbya sp. PCC 8106]
 gi|119457903|gb|EAW39026.1| hypothetical protein L8106_01887 [Lyngbya sp. PCC 8106]
          Length = 289

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 107 SGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSAS 165
                     +  RI++ L+  VRP +    GD+     +    V + + G CS CP+++
Sbjct: 86  HELIKPPQPPLENRIQQALEE-VRPGLKSHSGDVELVAIKLPDTVEVKLVGTCSNCPAST 144

Query: 166 ETLKYGVANILNHFVPEVKDIRTV 189
            TLK GV   + +  PE+  + +V
Sbjct: 145 LTLKQGVEQAIKNHCPEINHVISV 168


>gi|323343211|ref|ZP_08083442.1| Fe/S-biogenesis protein NfuA [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322463275|gb|EFY08470.1| Fe/S-biogenesis protein NfuA [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 79

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           + +RI E LD  +RP + RDGGD+ F    +  +V + + GAC GC     TLK GV  +
Sbjct: 3   LEERIIESLDK-IRPYIQRDGGDMEFVSVDENGVVTVKLLGACIGCGLIDYTLKGGVEAL 61

Query: 176 LNHFVPEVKDIRT 188
           L   +PEV  +  
Sbjct: 62  LMDEIPEVTGVIA 74


>gi|224064633|ref|XP_002301529.1| predicted protein [Populus trichocarpa]
 gi|222843255|gb|EEE80802.1| predicted protein [Populus trichocarpa]
          Length = 216

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +  +  +++   VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +
Sbjct: 69  ELNPQNVDLVLEEVRPYLIADGGNVDVVSVEDGVISLKLQGACGDCPSSTTTMKMGIERV 128

Query: 176 LNHFVPE-VKDIRTV 189
           L     + +KDIR V
Sbjct: 129 LKEKFGDAIKDIRQV 143


>gi|268323348|emb|CBH36936.1| conserved hypothetical protein, NifU-like domain family [uncultured
           archaeon]
          Length = 87

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANI 175
           +++ +K V++  +RP +  +GG I  KG  D  +V + + GAC+GCP +  TL   V   
Sbjct: 1   MLEEVKGVIEKDIRPLLEMEGGSIELKGVDDDGVVRVQLTGACAGCPMSQYTLVNFVEAT 60

Query: 176 LNHFVPEVKDIRT 188
           L   VP VK +  
Sbjct: 61  LKDKVPGVKQVVA 73


>gi|307108673|gb|EFN56913.1| hypothetical protein CHLNCDRAFT_144603 [Chlorella variabilis]
          Length = 149

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            + +   E + + VRP +  DGG++ F      +V+L + GAC  CPS+  T+  G+   
Sbjct: 19  ELTEENVETVLDEVRPYLMADGGNVEFVEIDGPVVYLRLAGACGSCPSSLTTMTMGIKRR 78

Query: 176 LNHFVP 181
           L   +P
Sbjct: 79  LMERIP 84



 Score = 35.5 bits (80), Expect = 3.5,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 4/53 (7%)

Query: 137 GGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           GG +        I  + + G      +   T++  V   L   +P +  ++ V
Sbjct: 100 GGGLELVELDGPIAKVRITGP----AANVMTVRVAVTQKLRERIPAIAAVQLV 148


>gi|255548369|ref|XP_002515241.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
 gi|223545721|gb|EEF47225.1| Nitrogen fixation protein nifU, putative [Ricinus communis]
          Length = 210

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
            +     +++   VRP +  DGG++      DG++ L ++GAC  CPS++ T+K G+  +
Sbjct: 63  ELTPENVDLVLEDVRPYLIADGGNVDVVSVEDGVISLQLQGACGSCPSSTTTMKMGIERV 122

Query: 176 LNHFV-PEVKDIRTV 189
           L       VKDIR V
Sbjct: 123 LKEKFGDSVKDIRQV 137



 Score = 37.5 bits (85), Expect = 0.89,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 31/94 (32%), Gaps = 11/94 (11%)

Query: 99  DMKLDDMGSGDFIESDSAVVQRIKEVLDNRV---RPAVARDGGDIVFKGYRDGIVFLSMR 155
             K  D        +D  V +   E ++  +   RPA+   GG +       G   +   
Sbjct: 124 KEKFGDSVKDIRQVNDEEVKETTPEAVNRHLDILRPAIKNYGGSVEVVSIESGECLVKYS 183

Query: 156 GACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           G     P +      G+   +    PE+ ++  V
Sbjct: 184 G-----PESIG---SGIKAAIKEKFPEITNVVLV 209


>gi|294501686|ref|YP_003565386.1| NifU-like domain-containing protein [Bacillus megaterium QM B1551]
 gi|295707034|ref|YP_003600109.1| NifU-like domain-containing protein [Bacillus megaterium DSM 319]
 gi|294351623|gb|ADE71952.1| NifU-like domain protein [Bacillus megaterium QM B1551]
 gi|294804693|gb|ADF41759.1| NifU-like domain protein [Bacillus megaterium DSM 319]
          Length = 76

