BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 368 bits (944), Expect = e-104, Method: Compositional matrix adjust. Identities = 178/178 (100%), Positives = 178/178 (100%) Query: 1 MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGN 60 MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGN Sbjct: 1 MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGN 60 Query: 61 RKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCL 120 RKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCL Sbjct: 61 RKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCL 120 Query: 121 RLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE 178 RLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE Sbjct: 121 RLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE 178 >gi|254780404|ref|YP_003064817.1| inositol monophosphatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 286 Score = 29.3 bits (64), Expect = 0.038, Method: Compositional matrix adjust. Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 22/169 (13%) Query: 2 VWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNR 61 ++ V+ ID + F EG + I+V + R VIG +H L V+ +S N Sbjct: 110 LFVVDPIDGTRAF-IEGRNEWCISVAVVHHGR-PVIGVVHASALGKEFFVSVGMKSTCNG 167 Query: 62 KNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLR 121 KN+++ +S + S + + LKG VR +R+S +IS S CLR Sbjct: 168 KNISV--SSNQMSDSLAIMASDVSLKGLDSYVRFRRQS-------SIS-------SLCLR 211 Query: 122 LMELTDNTCKWPLGDPFGKDFSFCGSDV---CNDSPYCDYHKK-LAYQR 166 ++ + + D D+ +D+ C+ D +K L Y R Sbjct: 212 ILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNR 260 >gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 26.2 bits (56), Expect = 0.33, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 3 WTVERIDKLKKFWSEGLSASQIAVQL 28 WT E + + K FWSEG S ++A + Sbjct: 174 WTKEDMQQFKSFWSEG-SQPRLAFEF 198 >gi|254780290|ref|YP_003064703.1| quinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] Length = 332 Score = 25.0 bits (53), Expect = 0.73, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 78 NVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLP 115 N ++ PV+ LP+ + MEK+ I I+LP Sbjct: 295 NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 >gi|254780625|ref|YP_003065038.1| formamidopyrimidine-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 24.3 bits (51), Expect = 1.3, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Query: 78 NVYICEPVLKGQLPVVRSKRKSKSMEKNN 106 N+Y+CE + + +L + RK++S+ +NN Sbjct: 182 NIYVCEALWRAKLSPI---RKTRSLIQNN 207 >gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 188 Score = 23.9 bits (50), Expect = 1.6, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 74 RQSSNVYICEPVLK---GQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDN 128 R+ S + E LK G+ V R+ ++ E + I+SG ++ I+ +R + TD+ Sbjct: 70 RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127 >gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Score = 23.1 bits (48), Expect = 3.4, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 8/34 (23%) Query: 18 GLSASQIAVQLGGVTRNAVI--------GKLHRL 43 G++A Q+ +++GG++ N ++ G+LH L Sbjct: 499 GITAMQMDMKIGGISENIMVMALQQAKRGRLHIL 532 >gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 22.3 bits (46), Expect = 5.2, Method: Compositional matrix adjust. Identities = 11/53 (20%), Positives = 29/53 (54%) Query: 73 TRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMEL 125 ++Q++ + I ++ ++ + + ++ ME+ + SG+ L I RL++L Sbjct: 231 SQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDL 283 >gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Score = 21.9 bits (45), Expect = 6.5, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 3 WTVERIDKLKKFWSEGLSASQ 23 +T ERID + +S GLS SQ Sbjct: 6 YTKERIDNILASFSGGLSLSQ 26 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.132 0.395 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,553 Number of Sequences: 1233 Number of extensions: 4142 Number of successful extensions: 13 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 10 length of query: 178 length of database: 328,796 effective HSP length: 68 effective length of query: 110 effective length of database: 244,952 effective search space: 26944720 effective search space used: 26944720 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)