RPSBLAST alignment of GI: 254780430 and SCOP domain: d1veha_

Alignment
>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92
 Score =  104 bits (260), Expect = 6e-24
 Identities = 38/78 (48%), Positives = 56/78 (71%)

Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171
           E D  VV  IKE+LD R+RP V  DGGD++++G+ DGIV L ++G+C+ CPS+  TLK G
Sbjct: 9   EEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSG 68

Query: 172 VANILNHFVPEVKDIRTV 189
           + N+L  ++PEV+ +  V
Sbjct: 69  IQNMLQFYIPEVEGVEQV 86

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Fe-S cluster assembly (FSCA) domain-like
family: NifU C-terminal domain-like
domain: HIRA-interacting protein 5, HIRIP5
species: Mouse (Mus musculus) [TaxId: 10090]