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVAN 174
           S + ++++EVL  ++RP + RDGGD       DGIV L + GAC  CPS++ TLK G+  
Sbjct: 2   SEMHEQVQEVL-EKLRPFLLRDGGDCELVDVEDGIVKLRLLGACGSCPSSTITLKAGIER 60

Query: 175 IL 176
            L
Sbjct: 61  AL 62


>gi|156936423|ref|YP_001440339.1| putative DNA uptake protein [Cronobacter sakazakii ATCC BAA-894]
 gi|166990524|sp|A7ME80|NFUA_ENTS8 RecName: Full=Fe/S biogenesis protein nfuA
 gi|156534677|gb|ABU79503.1| hypothetical protein ESA_04324 [Cronobacter sakazakii ATCC BAA-894]
          Length = 191

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 45/108 (41%), Gaps = 3/108 (2%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           +    +       LG        +    +   D+ +++R++ +L +++ P +A  GG + 
Sbjct: 72  YLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVT 131

Query: 142 FKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
                D     L   G C+GC     TLK G+   L +  PE+K +R 
Sbjct: 132 LMEITDEGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRD 179


>gi|212640233|ref|YP_002316753.1| thioredoxin-like protein [Anoxybacillus flavithermus WK1]
 gi|212561713|gb|ACJ34768.1| Thioredoxin-like protein [Anoxybacillus flavithermus WK1]
          Length = 80

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVA 173
           D  + Q+++EVLD  +RP + RDGGD       DG+V L + GAC  CPS++ TLK G+ 
Sbjct: 5   DQDIKQQVQEVLDK-LRPFLLRDGGDCELVDVEDGVVKLRLLGACGSCPSSTITLKAGIE 63

Query: 174 NIL 176
             L
Sbjct: 64  RAL 66


>gi|270308880|ref|YP_003330938.1| NifU domain protein [Dehalococcoides sp. VS]
 gi|270154772|gb|ACZ62610.1| NifU domain protein [Dehalococcoides sp. VS]
          Length = 72

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + +++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL   +PE
Sbjct: 6   EAVLDKIRPALEADGGNVELVDVVDGVVKVKLVGACAGCPMSTMTLKNGIERILKREIPE 65

Query: 183 VKDIRT 188
           VK++  
Sbjct: 66  VKEVVA 71


>gi|156081764|ref|XP_001608375.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148800946|gb|EDL42351.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 191

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 5/163 (3%)

Query: 32  NAKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPI 91
           N          + + S+    +       +       D+ +    +   I     + D  
Sbjct: 22  NICSKMNMHFLNYVVSLNKCLATKTANRILFSTSKNADYVNYVNEINNFIDAFQKNSDDS 81

Query: 92  IHNGG---LGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFK--GYR 146
             +G        K+ +    +  E    ++  IK +++ RVRP +  DGGDI F      
Sbjct: 82  SSSGENILSILQKIKNEKKYEQNEDLMEIISSIKLLIEKRVRPVIVNDGGDIKFICFDID 141

Query: 147 DGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
           DGIV++ + GAC  C  +  TL+Y + N+L +++ E+K+I+ V
Sbjct: 142 DGIVYVQLEGACVTCSQSEITLQYMIKNMLTYYISEIKEIKNV 184


>gi|72537505|gb|AAZ73682.1| hypothetical protein [Lyngbya majuscula CCAP 1446/4]
          Length = 289

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYR-DGIVFLSMRGACSGCPSASETLKYGVAN 174
            +  RI++ L+  VRP +    GD+     +    V + + G CS CP+++ TLK GV  
Sbjct: 95  PLETRIQQALEE-VRPGLKSHSGDVELVAVKLPDTVEVKLVGTCSNCPASTLTLKQGVEQ 153

Query: 175 ILNHFVPEVKDIRTV 189
            + +  PE++ + +V
Sbjct: 154 AIKNHCPEIQHVISV 168


>gi|17228187|ref|NP_484735.1| hypothetical protein alr0692 [Nostoc sp. PCC 7120]
 gi|17130037|dbj|BAB72649.1| alr0692 [Nostoc sp. PCC 7120]
          Length = 158

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 47/130 (36%), Gaps = 1/130 (0%)

Query: 61  ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120
           + VG  +   +  +  +  +I        P + N    ++    +     ++     + +
Sbjct: 28  VVVGLKRAIEDLHQEALKRLIKSVKQECLPALQNAVQDEVVYGVLLYHGLVKQPQPPLLQ 87

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGY-RDGIVFLSMRGACSGCPSASETLKYGVANILNHF 179
             +     VRP +    GD+          V +   G CS CP+++ TL  GV   +   
Sbjct: 88  RVQAALEEVRPGLKDHHGDVELVAIKPPDTVEVRFIGTCSSCPASTLTLSQGVEQAIKAL 147

Query: 180 VPEVKDIRTV 189
            PE+  +  V
Sbjct: 148 CPEIVTVIAV 157


>gi|223984131|ref|ZP_03634283.1| hypothetical protein HOLDEFILI_01575 [Holdemania filiformis DSM
           12042]
 gi|223963925|gb|EEF68285.1| hypothetical protein HOLDEFILI_01575 [Holdemania filiformis DSM
           12042]
          Length = 82

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%)

