HHsearch alignment for GI: 254780432 and conserved domain: PRK00011

>PRK00011 glyA serine hydroxymethyltransferase; Reviewed.
Probab=98.05  E-value=0.00061  Score=46.20  Aligned_cols=278  Identities=19%  Similarity=0.254  Sum_probs=135.5

Q ss_pred             HHHCCCCCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123-5655540356777665432001347860023435465654-3212-3455321134799986433322
Q gi|254780432|r   84 IHSTFADRVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR-TLAT-ISAGGKLQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        84 ~~~~~~~~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~-t~~a-~s~s~~~~~~~~~~p~~~~~~~  160 (392)
T Consensus        81 ~~lF~a~~anVqp~SGs~AN~av~~al-------l~PG-D~im~l~l~~GGHltHg~~~~~~~~~~~~~~y-~~d~~~~~  151 (415)
T PRK00011         81 KKLFGAEYANVQPHSGSQANAAVYFAL-------LKPG-DTILGMDLAHGGHLTHGSPVNFSGKLYNVVSY-GVDEETGL  151 (415)
T ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHHHH-------CCCC-CEEEECCCCCCCCCCCCCCCCCCCCEEEEEEE-EECCCCCC
T ss_conf             998389860567786399999999996-------2789-85876686667876578675544652478986-78643481


Q ss_pred             CCCHHHHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             2100268875410-123322223332222112462101232211022345721310110-03444455531011124545
Q gi|254780432|r  161 AKFCDLQSLKNQI-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV-QTGYGRTGKLFAYEWANVKP  238 (392)
Q Consensus       161 ~~~~d~~~l~~~~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV-~tG~GRtG~~f~~e~~gi~P  238 (392)
T Consensus       152 I---Dyd~~~~~a~~~kPklIi~G~-----S~y~r~~d-~~~~reIad~vgA~l~~D~aHi~GLIA~g~-~~~P-l~-~A  219 (415)
T PRK00011        152 I---DYDEVEKLALEHKPKLIIAGA-----SAYSRPID-FKKFREIADEVGAYLMVDMAHIAGLVAAGV-HPNP-VP-HA  219 (415)
T ss_pred             C---CHHHHHHHHHHHCCCEEEECC-----CCCCCCCC-HHHHHHHHHHHCCEEEEEHHHHHHHHHCCC-CCCC-CC-CC
T ss_conf             6---799999999860998899646-----13533128-899999999709889945355666664333-7996-67-75


Q ss_pred             CEEECC--CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHCC---CCCCHHHHHCCHHHHH
Q ss_conf             302103--44444434432-10001112222233223453211110012334-55432012---2210112100002688
Q gi|254780432|r  239 DIMTIA--KGMGGGFPIGA-CLATNEVAACMNQGSHGSTYGGNVLAMVLGEK-VLNIIQSD---GFLENVINIAKILFEG  311 (392)
Q Consensus       239 Di~~~g--K~l~gG~P~sa-v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a-~L~~l~~~---~l~~~~~~~g~~l~~~  311 (392)
T Consensus       220 Dvvt~tTHKTlrG--PrGGiIl~~~e~~~kId~aVFPg~qggph~h~iAa~Aval~Ea~~~~f~~Ya~qVv~NAk~La~~  297 (415)
T PRK00011        220 DVVTTTTHKTLRG--PRGGLILTNEELAKKINSAVFPGIQGGPLMHVIAAKAVAFKEALEPEFKEYAQQVVKNAKALAEA  297 (415)
T ss_pred             EEEECCCCCCCCC--CCCEEEEECCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_conf             6885453346789--88607973406666654120753146804778999999999984741899999999999999999


Q ss_pred             HHHHHHHCCCEEEEECCCE-EEEEEEEC---CCHHHHHHHHHHCCEEEE----ECC------CCEEEECCC-CC---CCH
Q ss_conf             9999886797075504640-09998724---998999999996898996----268------988995589-86---889
Q gi|254780432|r  312 LTAIKNRFPNMFLEVRGQG-LLIGLKTV---FSPALLAAKFRDECLLTA----PSS------DNVVRILPP-LT---ITA  373 (392)
Q Consensus       312 L~~l~~~~~~~v~~vRG~G-l~~~ie~~---~~~~~~~~~l~~~Gll~~----~~~------~~~irl~Pp-l~---it~  373 (392)
T Consensus       298 L~~~--G~-~vv~--ggTdnHlvlvdl~~~g~~G~~a~~~Le~~gI~vNkn~iP~d~~~~~~~SGiRiGt~a~TtrG~~e  372 (415)
T PRK00011        298 LQER--GF-KVVS--GGTDNHLVLVDLRKKGLTGKDAEAALEEANITVNKNAIPFDPRSPFVTSGIRIGTPAITTRGFKE  372 (415)
T ss_pred             HHHC--CC-EEEE--CCCCCCEEEEECCCCCCCHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCEEECCHHHHHCCCCH
T ss_conf             9768--97-7971--79877447764564568899999999985908755879899999888860143678897489988


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999998
Q gi|254780432|r  374 EEIHEGLERIERTAIK  389 (392)
Q Consensus       374 ~eid~~i~~l~~al~~  389 (392)
T Consensus       373 ~em~~ia~~I~~~l~~  388 (415)
T PRK00011        373 AEMEEIAELIADVLDN  388 (415)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             9999999999999837