RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] (189 letters) >gnl|CDD|37569 KOG2358, KOG2358, KOG2358, NifU-like domain-containing proteins [Posttranslational modification, protein turnover, chaperones]. Length = 213 Score = 140 bits (355), Expect = 2e-34 Identities = 76/195 (38%), Positives = 112/195 (57%), Gaps = 12/195 (6%) Query: 1 MFIQTEDTPNPATLKFIPGQVVLVE-GAIHFSNAKEAEISPLASRIFSI-PGIASVYFGY 58 MFIQT+ TPNP++L F+PG+ +L E G F+ A SPLA I G+ V+FG Sbjct: 10 MFIQTQITPNPSSLLFLPGKQILSERGLGDFATPCSAFFSPLAKSILFRDGGVVKVFFGP 69 Query: 59 DFITVGK--DQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSA 116 DF+TV K ++ W L P + ++ + G P+I +G + +KL ESD Sbjct: 70 DFVTVTKLTEENVWSVLDPEIPSLMSDGGNVGLPLI-DGNIVVLKLQGA-----CESDPE 123 Query: 117 VVQRIKEVLDNRVRPAVARDGGDIVFKGYRD--GIVFLSMRGACSGCPSASETLKYGVAN 174 IKE+++ R+RP + DGGD + G+ G+V L ++GAC+ CPS+ TLK G+ N Sbjct: 124 STMTIKELIETRIRPKIQEDGGDEDYVGFETGLGLVSLKLQGACTECPSSLVTLKNGIEN 183 Query: 175 ILNHFVPEVKDIRTV 189 +L +VPEVK + V Sbjct: 184 MLEIYVPEVKGVIQV 198 >gnl|CDD|31038 COG0694, COG0694, Thioredoxin-like proteins and domains [Posttranslational modification, protein turnover, chaperones]. Length = 93 Score = 90.4 bits (224), Expect = 2e-19 Identities = 37/82 (45%), Positives = 57/82 (69%), Gaps = 2/82 (2%) Query: 110 FIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYR--DGIVFLSMRGACSGCPSASET 167 E+D+ +++R++EVLD ++RP +A DGGD+ G DG+V+L + GACSGCPS++ T Sbjct: 3 MEETDAELLERVEEVLDEKIRPQLAMDGGDVELVGIDEEDGVVYLRLGGACSGCPSSTVT 62 Query: 168 LKYGVANILNHFVPEVKDIRTV 189 LK G+ L +PEVK++ V Sbjct: 63 LKNGIERQLKEEIPEVKEVEQV 84 >gnl|CDD|144628 pfam01106, NifU, NifU-like domain. This is an alignment of the carboxy-terminal domain. This is the only common region between the NifU protein from nitrogen-fixing bacteria and rhodobacterial species. The biochemical function of NifU is unknown. Length = 68 Score = 68.4 bits (168), Expect = 1e-12 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180 I+EV+D +RP + RDGGDI IV + ++GAC GC S++ TLK G+ L + Sbjct: 1 IEEVID-EIRPMLQRDGGDIELVDVDGDIVKVRLQGACGGCMSSTMTLKGGIERKLRERL 59 Query: 181 PEVK 184 E Sbjct: 60 GESL 63 >gnl|CDD|37645 KOG2434, KOG2434, KOG2434, RNA polymerase I transcription factor [Transcription]. Length = 500 Score = 29.6 bits (66), Expect = 0.60 Identities = 14/62 (22%), Positives = 22/62 (35%), Gaps = 9/62 (14%) Query: 73 LRPPVLGMIMEHFISGDPIIHN----GGLGDMKLDD-----MGSGDFIESDSAVVQRIKE 123 + +L ++E I D I G+ DM+ DD SG + V I Sbjct: 188 IGKDILEAVIERLIDLDVEIETDDSSSGMFDMETDDAEELETFSGMERNQANPVTIGITR 247 Query: 124 VL 125 + Sbjct: 248 LS 249 >gnl|CDD|146279 pfam03557, Bunya_G1, Bunyavirus glycoprotein G1. Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This family contains the G1 glycoprotein which is the viral attachment protein. Length = 871 Score = 28.1 bits (63), Expect = 1.6 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 138 GDIVFKGYRDGIVFLSMRGACSGCPSASE 166 GDI +K + + I L G C GC + E Sbjct: 741 GDIRYKTFAESID-LEAEGKCVGCINCFE 768 >gnl|CDD|29121 cd02046, hsp47, Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen. It has been shown to be essential for collagen biosynthesis, but its exact function is still unclear. Hsp47 is a non-inhibitory member of the SERPIN superfamily and corresponds to clade H.. Length = 366 Score = 26.6 bits (58), Expect = 4.8 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 41 LASRIFSIPGIASVYFGYDFITVGKDQYDWEH 72 + +R++ G +SV F DF+ K Y++EH Sbjct: 90 IGNRLY---GPSSVSFADDFVKNSKKHYNYEH 118 >gnl|CDD|34806 COG5209, RCD1, Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only]. Length = 315 Score = 26.5 bits (58), Expect = 5.0 Identities = 9/40 (22%), Positives = 15/40 (37%) Query: 55 YFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHN 94 F Y F+ +E+LR LG+I + + Sbjct: 144 LFLYPFLNTSSSNSKFEYLRLTSLGVIGALVKNDSQYVIK 183 >gnl|CDD|37291 KOG2080, KOG2080, KOG2080, Uncharacterized conserved protein, contains DENN and RUN domains [Signal transduction mechanisms]. Length = 1295 Score = 26.2 bits (57), Expect = 5.2 Identities = 15/64 (23%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Query: 61 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLG-----DMKLDDMGSGDFIESDS 115 IT + W+H+ P+L + HF+ P+ + GL ++L + F++ D+ Sbjct: 356 ITSLLFPFQWQHVYVPILPASLLHFLDA-PVPYLMGLHSDDRSKLELPQEANLCFVDIDN 414 Query: 116 AVVQ 119 +Q Sbjct: 415 HFIQ 418 >gnl|CDD|38980 KOG3776, KOG3776, KOG3776, Plasma membrane glycoprotein CD36 and related membrane receptors [Signal transduction mechanisms]. Length = 507 Score = 26.1 bits (57), Expect = 6.1 Identities = 12/61 (19%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Query: 128 RVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIR 187 +P V G+++F GY D ++ P + ++G+ N V + Sbjct: 168 GEKPFVTVTVGELLFDGYEDPLL----SLINRFVPIKPPSPRFGLFYGYNGTSDGVYTVN 223 Query: 188 T 188 T Sbjct: 224 T 224 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.142 0.424 Gapped Lambda K H 0.267 0.0698 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,397,929 Number of extensions: 127430 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's gapped: 276 Number of HSP's successfully gapped: 18 Length of query: 189 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 101 Effective length of database: 4,362,145 Effective search space: 440576645 Effective search space used: 440576645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (24.6 bits)