Query: 116 AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANI 175
             ++   + +  ++RP + RDGGD+ F    DGIV + M GACS C S   TLK G+  I
Sbjct: 2   ETMETQVKNVIEKIRPYIQRDGGDVEFVSLEDGIVTVKMLGACSECLSLDATLKDGIEAI 61

Query: 176 LNHFVPEVKDIR 187
           L   VP V ++R
Sbjct: 62  LLDEVPGVTEVR 73


>gi|271502336|ref|YP_003335362.1| IscR-regulated protein YhgI [Dickeya dadantii Ech586]
 gi|270345891|gb|ACZ78656.1| IscR-regulated protein YhgI [Dickeya dadantii Ech586]
          Length = 191

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 57/160 (35%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      + +   L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPNAECGVSYCPPDAVEPNDTELKFEKLSAYVDELSAPYLEDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    +   D+ +++R++ VL +++ P +A  GG +      +  
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVGDDAPLMERVEYVLQSQINPQLAGHGGRVSLMEITEEG 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
              L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 YAILQFGGGCNGCSMVDYTLKEGIEKELLEKFPELKGVRD 179


>gi|320191574|gb|EFW66224.1| NfuA Fe-S protein maturation [Escherichia coli O157:H7 str. EC1212]
          Length = 191

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 59/163 (36%), Gaps = 8/163 (4%)

Query: 34  KEAEISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISG 88
           +  E           PG  +   G  +      +     L+  +L   ++     +    
Sbjct: 17  ENQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDA 76

Query: 89  DPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR 146
           +       LG        +    +   D+ +++R++ +L +++ P +A  GG +      
Sbjct: 77  EIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEIT 136

Query: 147 DG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +     L   G C+GC     TLK G+   L +  PE+K +R 
Sbjct: 137 EDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRD 179


>gi|238754092|ref|ZP_04615450.1| Fe/S bioproteinsis protein nfuA [Yersinia ruckeri ATCC 29473]
 gi|238707588|gb|EEP99947.1| Fe/S bioproteinsis protein nfuA [Yersinia ruckeri ATCC 29473]
          Length = 191

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 56/160 (35%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQLSAYVDELSVPYLQDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGI 149
                LG        +    + D    +++R++ VL +++ P +A  GG +      D  
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDSAPLMERVEYVLQSQINPQLAGHGGRVTLMEITDDA 139

Query: 150 V-FLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|4140376|gb|AAD03815.1| NifU [Trichodesmium erythraeum IMS101]
          Length = 179

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 33/69 (47%)

Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180
           I++VL   VRP +A DGGD+         V + ++GAC  C +   TLK  +   L   V
Sbjct: 111 IQQVLQQEVRPVLAEDGGDVELFDVDGDRVLVKLKGACGSCSNVLVTLKGAIEATLKERV 170

Query: 181 PEVKDIRTV 189
            E   +  V
Sbjct: 171 SESLVVEAV 179


>gi|73749405|ref|YP_308644.1| nifU protein,-like protein [Dehalococcoides sp. CBDB1]
 gi|147670014|ref|YP_001214832.1| NifU domain-containing protein [Dehalococcoides sp. BAV1]
 gi|289433363|ref|YP_003463236.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. GT]
 gi|73661121|emb|CAI83728.1| nifU protein, homolog [Dehalococcoides sp. CBDB1]
 gi|146270962|gb|ABQ17954.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. BAV1]
 gi|288947083|gb|ADC74780.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. GT]
          Length = 72

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           E + +++RPA+  DGG++      DG+V + + GAC+GCP ++ TLK G+  IL   +PE
Sbjct: 6   EAVLDKIRPALEADGGNVELVDVVDGVVKVKLVGACAGCPMSTMTLKNGIERILKREIPE 65

Query: 183 VKDIRT 188
           +K++  
Sbjct: 66  IKEVVA 71


>gi|323436167|ref|ZP_01051062.2| NifU-like protein [Dokdonia donghaensis MED134]
 gi|321496482|gb|EAQ38213.2| NifU-like protein [Dokdonia donghaensis MED134]
          Length = 88

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 113 SDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD-GIVFLSMRGACSGCPSASETLKYG 171
           S + + Q++++ L   +RP +  DGGDI   G  D  +V + ++GAC GC     TLK G
Sbjct: 10  STAELTQKVEDAL-EEIRPFLQSDGGDISLLGIDDDRVVRVQLQGACVGCSVNQMTLKSG 68

Query: 172 VANILNHFVPEVKDIRTV 189
           V   +    P+++ +  V
Sbjct: 69  VEMTIKKHAPQIEQVINV 86


>gi|120601745|ref|YP_966145.1| NifU domain-containing protein [Desulfovibrio vulgaris DP4]
 gi|120561974|gb|ABM27718.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris DP4]
 gi|311234644|gb|ADP87498.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris RCH1]
          Length = 75

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 129 VRPAVARDGGDIVFKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187
           VRP + +DGGD+         +V + + G C GCP + +TLK  V  ++  FVP V+ + 
Sbjct: 12  VRPLLQQDGGDVELVDITPEGVVRVRLTGRCKGCPMSQKTLKNSVEKMVLKFVPAVQRVE 71

