HHsearch alignment for GI: 254780432 and conserved domain: COG0403

>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism].
Probab=98.15  E-value=0.00014  Score=50.47  Aligned_cols=316  Identities=21%  Similarity=0.245  Sum_probs=167.5

Q ss_pred             ECHHHHHHHCCCCCCHHHHH-HHHHHHHHC-CCCCC-CCCCHH-HHH------HHHHHHHHCCCC--CCCCCCCCCCCHH
Q ss_conf             41022674357878999999-999999731-45068-757818-999------998652010133--3123565554035
Q gi|254780432|r   36 DFASGIAVNSLGHSHPELVA-ILKSQSEKL-WHVSN-LYQSTQ-QEI------FANHLIHSTFAD--RVFFTNSGAESVE  103 (392)
Q Consensus        36 D~~~g~~~~~lGh~~p~i~~-a~~~q~~~~-~~~~~-~~~~~~-~~~------la~~L~~~~~~~--~v~f~~SGseA~e  103 (392)
T Consensus        75 ~~~sfiG~GyY~~~~P~vI~rnil---e~pewyTaYTPYQpEISQGrLqaLfefQtlv~dLTGm~VANASm~DeaTAaAE  151 (450)
T COG0403          75 VFTSFIGAGYYDTYTPPVILRNIL---ENPEWYTAYTPYQPEISQGRLEALFEFQTLVADLTGLDVANASMLDEATAAAE  151 (450)
T ss_pred             HHHHHCCCCCCCCCCCHHHHHHHH---CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             145425686468718278888764---38542236788863666579999998999999985887445002316769999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             67776654320013478600234354656543212345532113479998643332221002688754101233222233
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE  183 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~E  183 (392)
T Consensus       152 Am~-ma~r~~k----~k~~~~~V-~~~vhpqt~~Vl-----~Tra~~~g---~~i~~~~~~d~~~l~~~~~~~~~gv~vQ  217 (450)
T COG0403         152 AML-MAKRVTK----KKRNKFLV-PKDVHPQTLDVL-----RTRAEGLG---IEIEVVDADDLDDLESADDGDVFGVLVQ  217 (450)
T ss_pred             HHH-HHHHHHC----CCCCEEEE-CCCCCHHHHHHH-----HHHCCCCC---EEEEEECCCHHHHHHHCCCCCEEEEEEE
T ss_conf             999-9987414----76734996-688687799999-----86112576---3999956422556653246773799997


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEE--CCCCCCCCC-CCCCCCCCCCCCCCCEEE-----CCCCCCCCCC-CC
Q ss_conf             32222112462101232211022345721310--110034444-555310111245453021-----0344444434-43
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIF--DEVQTGYGR-TGKLFAYEWANVKPDIMT-----IAKGMGGGFP-IG  254 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~--DEV~tG~GR-tG~~f~~e~~gi~PDi~~-----~gK~l~gG~P-~s  254 (392)
T Consensus       218 yP~~~-G~~~---~d~~~l~~~~h~~~al~~v~aDplaL~LL~pPGe~------G--ADIvvG~~QrfGvPmgfGGPhag  285 (450)
T COG0403         218 YPNTF-GIVE---EDLRALIEAAHSAGALVIVAADPLALGLLKPPGEF------G--ADIVVGSAQRFGVPMGFGGPHAG  285 (450)
T ss_pred             CCCCC-CCCC---HHHHHHHHHHHHCCCEEEEEECHHHHHCCCCCCCC------C--CCEEEECCCCCCCCCCCCCCCEE
T ss_conf             68887-7341---40999999986359779998263676455784103------7--86697337604777678875632


Q ss_pred             CCCCCCCCCCCCCCCC-CCCCC--CC--------------------------C--CCCHHHHHHHHHHHHCCC---CCCH
Q ss_conf             2100011122222332-23453--21--------------------------1--110012334554320122---2101
Q gi|254780432|r  255 ACLATNEVAACMNQGS-HGSTY--GG--------------------------N--VLAMVLGEKVLNIIQSDG---FLEN  300 (392)
Q Consensus       255 av~~~~~i~~~~~~~~-~~~T~--~g--------------------------n--pl~~aaa~a~L~~l~~~~---l~~~  300 (392)
T Consensus       286 ~fA~~~~~~R~m-PGRlVG~S~D~~G~~A~rLaLQTREQHIRReKATSNICTnQaLlA~~As~y~~-~hGp~GLk~iA~r  363 (450)
T COG0403         286 YFAVKDEFKRQM-PGRLVGVSVDAAGKRAFRLALQTREQHIRREKATSNICTNQALLALAASMYAV-YHGPQGLKEIAER  363 (450)
T ss_pred             EEEEHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHH
T ss_conf             223758674259-98433046458998032012877888876400101554899999999999999-8696889999999


Q ss_pred             HHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHH
Q ss_conf             1210000268899998867970755046400999872499---8999999996898996268988995589868899999
Q gi|254780432|r  301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIH  377 (392)
Q Consensus       301 ~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid  377 (392)
T Consensus       364 ~~~~a~~la~~L~~~~~-----g~~~~~~~fFdt~~v~~~~~~~~~l~~~~~~~G~~L~~~~~~~~~ia~tEt~t~~~i~  438 (450)
T COG0403         364 IHRLAAYLAAGLKEIGA-----GVELVFDHFFDTFTVRVPEEVAEALLAAAIAGGINLRRVDADTVLIALTETTTKEDID  438 (450)
T ss_pred             HHHHHHHHHHHHHHCCC-----CEEECCCCCEEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCEEEEEECCCCHHHHH
T ss_conf             99999999998764588-----6475142422048886463679999999985497414544881599951256789999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254780432|r  378 EGLERIERTA  387 (392)
Q Consensus       378 ~~i~~l~~al  387 (392)
T Consensus       439 ~l~~~~~~~~  448 (450)
T COG0403         439 ALVAAFGGVN  448 (450)
T ss_pred             HHHHHHHHHC
T ss_conf             9999975331