RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] (189 letters) >gnl|CDD|149691 pfam08712, Nfu_N, Scaffold protein Nfu/NifU N terminal. This domain is found at the N terminus of NifU and NifU related proteins, and in the human Nfu protein. Both of these proteins are thought to be involved in the the assembly of iron-sulphur clusters. Length = 87 Score = 142 bits (360), Expect = 6e-35 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 1/87 (1%) Query: 3 IQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDFIT 62 IQTE TPNP TLKF+PG+ VL EG F NA EAE SPLA ++F IPG+ SV+FG DFIT Sbjct: 1 IQTESTPNPNTLKFLPGKEVLPEGTFEFKNADEAEGSPLAQKLFKIPGVKSVFFGDDFIT 60 Query: 63 VGK-DQYDWEHLRPPVLGMIMEHFISG 88 V K D DW+ L+P VL IMEH SG Sbjct: 61 VTKADDADWDDLKPEVLEAIMEHLESG 87 >gnl|CDD|162652 TIGR02000, NifU_proper, Fe-S cluster assembly protein NifU. Three different but partially homologous Fe-S cluster assembly systems have been described: Isc, Suf, and Nif. The latter is associated with donation of an Fe-S cluster to nitrogenase in a number of nitrogen-fixing species. NifU, described here, consists of an N-terminal domain (pfam01592) and a C-terminal domain (pfam01106). Homologs with an equivalent domain archictecture from Helicobacter and Campylobacter, however, are excluded from this model by a high trusted cutoff. The model, therefore, is specific for NifU involved in nitrogenase maturation. The related model TIGR01999 homologous to the N-terminus of this model describes IscU from the Isc system as in E. coli, Saccharomyces cerevisiae, and Homo sapiens. Length = 290 Score = 46.0 bits (109), Expect = 5e-06 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Query: 118 VQRIKEVLD--NRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLK 169 VQRI+ + VRP + DGGD+ IV++ + GACSGC ++ TLK Sbjct: 218 VQRIQLIQKVLEEVRPVLQADGGDVELYDVDGKIVYVVLTGACSGCSMSTMTLK 271 >gnl|CDD|132384 TIGR03341, YhgI_GntY, IscR-regulated protein YhgI. IscR (TIGR02010) is an iron-sulfur cluster-binding transcriptional regulator (see Genome Property GenProp0138). Members of this protein family include YhgI, whose expression is under control of IscR, and show sequence similarity to IscA, a known protein of iron-sulfur cluster biosynthesis. These two lines of evidence strongly suggest a role as an iron-sulfur cluster biosynthesis protein. An older study designated this protein GntY and suggested a role for it and for the product of an adjacent gene, based on complementation studies, in gluconate utilization. Length = 190 Score = 45.4 bits (108), Expect = 9e-06 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDI-VFKGYRDGIVFLSMRGACSGCPSASETLK 169 + D+ + +RI VL + + P +A GG + + + DG+ L G C+GC TLK Sbjct: 100 VADDAPLEERINYVLQSEINPQLASHGGKVTLVEITDDGVAVLQFGGGCNGCSMVDVTLK 159 Query: 170 YGVANILNHFVPEVKDIR 187 GV L PE+K +R Sbjct: 160 DGVEKTLLERFPELKGVR 177 >gnl|CDD|183027 PRK11190, PRK11190, Fe/S biogenesis protein NfuA; Provisional. Length = 192 Score = 38.5 bits (90), Expect = 0.001 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Query: 111 IESDSAVVQRIKEVLDNRVRPAVARDGGDIVF-KGYRDGIVFLSMRGACSGCPSASETLK 169 + D+ +++R++ VL +++ P +A GG + + DG L G C+GC TLK Sbjct: 101 VADDAPLMERVEYVLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLK 160 Query: 170 YGV-ANILNHFVPEVKDIRTV 189 G+ +LN F E+K +R + Sbjct: 161 EGIEKQLLNEFPGELKGVRDL 181 >gnl|CDD|166487 PLN02846, PLN02846, digalactosyldiacylglycerol synthase. Length = 462 Score = 32.5 bits (74), Expect = 