Query: 188 TV 189
            V
Sbjct: 72  AV 73


>gi|218780491|ref|YP_002431809.1| Fe-S cluster assembly protein NifU [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761875|gb|ACL04341.1| Fe-S cluster assembly protein NifU [Desulfatibacillum alkenivorans
           AK-01]
          Length = 271

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 42/102 (41%)

Query: 88  GDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRD 147
                    + D    D+       ++   +Q I+E L+  VRP + +DGGDI       
Sbjct: 170 QKCHADIQEILDSYKGDVKPKPAPLTNIRKIQLIQETLEREVRPTLKQDGGDIELVDVDG 229

Query: 148 GIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRTV 189
             V + ++G CS C ++  TLK  V   L   V +   +  V
Sbjct: 230 DKVLVRLQGRCSSCQASQATLKGHVEAKLRELVVDTLVVEEV 271


>gi|123444169|ref|YP_001008139.1| putative DNA uptake protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332163339|ref|YP_004299916.1| putative DNA uptake protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|150383451|sp|A1JSF6|NFUA_YERE8 RecName: Full=Fe/S biogenesis protein nfuA
 gi|122091130|emb|CAL14013.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607833|emb|CBY29331.1| nfua Fe-S protein maturation [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667569|gb|ADZ44213.1| putative DNA uptake protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862994|emb|CBX73127.1| Fe/S biogenesis protein nfuA [Yersinia enterocolitica W22703]
          Length = 191

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 55/160 (34%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQLSAYIDELSKPYLEDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    + D    +++R++ VL +++ P +A  GG +         
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDNAPLMERVEYVLQSQINPQLAGHGGRVTLMEITPDA 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|260599716|ref|YP_003212287.1| Fe/S biogenesis protein NfuA [Cronobacter turicensis z3032]
 gi|260218893|emb|CBA34248.1| Fe/S biogenesis protein nfuA [Cronobacter turicensis z3032]
          Length = 191

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 45/108 (41%), Gaps = 3/108 (2%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           +    +       LG        +    +   D+ +++R++ +L +++ P +A  GG + 
Sbjct: 72  YLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYLLQSQINPQLAGHGGRVT 131

Query: 142 FKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
                D     L   G C+GC     TLK G+   L +  PE+K +R 
Sbjct: 132 LMEITDEGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRD 179


>gi|262375821|ref|ZP_06069053.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309424|gb|EEY90555.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 212

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 114 DSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG-----IVFLSMRGACSGCPSASETL 168
           D++V +RI  VL + + P +A  GG+      ++         L   G C GC +   TL
Sbjct: 120 DASVEERITYVLQSEINPGLAGHGGNCALVEVKEDPEKGLTAVLKFGGGCQGCSAIDITL 179

Query: 169 KYGVANILNHFVPEVKDIRT 188
           K GV   L   VPE+  +  
Sbjct: 180 KQGVETTLKQHVPELMHVVD 199


>gi|238751155|ref|ZP_04612650.1| Fe/S bioproteinsis protein nfuA [Yersinia rohdei ATCC 43380]
 gi|238710633|gb|EEQ02856.1| Fe/S bioproteinsis protein nfuA [Yersinia rohdei ATCC 43380]
          Length = 191

