RPSBLAST alignment for GI: 254780430 and conserved domain: COG0694

>gnl|CDD|31038 COG0694, COG0694, Thioredoxin-like proteins and domains [Posttranslational modification, protein turnover, chaperones]. Length = 93
 Score = 90.4 bits (224), Expect = 2e-19
 Identities = 37/82 (45%), Positives = 57/82 (69%), Gaps = 2/82 (2%)

Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASET 167
             E+D+ +++R++EVLD ++RP +A DGGD+   G    DG+V+L + GACSGCPS++ T
Sbjct: 3   MEETDAELLERVEEVLDEKIRPQLAMDGGDVELVGIDEEDGVVYLRLGGACSGCPSSTVT 62

Query: 168 LKYGVANILNHFVPEVKDIRTV 189
           LK G+   L   +PEVK++  V
Sbjct: 63  LKNGIERQLKEEIPEVKEVEQV 84