HHsearch alignment for GI: 254780432 and conserved domain: KOG1359

>KOG1359 consensus.
Probab=99.72  E-value=3.4e-16  Score=126.32  Aligned_cols=331  Identities=18%  Similarity=0.230  Sum_probs=207.7

Q ss_pred             CEEEEEECCCEEEECCC--CEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--CC---CCCHHHHHHHHHHHHH
Q ss_conf             74898501037996799--76464102267435787-89999999999997314506--87---5781899999865201
Q gi|254780432|r   15 DIRFEKGKGAWLFSENG--IPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--NL---YQSTQQEIFANHLIHS   86 (392)
Q Consensus        15 p~~i~~a~G~~i~d~dG--~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~~---~~~~~~~~la~~L~~~   86 (392)
T Consensus        49 erVi~s~q~p~i~-v~G~~k~ilnFca---NnYLGLsshPeii~a~~~aleeyGaGlssvrfIcGtq~iHk~LE~kiAqf  124 (417)
T KOG1359          49 ERVITSRQGPTIQ-VKGSDKKILNFCA---NNYLGLSSHPEIINAGQKALEEYGAGLSSVRFICGTQDIHKLLESKIAQF  124 (417)
T ss_pred             EEEEEECCCCEEE-EECCCCCEEEECC---CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             0588614564499-8126655044224---54334457838889899999982878643168844557999999999987


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCHH
Q ss_conf             0133312356555403567776654320013478600234354656543212345532113479998643-332221002
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE-GFDQAKFCD  165 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~-~~~~~~~~d  165 (392)
T Consensus       125 h~rED~ilypscfdANag~feai--------l~pedAvfSDeLN-hAS----I-IdGi---------rLckry~h~dv~~  181 (417)
T KOG1359         125 HGREDTILYPSCFDANAGAFEAI--------LTPEDAVFSDELN-HAS----I-IDGI---------RLCKRYRHVDVFD  181 (417)
T ss_pred             HCCCCEEEECCCCCCCHHHHHHH--------CCHHHHHHCCCCC-CCH----H-HHHH---------HHHHHHCCCHHHH
T ss_conf             08775487331003443778774--------4825412100002-203----4-3246---------7776644512677


Q ss_pred             HHHHHH-HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC-CCCC-CCCCCCCCCCCCCC--CCCE
Q ss_conf             688754-10123322223332222112462101232211022345721310110-0344-44555310111245--4530
Q gi|254780432|r  166 LQSLKN-QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV-QTGY-GRTGKLFAYEWANV--KPDI  240 (392)
Q Consensus       166 ~~~l~~-~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV-~tG~-GRtG~~f~~e~~gi--~PDi  240 (392)
T Consensus       182 l~~~l~~a~k~r~klv~TDg~FSMDGdiaP----l~ei~~La~kYgaLlfiDecHaTgf~G~tGrG-t~E~~~vm~~vdi  256 (417)
T KOG1359         182 LEHCLISACKMRLKLVVTDGVFSMDGDIAP----LEEISQLAKKYGALLFIDECHATGFFGETGRG-TAEEFGVMGDVDI  256 (417)
T ss_pred             HHHHHHHHHHHEEEEEEECCEECCCCCCCC----HHHHHHHHHHCCCEEEEEECCCCEEECCCCCC-HHHHHCCCCCCEE
T ss_conf             888777743321799985461214787333----89999999862937998604310565578887-3887377776402


Q ss_pred             E--ECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHH-CCCCCCHHHHHCCHHHHHH
Q ss_conf             2--10344444---4344321000111222223322345321--1110012334554320-1222101121000026889
Q gi|254780432|r  241 M--TIAKGMGG---GFPIGACLATNEVAACMNQGSHGSTYGG--NVLAMVLGEKVLNIIQ-SDGFLENVINIAKILFEGL  312 (392)
Q Consensus       241 ~--~~gK~l~g---G~P~sav~~~~~i~~~~~~~~~~~T~~g--npl~~aaa~a~L~~l~-~~~l~~~~~~~g~~l~~~L  312 (392)
T Consensus       257 insTLgKAlGga~GGy----ttgp~~li~llrqr~RpylFSnslppavV~~a~ka~dllm~s~~~i~~~~a~~qrfr~~m  332 (417)
T KOG1359         257 INSTLGKALGGASGGY----TTGPKPLISLLRQRSRPYLFSNSLPPAVVGMAAKAYDLLMVSSKEIQSRQANTQRFREFM  332 (417)
T ss_pred             HHHHHHHHHCCCCCCC----CCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0424566624777887----468756899998528861421789805541569999999864799998988999999988


Q ss_pred             HHHHHHCCCEEEEECCC-----EEEEEEEECCCHHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHH
Q ss_conf             99988679707550464-----00999872499899999999689899626-------8988995589868899999999
Q gi|254780432|r  313 TAIKNRFPNMFLEVRGQ-----GLLIGLKTVFSPALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       313 ~~l~~~~~~~v~~vRG~-----Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i  380 (392)
T Consensus       333 e~a-----G-f-tIsg~~hPI~pv~lG--da~lA~~~ad~lLk~Gi~Vigfs~PvVP~gkariRVqiSAaHt~edid~~i  403 (417)
T KOG1359         333 EAA-----G-F-TISGASHPICPVMLG--DARLASKMADELLKRGIYVIGFSYPVVPKGKARIRVQISAAHTEEDIDRLI  403 (417)
T ss_pred             HHC-----C-C-EECCCCCCCCCEECC--CHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEEEHHCCHHHHHHHH
T ss_conf             752-----8-2-431788874232316--388888889999855716986258767888447999970104788899999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999985
Q gi|254780432|r  381 ERIERTAIKL  390 (392)
Q Consensus       381 ~~l~~al~~L  390 (392)
T Consensus       404 ~Af~~vgr~~  413 (417)
T KOG1359         404 EAFSEVGRFL  413 (417)
T ss_pred             HHHHHHHHHH
T ss_conf             9999988752