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 55/160 (34%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQLSAYIDELSKPYLEDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    + D    +++R++ VL +++ P +A  GG +         
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDTAPLMERVEYVLQSQINPQLAGHGGRVTLMEITPDA 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|22127773|ref|NP_671196.1| putative DNA uptake protein [Yersinia pestis KIM 10]
 gi|45439990|ref|NP_991529.1| putative DNA uptake protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51598063|ref|YP_072254.1| DNA uptake protein [Yersinia pseudotuberculosis IP 32953]
 gi|108809333|ref|YP_653249.1| putative DNA uptake protein [Yersinia pestis Antiqua]
 gi|108814098|ref|YP_649865.1| putative DNA uptake protein [Yersinia pestis Nepal516]
 gi|145597377|ref|YP_001161452.1| putative DNA uptake protein [Yersinia pestis Pestoides F]
 gi|150260809|ref|ZP_01917537.1| predicted gluconate transport associated protein [Yersinia pestis
           CA88-4125]
 gi|153947285|ref|YP_001402938.1| DNA uptake protein [Yersinia pseudotuberculosis IP 31758]
 gi|162421404|ref|YP_001608065.1| putative DNA uptake protein [Yersinia pestis Angola]
 gi|165928048|ref|ZP_02223880.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936266|ref|ZP_02224835.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010431|ref|ZP_02231329.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166214579|ref|ZP_02240614.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399248|ref|ZP_02304772.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419001|ref|ZP_02310754.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426539|ref|ZP_02318292.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167468684|ref|ZP_02333388.1| hesB-like domain/nifU-like domain protein [Yersinia pestis FV-1]
 gi|170022424|ref|YP_001718929.1| putative DNA uptake protein [Yersinia pseudotuberculosis YPIII]
 gi|186897263|ref|YP_001874375.1| putative DNA uptake protein [Yersinia pseudotuberculosis PB1/+]
 gi|218927338|ref|YP_002345213.1| putative DNA uptake protein [Yersinia pestis CO92]
 gi|229836393|ref|ZP_04456560.1| predicted gluconate transport associated protein [Yersinia pestis
           Pestoides A]
 gi|229839982|ref|ZP_04460141.1| predicted gluconate transport associated protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229842063|ref|ZP_04462218.1| predicted gluconate transport associated protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229904636|ref|ZP_04519747.1| predicted gluconate transport associated protein [Yersinia pestis
           Nepal516]
 gi|270488149|ref|ZP_06205223.1| IscR-regulated protein YhgI [Yersinia pestis KIM D27]
 gi|294502220|ref|YP_003566282.1| hypothetical protein YPZ3_0110 [Yersinia pestis Z176003]
 gi|51702126|sp|Q8ZJI0|NFUA_YERPE RecName: Full=Fe/S biogenesis protein nfuA
 gi|81638196|sp|Q664J6|NFUA_YERPS RecName: Full=Fe/S biogenesis protein nfuA
 gi|119370621|sp|Q1C2L8|NFUA_YERPA RecName: Full=Fe/S biogenesis protein nfuA
 gi|119370622|sp|Q1CCL5|NFUA_YERPN RecName: Full=Fe/S biogenesis protein nfuA
 gi|166990533|sp|A7FNW0|NFUA_YERP3 RecName: Full=Fe/S biogenesis protein nfuA
 gi|166990534|sp|A4TGR7|NFUA_YERPP RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767339|sp|B2K5V9|NFUA_YERPB RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767340|sp|A9R4D2|NFUA_YERPG RecName: Full=Fe/S biogenesis protein nfuA
 gi|254767341|sp|B1JHZ3|NFUA_YERPY RecName: Full=Fe/S biogenesis protein nfuA
 gi|21960901|gb|AAM87447.1|AE013995_2 hypothetical protein y3903 [Yersinia pestis KIM 10]
 gi|45434845|gb|AAS60406.1| Thioredoxin-like proteins and domains [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51591345|emb|CAH23011.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777746|gb|ABG20265.1| hypothetical protein YPN_3938 [Yersinia pestis Nepal516]
 gi|108781246|gb|ABG15304.1| hypothetical protein YPA_3342 [Yersinia pestis Antiqua]
 gi|115345949|emb|CAL18813.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209073|gb|ABP38480.1| hypothetical protein YPDSF_0054 [Yersinia pestis Pestoides F]
 gi|149290217|gb|EDM40294.1| predicted gluconate transport associated protein [Yersinia pestis
           CA88-4125]
 gi|152958780|gb|ABS46241.1| hesB-like domain/nifU-like domain protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|162354219|gb|ABX88167.1| hesB-like domain/nifU-like domain protein [Yersinia pestis Angola]
 gi|165915880|gb|EDR34488.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165919997|gb|EDR37298.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990521|gb|EDR42822.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204234|gb|EDR48714.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962995|gb|EDR59016.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051752|gb|EDR63160.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054527|gb|EDR64335.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169748958|gb|ACA66476.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis YPIII]
 gi|186700289|gb|ACC90918.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis PB1/+]
 gi|229678754|gb|EEO74859.1| predicted gluconate transport associated protein [Yersinia pestis
           Nepal516]
 gi|229690373|gb|EEO82427.1| predicted gluconate transport associated protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696348|gb|EEO86395.1| predicted gluconate transport associated protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229706461|gb|EEO92468.1| predicted gluconate transport associated protein [Yersinia pestis
           Pestoides A]
 gi|262360299|gb|ACY57020.1| hypothetical protein YPD4_0111 [Yersinia pestis D106004]
 gi|262364249|gb|ACY60806.1| hypothetical protein YPD8_0116 [Yersinia pestis D182038]
 gi|270336653|gb|EFA47430.1| IscR-regulated protein YhgI [Yersinia pestis KIM D27]
 gi|294352679|gb|ADE63020.1| hypothetical protein YPZ3_0110 [Yersinia pestis Z176003]
 gi|320013262|gb|ADV96833.1| putative DNA uptake protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 191

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 55/160 (34%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQLSAYVDELSVPYLQDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    + D    +++R++ VL +++ P +A  GG +         
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDSAPLMERVEYVLQSQINPQLAGHGGRVTLMEITPEG 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|311747521|ref|ZP_07721306.1| NifU domain protein [Algoriphagus sp. PR1]
 gi|126574883|gb|EAZ79254.1| NifU domain protein [Algoriphagus sp. PR1]
          Length = 82

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 115 SAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIV-FLSMRGACSGCPSASETLKYGVA 173
           + +  +I+  LD  +RP +  DGG++      + +V  + M G+C  CP +S TLK GV 
Sbjct: 3   TELKNKIEFALDT-IRPYLEADGGNVRIVELTEDMVLRIEMLGSCGSCPMSSMTLKAGVE 61

Query: 174 NILNHFVPEVKDIRTV 189
           + +   +PE+  +  +
Sbjct: 62  DAIKRAIPEITKVEAI 77


>gi|326494232|dbj|BAJ90385.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 224

