HHsearch alignment for GI: 254780432 and conserved domain: COG0001

>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=543.50  Aligned_cols=366  Identities=30%  Similarity=0.434  Sum_probs=313.2

Q ss_pred             CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC-CCC
Q ss_conf             8748985010379967997646410226743578789999999999997314506875781899999865201013-331
Q gi|254780432|r   14 SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA-DRV   92 (392)
Q Consensus        14 ~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~-~~v   92 (392)
T Consensus        35 ~P~fi~~g~Ga~l~DvDGn~YIDy~~~~Gp~ilGH~~p~V~~Av~~~l~~G~~--fg~Pte~Ei~~Aell~~~~p~~e~v  112 (432)
T COG0001          35 YPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLS--FGAPTELEVELAELLIERVPSIEKV  112 (432)
T ss_pred             CCEEEEECCCCEEEECCCCEEEEHHCCCCCCCCCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             98467745578699479987540130576500088987999999999972677--7899778999999999865865089


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC-----CCCCCCCCCHH
Q ss_conf             23565554035677766543200134786002343546565432123455--321134799986-----43332221002
Q gi|254780432|r   93 FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAG--GKLQYLEGFGPK-----IEGFDQAKFCD  165 (392)
Q Consensus        93 ~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s--~~~~~~~~~~p~-----~~~~~~~~~~d  165 (392)
T Consensus       113 rfvnSGTEAtmsAiRlARa~------TgR~kIikF~G~YHG~~D~~lv~agsg~~t~g~p~s~Gvp~~~a~~ti~~~yND  186 (432)
T COG0001         113 RFVNSGTEATMSAIRLARAY------TGRDKIIKFEGCYHGHSDSLLVKAGSGAATLGSPSSPGVPADVAKHTLVLPYND  186 (432)
T ss_pred             EEECCHHHHHHHHHHHHHHH------HCCCEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCHHHHCCEEEECCCC
T ss_conf             98606408999999999876------479759997288888711878426767555789999999734534478845799


Q ss_pred             HHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             68875410---123322223332222112462101232211022345721310110034444555310111245453021
Q gi|254780432|r  166 LQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT  242 (392)
Q Consensus       166 ~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~  242 (392)
T Consensus       187 ~~al~~~~~~~g~~IAaVIvEPv~gn~g~i~p~~~Fl~~Lr~lt~e~G~lLI~DEViTGF-R~~~gGaq~~~gi~PDltt  265 (432)
T COG0001         187 LEALEEAFEEYGDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGF-RVALGGAQGYYGVEPDLTT  265 (432)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHC-CCCCCCCCCCCCCCCCHHH
T ss_conf             999999998768967999954246788989898789999999999719489986221204-5477642010086963332


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             034444443443210001112222233---22345321111001233455432012-22101121000026889999886
Q gi|254780432|r  243 IAKGMGGGFPIGACLATNEVAACMNQG---SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNR  318 (392)
Q Consensus       243 ~gK~l~gG~P~sav~~~~~i~~~~~~~---~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~  318 (392)
T Consensus       266 lGKiIGGGlP~ga~gGr~eiM~~~~p~g~vyqaGT~sgnplamaAG~atl~~l~~~~~~y~~l~~~~~~L~~gl~~~~~~  345 (432)
T COG0001         266 LGKIIGGGLPIGAFGGRAEIMEQLAPLGPVYQAGTLSGNPLAMAAGLATLEELMTEEGVYERLDALGERLAEGLRAAAER  345 (432)
T ss_pred             HHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             22440477520112569999963277887645677788689999999999998736518999999999999999999998


Q ss_pred             CCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             79707550464009998724998---------------999999996898996268988995589868899999999999
Q gi|254780432|r  319 FPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       319 ~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
T Consensus       346 ~-g~~~~v~~~gsm~~i~F~~~~~~n~~da~~sd~~~~~~~~~~~l~~GV~l~ps~~ea~flS~a--hte~di~~~~~a~  422 (432)
T COG0001         346 H-GIPLTVNRVGSMFGIFFTEEGVRNYADAKRSDVERFAKFFHHLLNRGVYLAPSQFEAGFLSTA--HTEEDIDRTLEAA  422 (432)
T ss_pred             H-CCCEEEEEECCEEEEEECCCCCCCHHHHHHHCHHHHHHHHHHHHHCCCCCCCCCCCCEEEECC--CCHHHHHHHHHHH
T ss_conf             3-998588620425899955899888999986356999999999996882347755554552004--6899999999999


Q ss_pred             HHHHHHHC
Q ss_conf             99999852
Q gi|254780432|r  384 ERTAIKLS  391 (392)
Q Consensus       384 ~~al~~L~  391 (392)
T Consensus       423 ~~~~~~~~  430 (432)
T COG0001         423 DEAFKELA  430 (432)
T ss_pred             HHHHHHHH
T ss_conf             99999863