RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Length = 43 Score = 29.2 bits (66), Expect = 0.20 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 4 TVERIDKLKKFWSEGLSASQIAVQLGGVTRNAV 36 ++R D + W +GL AS I+ + + R+ V Sbjct: 5 KIDR-DAVLNMWQQGLGASHISKTM-NIARSTV 35 >d2oz4a2 b.1.1.4 (A:186-282) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Score = 25.2 bits (55), Expect = 3.4 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 20 SASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRK---NVTLGSTSPKTRQS 76 S +Q+ + LG N + S + V+ + +G ++ V LG+ S +T Q+ Sbjct: 34 SEAQVHLALGDQRLNPTV-TYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQT 92 Query: 77 SNVY 80 +Y Sbjct: 93 VTIY 96 >d1sxjd1 a.80.1.1 (D:263-353) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 Score = 24.4 bits (53), Expect = 5.8 Identities = 7/23 (30%), Positives = 10/23 (43%) Query: 6 ERIDKLKKFWSEGLSASQIAVQL 28 E + F G SA+ + QL Sbjct: 20 EIKKYVNTFMKSGWSAASVVNQL 42 >d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Score = 24.0 bits (52), Expect = 6.8 Identities = 5/49 (10%), Positives = 14/49 (28%), Gaps = 3/49 (6%) Query: 123 MELTDNTCKWPLGDPFGKDFSFCGSD---VCNDSPYCDYHKKLAYQRVN 168 E ++ + G +F D + +L + ++ Sbjct: 64 QEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLS 112 >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Length = 263 Score = 24.0 bits (51), Expect = 8.4 Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 4/21 (19%) Query: 149 VCNDSPYCDYHKKL-AYQRVN 168 VC P CD+H ++ A R++ Sbjct: 23 VC---PKCDHHMRMTARNRLH 40 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.132 0.395 Gapped Lambda K H 0.267 0.0628 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 613,370 Number of extensions: 24959 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 7 Length of query: 178 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 98 Effective length of database: 1,309,196 Effective search space: 128301208 Effective search space used: 128301208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)