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 123 EVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPE 182
           + + + VRP +  DGGD+      DG+V L + GACS CPS++ T+  G+  +L     +
Sbjct: 82  DRVLDDVRPYLISDGGDVAVVSVEDGVVSLRLEGACSSCPSSTTTMNMGIERVLKEKFGD 141

Query: 183 -VKDIRTV 189
            +KDIR V
Sbjct: 142 AIKDIRQV 149


>gi|238788981|ref|ZP_04632771.1| Fe/S bioproteinsis protein nfuA [Yersinia frederiksenii ATCC 33641]
 gi|238723008|gb|EEQ14658.1| Fe/S bioproteinsis protein nfuA [Yersinia frederiksenii ATCC 33641]
          Length = 191

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 55/160 (34%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   L   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQLSAYVDELSVPYLEDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    + D    +++R++ VL +++ P +A  GG +         
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDNAPLMERVEYVLQSQINPQLASHGGRVTLMEITPDA 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|238786223|ref|ZP_04630170.1| Fe/S bioproteinsis protein nfuA [Yersinia bercovieri ATCC 43970]
 gi|238797310|ref|ZP_04640811.1| Fe/S bioproteinsis protein nfuA [Yersinia mollaretii ATCC 43969]
 gi|238712864|gb|EEQ04929.1| Fe/S bioproteinsis protein nfuA [Yersinia bercovieri ATCC 43970]
 gi|238718947|gb|EEQ10762.1| Fe/S bioproteinsis protein nfuA [Yersinia mollaretii ATCC 43969]
          Length = 191

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 55/160 (34%), Gaps = 8/160 (5%)

Query: 37  EISPLASRIFSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIME-----HFISGDPI 91
           E           PG  +   G  +      +     L+   +   ++     +    +  
Sbjct: 20  EEGTQIRVFVINPGTPTAECGVSYCPPDAVEATDTELKFEQISAYVDELSKPYLEDAEID 79

Query: 92  IHNGGLGDMKLDDMGSGDFIESDS--AVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDG- 148
                LG        +    + D    +++R++ VL +++ P +A  GG +         
Sbjct: 80  FVTDQLGSQLTLKAPNAKMRKVDDTAPLMERVEYVLQSQINPQLAGHGGRVTLMEITPDA 139

Query: 149 IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
           +  L   G C+GC     TLK G+   L    PE+K +R 
Sbjct: 140 LAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGVRD 179


>gi|320181906|gb|EFW56812.1| NfuA Fe-S protein maturation [Shigella boydii ATCC 9905]
          Length = 191

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 45/108 (41%), Gaps = 3/108 (2%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           +    +       LG        +    +   D+ +++R++ +L +++ P +A  GG + 
Sbjct: 72  YLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVS 131

Query: 142 FKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
                +     L   G C+GC     TLK G+   L +  PE+K +R 
Sbjct: 132 LMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRD 179


>gi|331649212|ref|ZP_08350298.1| IscR-regulated protein YhgI [Escherichia coli M605]
 gi|331041710|gb|EGI13854.1| IscR-regulated protein YhgI [Escherichia coli M605]
          Length = 191

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 45/108 (41%), Gaps = 3/108 (2%)

Query: 84  HFISGDPIIHNGGLGDMKLDDMGSGDFIE--SDSAVVQRIKEVLDNRVRPAVARDGGDIV 141
           +    +       LG        +    +   D+ +++R++ +L +++ P +A  GG + 
Sbjct: 72  YLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVS 131

Query: 142 FKGYRDG-IVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188
                +     L   G C+GC     TLK G+   L +  PE+K +R 
Sbjct: 132 LMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRD 179


