BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] (189 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 387 bits (994), Expect = e-110, Method: Compositional matrix adjust. Identities = 189/189 (100%), Positives = 189/189 (100%) Query: 1 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF Sbjct: 1 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60 Query: 61 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR Sbjct: 61 ITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDDMGSGDFIESDSAVVQR 120 Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV Sbjct: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFV 180 Query: 181 PEVKDIRTV 189 PEVKDIRTV Sbjct: 181 PEVKDIRTV 189 >gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 28.1 bits (61), Expect = 0.100, Method: Compositional matrix adjust. Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188 VR V +D +I F + +L+ + + + LK +AN+ ++ D+RT Sbjct: 6 VRQKVQKDSVEIRFTKLETALPYLATKADLADVRTE---LKQDIANVRTELKADIADVRT 62 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 25.0 bits (53), Expect = 0.76, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 90 PIIHN-GGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNR 128 PII N LG + G+ F+ES Q+I +VL+ R Sbjct: 1048 PIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGR 1087 >gi|254780320|ref|YP_003064733.1| translation initiation factor IF-3 [Candidatus Liberibacter asiaticus str. psy62] Length = 136 Score = 22.7 bits (47), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 100 MKLDDMGSGDFIESDSAVVQRIKEVLDNR-VRPAVARDGGDIVFKGYRDGIVFLSMR 155 M++ + D +E DS+V + ++LD R +R + ++ + K GI + MR Sbjct: 1 MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMR 57 >gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 154 Score = 22.7 bits (47), Expect = 4.3, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 7 DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASR 44 D PN A L+ IP Q + + F+ + + P+ S+ Sbjct: 20 DDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQ 57 >gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 22.3 bits (46), Expect = 6.0, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 45 IFSIPGIASVYFGYDFITVGKDQYDWE 71 + I + ++Y GYD+ VG D E Sbjct: 170 LLWISALLTIYSGYDYFRVGIKHIDSE 196 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 21.6 bits (44), Expect = 9.0, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 156 GACSGCPSASETLKYGVANILNHFVPEVK 184 G+C+G + + L G+AN + + E K Sbjct: 120 GSCAGIEATTGPLGQGIANAVGMAIAERK 148 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.142 0.424 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 124,640 Number of Sequences: 1233 Number of extensions: 5176 Number of successful extensions: 15 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 9 length of query: 189 length of database: 328,796 effective HSP length: 69 effective length of query: 120 effective length of database: 243,719 effective search space: 29246280 effective search space used: 29246280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)