RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >3ebe_A Protein MCM10 homolog; OB-fold, zinc finger, CCCH, DNA replication, metal-binding, nucleus, zinc, zinc-finger; 2.30A {Xenopus laevis} PDB: 3h15_A Length = 200 Score = 27.8 bits (62), Expect = 1.3 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 11/43 (25%) Query: 140 KDFSFCGS-----DVCN------DSPYCDYHKKLAYQRVNDRR 171 D C + D C D YC YH + Y++V+ +R Sbjct: 149 VDLGTCKARKKNGDPCTQMVNLNDCEYCQYHVQAQYKKVSSKR 191 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 26.1 bits (57), Expect = 4.6 Identities = 11/51 (21%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Query: 60 NRKNVTL---GSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNT 107 N N+T+ G + R++ + I E ++ G+L ++++ K + +++T Sbjct: 1668 NPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKL---KTEKIFKEINEHST 1715 >2q1z_A RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc binding transcription factor; 2.40A {Rhodobacter sphaeroides 2} PDB: 2z2s_A Length = 184 Score = 25.7 bits (55), Expect = 5.4 Identities = 3/42 (7%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Query: 1 MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHR 42 + +++ + L+ ++A + G+ + ++ Sbjct: 134 ARLPEAQRALIERAFFGDLTHRELAAET-GLPLGTIKSRIRL 174 >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative stress, transcription regulation; 2.35A {Mycobacterium tuberculosis} Length = 92 Score = 25.7 bits (57), Expect = 6.3 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 G S +QIA L G+ V +LH Sbjct: 52 RGWSTAQIATDL-GIAEGTVKSRLHY 76 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.132 0.395 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,418,874 Number of extensions: 57255 Number of successful extensions: 128 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 8 Length of query: 178 Length of database: 5,693,230 Length adjustment: 86 Effective length of query: 92 Effective length of database: 3,608,246 Effective search space: 331958632 Effective search space used: 331958632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.2 bits)