>gi|15803918|ref|NP_289954.1| putative DNA uptake protein [Escherichia coli O157:H7 EDL933]
 gi|15833510|ref|NP_312283.1| DNA uptake protein [Escherichia coli O157:H7 str. Sakai]
 gi|16131290|ref|NP_417873.1| Fe/S biogenesis protein; possible scaffold/chaperone for damaged
           Fe/S proteins [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24114681|ref|NP_709191.1| putative DNA uptake protein [Shigella flexneri 2a str. 301]
 gi|26250015|ref|NP_756055.1| putative DNA uptake protein [Escherichia coli CFT073]
 gi|30065301|ref|NP_839472.1| putative DNA uptake protein [Shigella flexneri 2a str. 2457T]
 gi|74313917|ref|YP_312336.1| putative DNA uptake protein [Shigella sonnei Ss046]
 gi|82545771|ref|YP_409718.1| DNA uptake protein [Shigella boydii Sb227]
 gi|82778770|ref|YP_405119.1| putative DNA uptake protein [Shigella dysenteriae Sd197]
 gi|89110596|ref|AP_004376.1| predicted gluconate transport associated protein [Escherichia coli
           str. K-12 substr. W3110]
 gi|91212889|ref|YP_542875.1| putative DNA uptake protein [Escherichia coli UTI89]
 gi|110643647|ref|YP_671377.1| putative DNA uptake protein [Escherichia coli 536]
 gi|110807249|ref|YP_690769.1| putative DNA uptake protein [Shigella flexneri 5 str. 8401]
 gi|117625679|ref|YP_859002.1| putative DNA uptake protein [Escherichia coli APEC O1]
 gi|157155730|ref|YP_001464872.1| putative DNA uptake protein [Escherichia coli E24377A]
 gi|157162891|ref|YP_001460209.1| putative DNA uptake protein [Escherichia coli HS]
 gi|168747108|ref|ZP_02772130.1| protein GntY [Escherichia coli O157:H7 str. EC4113]
 gi|168753167|ref|ZP_02778174.1| protein GntY [Escherichia coli O157:H7 str. EC4401]
 gi|168759439|ref|ZP_02784446.1| protein GntY [Escherichia coli O157:H7 str. EC4501]
 gi|168765762|ref|ZP_02790769.1| protein GntY [Escherichia coli O157:H7 str. EC4486]
 gi|168772693|ref|ZP_02797700.1| protein GntY [Escherichia coli O157:H7 str. EC4196]
 gi|168779498|ref|ZP_02804505.1| protein GntY [Escherichia coli O157:H7 str. EC4076]
 gi|168785219|ref|ZP_02810226.1| protein GntY [Escherichia coli O157:H7 str. EC869]
 gi|168797185|ref|ZP_02822192.1| protein GntY [Escherichia coli O157:H7 str. EC508]
 gi|170018350|ref|YP_001723304.1| putative DNA uptake protein [Escherichia coli ATCC 8739]
 gi|170082930|ref|YP_001732250.1| gluconate transport associated protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681204|ref|YP_001745662.1| putative DNA uptake protein [Escherichia coli SMS-3-5]
 gi|170766983|ref|ZP_02901436.1| protein GntY [Escherichia albertii TW07627]
 gi|187731025|ref|YP_001882093.1| putative DNA uptake protein [Shigella boydii CDC 3083-94]
 gi|188492005|ref|ZP_02999275.1| protein GntY [Escherichia coli 53638]
 gi|191167295|ref|ZP_03029112.1| protein GntY [Escherichia coli B7A]
 gi|191167903|ref|ZP_03029707.1| protein GntY [Escherichia coli B7A]
 gi|191171521|ref|ZP_03033069.1| protein GntY [Escherichia coli F11]
 gi|193061845|ref|ZP_03042942.1| protein GntY [Escherichia coli E22]
 gi|193068805|ref|ZP_03049765.1| protein GntY [Escherichia coli E110019]
 gi|194426967|ref|ZP_03059519.1| protein GntY [Escherichia coli B171]
 gi|194435891|ref|ZP_03067994.1| protein GntY [Escherichia coli 101-1]
 gi|195934903|ref|ZP_03080285.1| putative DNA uptake protein [Escherichia coli O157:H7 str. EC4024]
 gi|208809095|ref|ZP_03251432.1| protein GntY [Escherichia coli O157:H7 str. EC4206]
 gi|208811856|ref|ZP_03253185.1| protein GntY [Escherichia coli O157:H7 str. EC4045]
 gi|208821055|ref|ZP_03261375.1| protein GntY [Escherichia coli O157:H7 str. EC4042]
 gi|209396437|ref|YP_002272850.1| protein GntY [Escherichia coli O157:H7 str. EC4115]
 gi|209920872|ref|YP_002294956.1| putative DNA uptake protein [Escherichia coli SE11]
 gi|215488695|ref|YP_002331126.1| putative DNA uptake protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217325780|ref|ZP_03441864.1| protein GntY [Escherichia coli O157:H7 str. TW14588]
 gi|218550672|ref|YP_002384463.1| DNA uptake protein [Escherichia fergusonii ATCC 35469]
 gi|218555963|ref|YP_002388876.1| putative DNA uptake protein [Escherichia coli IAI1]
 gi|218560472|ref|YP_002393385.1| DNA uptake protein [Escherichia coli S88]
 gi|218691690|ref|YP_002399902.1| putative DNA uptake protein [Escherichia coli ED1a]
 gi|218697097|ref|YP_002404764.1| putative DNA uptake protein [Escherichia coli 55989]
 gi|218707005|ref|YP_002414524.1| putative DNA uptake protein [Escherichia coli UMN026]
 gi|227883548|ref|ZP_04001353.1| HesB family protein [Escherichia coli 83972]
 gi|237703145|ref|ZP_04533626.1| Fe/S biogenesis protein nfuA [Escherichia sp. 3_2_53FAA]