0.071 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 7/79 (8%) Query: 93 HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL 152 H L +++D GSG+ DS V+ E L+ VR RD D +F Y+ VFL Sbjct: 253 HQKELSGLEVDLYGSGE----DSDEVKAAAEKLELDVRVYPGRDHADPLFHDYK---VFL 305 Query: 153 SMRGACSGCPSASETLKYG 171 + C + +E L G Sbjct: 306 NPSTTDVVCTTTAEALAMG 324 >gnl|CDD|132152 TIGR03108, eps_aminotran_1, exosortase 1 system-associated amidotransferase 1. The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins. Length = 628 Score = 27.4 bits (61), Expect = 2.5 Identities = 13/27 (48%), Positives = 18/27 (66%) Query: 120 RIKEVLDNRVRPAVARDGGDIVFKGYR 146 R+ E+ RV A++ DGGD +F GYR Sbjct: 349 RVCELARKRVTVALSGDGGDELFAGYR 375 >gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase. Length = 529 Score = 27.0 bits (60), Expect = 2.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 19 GQVVLVEGAIHFSNAKEAEISPLASRIFSIPG 50 G + +E + S + A SPLA ++F + G Sbjct: 355 GAISAIEDGLRASGSSPASGSPLAGKLFVVIG 386 >gnl|CDD|179616 PRK03635, PRK03635, chromosome replication initiation inhibitor protein; Validated. Length = 294 Score = 25.9 bits (58), Expect = 5.9 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 7/39 (17%) Query: 115 SAVVQRIK-------EVLDNRVRPAVARDGGDIVFKGYR 146 SAV QRIK +VL R +P + G + + R Sbjct: 31 SAVSQRIKALEERVGQVLLVRTQPCRPTEAGQRLLRHAR 69 >gnl|CDD|180801 PRK07033, PRK07033, hypothetical protein; Provisional. Length = 427 Score = 25.8 bits (57), Expect = 6.5 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 106 GSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMR 155 G G F S S V+ + + RV A+ + G+++ GY D + + R Sbjct: 314 GDGLF-ASASTSVRDRYQPVLARVADALNQVKGNVLVTGYSDNVPIRTAR 362 >gnl|CDD|177938 PLN02303, PLN02303, urease. Length = 837 Score = 25.9 bits (57), Expect = 7.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 102 LDDMGSGDFIESDSAVVQRIKEVL 125 L DMG+ I SDS + RI EV+ Sbjct: 618 LHDMGAISIISSDSQAMGRIGEVI 641 >gnl|CDD|179209 PRK01029, tolB, translocation protein TolB; Provisional. Length = 428 Score = 25.9 bits (57), Expect = 7.4 Identities = 11/42 (26%), Positives = 17/42 (40%), Gaps = 11/42 (26%) Query: 45 IFSIPGIASVYFGYDFITVGKDQ-----------YDWEHLRP 75 + +PGI+S + T D YD ++LRP Sbjct: 138 LTGVPGISSGKIIFSLSTTNSDTELKQGELWSVDYDGQNLRP 179 >gnl|CDD|179115 PRK00767, PRK00767, transcriptional regulator BetI; Validated. Length = 197 Score = 25.6 bits (57), Expect = 9.1 Identities = 12/35 (34%), Positives = 14/35 (40%), Gaps = 15/35 (42%) Query: 33 AKEAEISPLASRIFSIPGIASVYFGYDFITVGKDQ 67 A+ A +S GI S YFG GKD Sbjct: 36 ARRAGVST---------GIISHYFG------GKDG 55 >gnl|CDD|152009 pfam11573, Med23, Mediator complex subunit 23. Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice. Length = 1341 Score = 25.2 bits (55), Expect = 9.6 Identities = 6/27 (22%), Positives = 14/27 (51%) Query: 67 QYDWEHLRPPVLGMIMEHFISGDPIIH 93 Q+ W HL ++ ++ F + I++ Sbjct: 337 QWQWLHLSSQLIYFVLFQFANFKNIVN 363 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.142 0.424 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,229,020 Number of extensions: 207983 Number of successful extensions: 411 Number of sequences better than 10.0: 1 Number of HSP's gapped: 408 Number of HSP's successfully gapped: 21 Length of query: 189 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 101 Effective length of database: 4,092,969 Effective search space: 413389869 Effective search space used: 413389869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (24.6 bits)