 gi|238902505|ref|YP_002928301.1| putative gluconate transport associated protein [Escherichia coli
           BW2952]
 gi|253771757|ref|YP_003034588.1| DNA uptake protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254038582|ref|ZP_04872638.1| GntY [Escherichia sp. 1_1_43]
 gi|254163342|ref|YP_003046450.1| putative DNA uptake protein [Escherichia coli B str. REL606]
 gi|254795329|ref|YP_003080166.1| putative DNA uptake protein [Escherichia coli O157:H7 str. TW14359]
 gi|256020759|ref|ZP_05434624.1| putative DNA uptake protein [Shigella sp. D9]
 gi|256025858|ref|ZP_05439723.1| putative DNA uptake protein [Escherichia sp. 4_1_40B]
 gi|260846198|ref|YP_003223976.1| putative gluconate transport associated protein [Escherichia coli
           O103:H2 str. 12009]
 gi|260857521|ref|YP_003231412.1| putative gluconate transport associated protein [Escherichia coli
           O26:H11 str. 11368]
 gi|260870140|ref|YP_003236542.1| putative gluconate transport associated protein [Escherichia coli
           O111:H- str. 11128]
 gi|261224695|ref|ZP_05938976.1| predicted gluconate transport associated protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261254410|ref|ZP_05946943.1| putative gluconate transport associated protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284750|ref|YP_003501568.1| Fe/S biogenesis protein nfuA [Escherichia coli O55:H7 str. CB9615]
 gi|293406992|ref|ZP_06650916.1| DNA uptake protein [Escherichia coli FVEC1412]
 gi|293412832|ref|ZP_06655500.1| IscR-regulated protein YhgI [Escherichia coli B354]
 gi|293416816|ref|ZP_06659453.1| IscR-regulated protein YhgI [Escherichia coli B185]
 gi|293453720|ref|ZP_06664139.1| IscR-regulated protein YhgI [Escherichia coli B088]
 gi|298382734|ref|ZP_06992329.1| DNA uptake protein [Escherichia coli FVEC1302]
 gi|300815387|ref|ZP_07095612.1| IscR-regulated protein YhgI [Escherichia coli MS 107-1]
 gi|300822787|ref|ZP_07102924.1| IscR-regulated protein YhgI [Escherichia coli MS 119-7]
 gi|300898897|ref|ZP_07117198.1| IscR-regulated protein YhgI [Escherichia coli MS 198-1]
 gi|300907442|ref|ZP_07125089.1| IscR-regulated protein YhgI [Escherichia coli MS 84-1]
 gi|300919299|ref|ZP_07135813.1| IscR-regulated protein YhgI [Escherichia coli MS 115-1]
 gi|300926895|ref|ZP_07142661.1| IscR-regulated protein YhgI [Escherichia coli MS 182-1]
 gi|300931053|ref|ZP_07146409.1| IscR-regulated protein YhgI [Escherichia coli MS 187-1]
 gi|300937287|ref|ZP_07152130.1| IscR-regulated protein YhgI [Escherichia coli MS 21-1]
 gi|300946843|ref|ZP_07161084.1| IscR-regulated protein YhgI [Escherichia coli MS 116-1]
 gi|300956744|ref|ZP_07169013.1| IscR-regulated protein YhgI [Escherichia coli MS 175-1]
 gi|300985358|ref|ZP_07177414.1| IscR-regulated protein YhgI [Escherichia coli MS 45-1]
 gi|300987300|ref|ZP_07178108.1| IscR-regulated protein YhgI [Escherichia coli MS 200-1]
 gi|301019565|ref|ZP_07183727.1| IscR-regulated protein YhgI [Escherichia coli MS 69-1]
 gi|301023028|ref|ZP_07186838.1| IscR-regulated protein YhgI [Escherichia coli MS 196-1]
 gi|301050374|ref|ZP_07197263.1| IscR-regulated protein YhgI [Escherichia coli MS 185-1]
 gi|301302293|ref|ZP_07208425.1| IscR-regulated protein YhgI [Escherichia coli MS 124-1]
 gi|301329725|ref|ZP_07222468.1| IscR-regulated protein YhgI [Escherichia coli MS 78-1]
 gi|301645854|ref|ZP_07245768.1| IscR-regulated protein YhgI [Escherichia coli MS 146-1]
 gi|306816248|ref|ZP_07450386.1| putative DNA uptake protein [Escherichia coli NC101]
 gi|307140100|ref|ZP_07499456.1| putative DNA uptake protein [Escherichia coli H736]
 gi|307311921|ref|ZP_07591559.1| IscR-regulated protein YhgI [Escherichia coli W]
 gi|309785841|ref|ZP_07680472.1| nifU-like domain protein [Shigella dysenteriae 1617]
 gi|309794685|ref|ZP_07689107.1| IscR-regulated protein YhgI [Escherichia coli MS 145-7]
 gi|312968274|ref|ZP_07782484.1| nifU-like domain protein [Escherichia coli 2362-75]
 gi|312972322|ref|ZP_07786496.1| nifU-like domain protein [Escherichia coli 1827-70]
 gi|331644114|ref|ZP_08345243.1| IscR-regulated protein YhgI [Escherichia coli H736]
 gi|331654992|ref|ZP_08355991.1| IscR-regulated protein YhgI [Escherichia coli M718]
 gi|331659703|ref|ZP_08360641.1| IscR-regulated protein YhgI [Escherichia coli TA206]
 gi|331665020|ref|ZP_08365921.1| IscR-regulated protein YhgI [Escherichia coli TA143]
 gi|331670236|ref|ZP_08371075.1| IscR-regulated protein YhgI [Escherichia coli TA271]
 gi|331674902|ref|ZP_08375659.1| IscR-regulated protein YhgI [Escherichia coli TA280]
 gi|331679478|ref|ZP_08380148.1| IscR-regulated protein YhgI [Escherichia coli H591]
 gi|331685056|ref|ZP_08385642.1| IscR-regulated protein YhgI [Escherichia coli H299]
 gi|332281961